F436172

General Info

Members Datasets Scaffolds Average Seq Length
406 198 406 183

Family's Representative Sequence

Representative Sequence 3300006173|Ga0070716_101076355|Ga0070716_1010763551
Length 198
Sequence VSNVASLASAVSLLRFEGVTLRRGGRLLFENLDLTVNAGERLQLTGPNGTGKSSLLRLAAGLLRQERGRIERAPLALADEHVALDRERPLIAALGFWSGFGGSNERLEFALNTLDLAGLIPIPVRLLSAGQLKRATLARVVGTGAPLWLLDEPLNGLDRGGLDDLEELLDWHTAQGGAVVAASHLVLPGDWRQLEVGH

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
7 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
92 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
93 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
169 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
170 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
171 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
172 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
173 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
174 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
175 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
176 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
179 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
180 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
181 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
182 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
183 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
184 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
185 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
186 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
187 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
188 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
189 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.99
Nodule 0
Rhizoplane 1.97
Rhizosphere 96.8
Stem 0
Stem Tuber 0
Unclassified 0.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1016893 3300001904 Bacteria 1159
2 JGI24740J21852_10014073 3300001979 Bacteria 2963
3 JGI24739J22299_10001357 3300001989 Bacteria 9185
4 JGI24737J22298_10001192 3300001990 Bacteria 9171
5 JGI24737J22298_10005149 3300001990 Bacteria 4526
6 JGI24737J22298_10019149 3300001990 Bacteria 2190
7 JGI24735J21928_10111490 3300002067 Bacteria 787
8 JGI24745J21846_1024168 3300002073 Bacteria 720
9 JGI24035J26624_1003800 3300002126 Bacteria 1429
10 JGI24742J22300_10021943 3300002244 Bacteria 1092
11 JGI25165J46597_1000040 3300003214 Bacteria 277491
12 Ga0070658_10075942 3300005327 Bacteria 2756
13 Ga0070658_10090684 3300005327 Bacteria 2518
14 Ga0070658_10098575 3300005327 Bacteria 2414
15 Ga0070658_10120693 3300005327 Bacteria 2178
16 Ga0070658_10215808 3300005327 Bacteria 1621
17 Ga0070658_10392880 3300005327 Bacteria 1191
18 Ga0070658_10433550 3300005327 Bacteria 1131
19 Ga0070676_10000328 3300005328 Bacteria 21565
20 Ga0070676_10012034 3300005328 Bacteria 4715
21 Ga0070676_10967688 3300005328 Bacteria 637
22 Ga0070683_100649092 3300005329 Bacteria 1010
23 Ga0070690_100086058 3300005330 Bacteria 2063
24 Ga0070670_100001101 3300005331 Bacteria 21478
25 Ga0070670_100022850 3300005331 Bacteria 5381
26 Ga0070670_100233677 3300005331 Bacteria 1600
27 Ga0070677_10171750 3300005333 Bacteria 1025
28 Ga0068869_100000037 3300005334 Bacteria 54729
29 Ga0070666_10028508 3300005335 Bacteria 3664
30 Ga0070666_10037936 3300005335 Bacteria 3205
31 Ga0070666_10039080 3300005335 Bacteria 3161
32 Ga0070680_100003004 3300005336 Bacteria 12527
33 Ga0070680_100310025 3300005336 Bacteria 1339
34 Ga0068868_100003289 3300005338 Bacteria 11252
35 Ga0070660_100014087 3300005339 Bacteria 5756
36 Ga0070660_100031231 3300005339 Bacteria 3999
37 Ga0070660_100084070 3300005339 Bacteria 2501
38 Ga0070660_100088578 3300005339 Bacteria 2437
39 Ga0070689_100035844 3300005340 Bacteria 3791
40 Ga0070691_10060374 3300005341 Bacteria 1822
41 Ga0070661_100077432 3300005344 Bacteria 2451
42 Ga0070661_100080475 3300005344 Bacteria 2404
43 Ga0070661_100388856 3300005344 Bacteria 1101
44 Ga0070668_100147108 3300005347 Bacteria 1902
45 Ga0070669_100000553 3300005353 Bacteria 27761
46 Ga0070669_100132178 3300005353 Bacteria 1916
47 Ga0070669_100244232 3300005353 Bacteria 1427
48 Ga0070669_100766397 3300005353 Unclassified 818
49 Ga0070675_100005630 3300005354 Bacteria 9593
50 Ga0070675_100006324 3300005354 Bacteria 9092
51 Ga0070675_100100684 3300005354 Bacteria 2433
52 Ga0070675_101092376 3300005354 Bacteria 733
53 Ga0070671_100000868 3300005355 Bacteria 22106
54 Ga0070671_100017714 3300005355 Bacteria 5773
55 Ga0070671_100070782 3300005355 Bacteria 2910
56 Ga0070671_100658111 3300005355 Bacteria 907
57 Ga0070674_100009408 3300005356 Bacteria 5850
58 Ga0070674_100230450 3300005356 Bacteria 1445
59 Ga0070674_100879094 3300005356 Bacteria 779
60 Ga0070673_100000617 3300005364 Bacteria 19485
61 Ga0070673_100031280 3300005364 Bacteria 3992
62 Ga0070688_100144678 3300005365 Bacteria 1618
63 Ga0070659_100000226 3300005366 Bacteria 43761
64 Ga0070659_100035671 3300005366 Bacteria 3873
65 Ga0070659_100035891 3300005366 Bacteria 3863
66 Ga0070659_100269470 3300005366 Bacteria 1414
67 Ga0070667_100006736 3300005367 Bacteria 9545
68 Ga0070667_100146332 3300005367 Bacteria 2072
69 Ga0070709_10142427 3300005434 Bacteria 1648
70 Ga0070714_100003924 3300005435 Bacteria 11182
71 Ga0070714_100023027 3300005435 Bacteria 5113
72 Ga0070714_100037222 3300005435 Bacteria 4087
73 Ga0070714_100289338 3300005435 Bacteria 1524
74 Ga0070714_100638292 3300005435 Bacteria 1024
75 Ga0070713_100281619 3300005436 Bacteria 1526
76 Ga0070663_100001889 3300005455 Bacteria 11696
77 Ga0070663_100418503 3300005455 Bacteria 1099
78 Ga0070678_100016725 3300005456 Bacteria 4700
79 Ga0070678_100088764 3300005456 Bacteria 2365
80 Ga0070678_100283187 3300005456 Bacteria 1402
81 Ga0070662_100000705 3300005457 Bacteria 20486
82 Ga0070662_100034481 3300005457 Bacteria 3569
83 Ga0070662_100123385 3300005457 Bacteria 1988
84 Ga0070662_100154180 3300005457 Bacteria 1792
85 Ga0070662_100209445 3300005457 Bacteria 1551
86 Ga0070681_10042740 3300005458 Bacteria 4540
87 Ga0068867_100000435 3300005459 Bacteria 27943
88 Ga0068867_100747195 3300005459 Bacteria 868
89 Ga0070685_10170526 3300005466 Bacteria 1394
90 Ga0070679_100226247 3300005530 Bacteria 1831
91 Ga0070679_100292664 3300005530 Bacteria 1580
92 Ga0070679_100469398 3300005530 Bacteria 1203
93 Ga0068853_100007949 3300005539 Bacteria 8505
94 Ga0068853_100009556 3300005539 Bacteria 7813
95 Ga0068853_100862515 3300005539 Bacteria 869
96 Ga0070672_100001515 3300005543 Bacteria 14397
97 Ga0070672_100039938 3300005543 Bacteria 3597
98 Ga0070672_100071996 3300005543 Bacteria 2751
99 Ga0070686_100981433 3300005544 Bacteria 692
100 Ga0070693_100102989 3300005547 Bacteria 1742
101 Ga0070665_100032168 3300005548 Bacteria 5279
102 Ga0070665_100159328 3300005548 Bacteria 2258
103 Ga0068855_100000085 3300005563 Bacteria 112108
104 Ga0068855_100038922 3300005563 Bacteria 5646
105 Ga0068855_100047240 3300005563 Bacteria 5086
106 Ga0068855_100061623 3300005563 Bacteria 4382
107 Ga0068855_100227769 3300005563 Bacteria 2088
108 Ga0068855_100622160 3300005563 Bacteria 1162
109 Ga0070664_100001534 3300005564 Bacteria 18443
110 Ga0068857_100004366 3300005577 Bacteria 11946
111 Ga0068854_100000415 3300005578 Bacteria 26758
112 Ga0068854_100004970 3300005578 Bacteria 8383
113 Ga0068854_100014935 3300005578 Bacteria 5129
114 Ga0068854_100211313 3300005578 Bacteria 1530
115 Ga0068854_100257084 3300005578 Bacteria 1397
116 Ga0068856_100010923 3300005614 Bacteria 8812
117 Ga0068856_100013946 3300005614 Bacteria 7770
118 Ga0070702_100090091 3300005615 Bacteria 1858
119 Ga0068852_100000998 3300005616 Bacteria 18659
120 Ga0068852_100002226 3300005616 Bacteria 13301
121 Ga0068852_100385584 3300005616 Bacteria 1375
122 Ga0068852_100573227 3300005616 Bacteria 1131
123 Ga0068859_100003734 3300005617 Bacteria 15514
124 Ga0068864_100003081 3300005618 Bacteria 13762
125 Ga0068866_10105035 3300005718 Bacteria 1565
126 Ga0068863_100079745 3300005841 Bacteria 3100
127 Ga0068863_101113911 3300005841 Bacteria 794
128 Ga0068858_100074051 3300005842 Bacteria 3162
129 Ga0068860_100003826 3300005843 Bacteria 15481
130 Ga0081539_10008291 3300005985 Bacteria 9105
131 Ga0070717_10199809 3300006028 Bacteria 1750
132 Ga0070716_101076355 3300006173 Bacteria 640
133 Ga0070712_100046681 3300006175 Bacteria 2995
134 Ga0070712_100335291 3300006175 Bacteria 1233
135 Ga0097621_100017939 3300006237 Bacteria 5391
136 Ga0097621_100992917 3300006237 Bacteria 785
137 Ga0068871_100081800 3300006358 Bacteria 2676
138 Ga0068871_100127469 3300006358 Bacteria 2155
139 Ga0068871_100804129 3300006358 Bacteria 867
140 Ga0068865_100003562 3300006881 Bacteria 9348
141 Ga0097620_100003734 3300006931 Bacteria 15514
142 Ga0105240_10003525 3300009093 Bacteria 24281
143 Ga0105240_10154375 3300009093 Bacteria 2732
144 Ga0105240_10279113 3300009093 Bacteria 1920
145 Ga0105240_11182329 3300009093 Bacteria 811
146 Ga0105245_10003832 3300009098 Bacteria 13375
147 Ga0105243_10073259 3300009148 Bacteria 2775
148 Ga0105241_10126086 3300009174 Bacteria 2067
149 Ga0105241_10986335 3300009174 Bacteria 787
150 Ga0105242_10552221 3300009176 Bacteria 1104
151 Ga0105248_10004678 3300009177 Bacteria 15148
152 Ga0105248_10011200 3300009177 Bacteria 9892
153 Ga0105237_10311284 3300009545 Bacteria 1578
154 Ga0105237_10745597 3300009545 Bacteria 986
155 Ga0105238_10018382 3300009551 Bacteria 7114
156 Ga0105238_10127662 3300009551 Bacteria 2522
157 Ga0105238_10621772 3300009551 Bacteria 1089
158 Ga0105238_11832918 3300009551 Bacteria 639
159 Ga0105239_10229432 3300010375 Bacteria 2083
160 Ga0105239_10501251 3300010375 Bacteria 1380
161 Ga0105246_10006203 3300011119 Bacteria 7297
162 Ga0105246_10184312 3300011119 Bacteria 1610
163 Ga0157373_10211741 3300013100 Bacteria 1367
164 Ga0157371_10004280 3300013102 Bacteria 12521
165 Ga0157371_10187065 3300013102 Bacteria 1482
166 Ga0157371_10241627 3300013102 Bacteria 1299
167 Ga0157371_10440277 3300013102 Bacteria 957
168 Ga0157370_10000189 3300013104 Bacteria 77032
169 Ga0157370_10504334 3300013104 Bacteria 1111
170 Ga0157370_10555878 3300013104 Bacteria 1052
171 Ga0157369_10006976 3300013105 Bacteria 13029
172 Ga0157369_10007765 3300013105 Bacteria 12341
173 Ga0157374_10107447 3300013296 Bacteria 2682
174 Ga0157378_10008452 3300013297 Bacteria 8968
175 Ga0163162_10037511 3300013306 Bacteria 4837
176 Ga0163162_10103179 3300013306 Bacteria 2945
177 Ga0163162_10269609 3300013306 Bacteria 1834
178 Ga0157372_10018495 3300013307 Bacteria 7491
179 Ga0157372_10035290 3300013307 Bacteria 5505
180 Ga0157375_10007475 3300013308 Bacteria 9557
181 Ga0157375_10077885 3300013308 Bacteria 3347
182 Ga0157375_10542675 3300013308 Bacteria 1325
183 Ga0163163_10653823 3300014325 Bacteria 1115
184 Ga0182008_10084523 3300014497 Bacteria 1563
185 Ga0207427_102533 3300025231 Bacteria 4802
186 Ga0209026_1003011 3300025250 Bacteria 5813
187 Ga0209233_1000003 3300025261 Bacteria 1607366
188 Ga0209455_1000472 3300025272 Bacteria 30155
189 Ga0207673_1002098 3300025290 Bacteria 2239
190 Ga0207697_10002743 3300025315 Bacteria 8981
191 Ga0207656_10222210 3300025321 Bacteria 918
192 Ga0207642_10247624 3300025899 Bacteria 1010
193 Ga0207688_10007911 3300025901 Bacteria 5786
194 Ga0207688_10038718 3300025901 Bacteria 2647
195 Ga0207680_10512320 3300025903 Bacteria 855
196 Ga0207647_10000106 3300025904 Bacteria 64310
197 Ga0207647_10009434 3300025904 Bacteria 6932
198 Ga0207647_10303174 3300025904 Bacteria 909
199 Ga0207699_10100651 3300025906 Bacteria 1833
200 Ga0207645_10019552 3300025907 Bacteria 4439
201 Ga0207643_10025544 3300025908 Bacteria 3265
202 Ga0207705_10009986 3300025909 Bacteria 6910
203 Ga0207705_10045360 3300025909 Bacteria 3159
204 Ga0207705_10320550 3300025909 Bacteria 1191
205 Ga0207695_10011477 3300025913 Bacteria 10725
206 Ga0207695_10219981 3300025913 Bacteria 1807
207 Ga0207671_10197957 3300025914 Bacteria 1568
208 Ga0207671_10227379 3300025914 Bacteria 1463
209 Ga0207693_10204977 3300025915 Bacteria 1551
210 Ga0207660_10000188 3300025917 Bacteria 39152
211 Ga0207660_10297782 3300025917 Bacteria 1284
212 Ga0207657_10003988 3300025919 Bacteria 15693
213 Ga0207657_10006522 3300025919 Bacteria 12088
214 Ga0207657_10024747 3300025919 Bacteria 5550
215 Ga0207657_10031605 3300025919 Bacteria 4792
216 Ga0207657_10312380 3300025919 Bacteria 1244
217 Ga0207649_10061471 3300025920 Bacteria 2364
218 Ga0207649_10157422 3300025920 Bacteria 1571
219 Ga0207649_10289475 3300025920 Bacteria 1194
220 Ga0207652_10179967 3300025921 Bacteria 1900
221 Ga0207652_10410587 3300025921 Bacteria 1221
222 Ga0207681_10075320 3300025923 Bacteria 2366
223 Ga0207681_10225793 3300025923 Bacteria 1451
224 Ga0207681_10613176 3300025923 Unclassified 900
225 Ga0207694_10005798 3300025924 Bacteria 9462
226 Ga0207694_10005951 3300025924 Bacteria 9352
227 Ga0207694_10088233 3300025924 Bacteria 2445
228 Ga0207650_10018261 3300025925 Bacteria 4919
229 Ga0207650_10025948 3300025925 Bacteria 4177
230 Ga0207659_10002870 3300025926 Bacteria 10257
231 Ga0207659_10018539 3300025926 Bacteria 4564
232 Ga0207659_10115795 3300025926 Bacteria 2045
233 Ga0207687_10005376 3300025927 Bacteria 8474
234 Ga0207700_10107545 3300025928 Bacteria 2238
235 Ga0207700_10257986 3300025928 Bacteria 1491
236 Ga0207664_10439606 3300025929 Bacteria 1163
237 Ga0207644_10009135 3300025931 Bacteria 6498
238 Ga0207644_10043900 3300025931 Bacteria 3174
239 Ga0207644_10115538 3300025931 Bacteria 2035
240 Ga0207644_10866576 3300025931 Bacteria 756
241 Ga0207690_10005022 3300025932 Bacteria 7817
242 Ga0207690_10049209 3300025932 Bacteria 2808
243 Ga0207690_10118133 3300025932 Bacteria 1921
244 Ga0207706_10003248 3300025933 Bacteria 15582
245 Ga0207706_10029373 3300025933 Bacteria 4908
246 Ga0207706_10052443 3300025933 Bacteria 3601
247 Ga0207706_10057174 3300025933 Bacteria 3437
248 Ga0207706_10146265 3300025933 Bacteria 2079
249 Ga0207686_10365080 3300025934 Bacteria 1091
250 Ga0207670_10074587 3300025936 Bacteria 2356
251 Ga0207669_10035213 3300025937 Bacteria 2846
252 Ga0207669_10059087 3300025937 Bacteria 2344
253 Ga0207704_10005443 3300025938 Bacteria 5873
254 Ga0207665_10385405 3300025939 Bacteria 1064
255 Ga0207691_10000143 3300025940 Bacteria 65645
256 Ga0207691_10003928 3300025940 Bacteria 14444
257 Ga0207691_10048123 3300025940 Bacteria 3910
258 Ga0207711_10002755 3300025941 Bacteria 15479
259 Ga0207711_10073880 3300025941 Bacteria 2964
260 Ga0207689_10001967 3300025942 Bacteria 19411
261 Ga0207661_10279412 3300025944 Bacteria 1492
262 Ga0207661_10613956 3300025944 Bacteria 999
263 Ga0207679_10003827 3300025945 Bacteria 9329
264 Ga0207679_10432146 3300025945 Bacteria 1164
265 Ga0207679_10581165 3300025945 Bacteria 1008
266 Ga0207679_10656827 3300025945 Bacteria 949
267 Ga0207667_10000017 3300025949 Bacteria 390654
268 Ga0207667_10033268 3300025949 Bacteria 5545
269 Ga0207667_10145960 3300025949 Bacteria 2435
270 Ga0207667_10194918 3300025949 Bacteria 2078
271 Ga0207667_10232853 3300025949 Bacteria 1886
272 Ga0207651_10000825 3300025960 Bacteria 13420
273 Ga0207651_10014359 3300025960 Bacteria 4569
274 Ga0207651_10042691 3300025960 Bacteria 3020
275 Ga0207651_10328343 3300025960 Bacteria 1281
276 Ga0207668_10779140 3300025972 Bacteria 845
277 Ga0207640_10000353 3300025981 Bacteria 30062
278 Ga0207640_10003645 3300025981 Bacteria 8305
279 Ga0207640_10010788 3300025981 Bacteria 5155
280 Ga0207640_10079761 3300025981 Bacteria 2232
281 Ga0207640_10222785 3300025981 Bacteria 1445
282 Ga0207640_10845566 3300025981 Bacteria 796
283 Ga0207658_10013873 3300025986 Bacteria 5514
284 Ga0207658_10403356 3300025986 Bacteria 1202
285 Ga0207677_10007256 3300026023 Bacteria 6112
286 Ga0207703_10043628 3300026035 Bacteria 3600
287 Ga0207639_10000923 3300026041 Bacteria 19909
288 Ga0207639_10045692 3300026041 Bacteria 3300
289 Ga0207639_10258498 3300026041 Unclassified 1522
290 Ga0207639_10477221 3300026041 Bacteria 1136
291 Ga0207678_10009201 3300026067 Bacteria 8696
292 Ga0207678_10310696 3300026067 Bacteria 1355
293 Ga0207702_10004093 3300026078 Bacteria 13084
294 Ga0207702_10011842 3300026078 Bacteria 7259
295 Ga0207641_10197987 3300026088 Bacteria 1850
296 Ga0207641_10854306 3300026088 Bacteria 902
297 Ga0207648_10002130 3300026089 Bacteria 21534
298 Ga0207648_10743868 3300026089 Bacteria 910
299 Ga0207676_10001969 3300026095 Bacteria 14965
300 Ga0207674_10001507 3300026116 Bacteria 30052
301 Ga0207674_10002427 3300026116 Bacteria 23546
302 Ga0207674_10005518 3300026116 Bacteria 15021
303 Ga0207674_10021887 3300026116 Bacteria 6878
304 Ga0207674_10343685 3300026116 Bacteria 1443
305 Ga0207683_10012981 3300026121 Bacteria 7113
306 Ga0207683_10101356 3300026121 Bacteria 2571
307 Ga0207683_10164925 3300026121 Bacteria 2004
308 Ga0207698_10003682 3300026142 Bacteria 9264
309 Ga0207698_10008243 3300026142 Bacteria 6578
310 Ga0207698_10066691 3300026142 Bacteria 2834
311 Ga0207698_10071760 3300026142 Bacteria 2749
312 Ga0207698_10320489 3300026142 Bacteria 1451
313 Ga0207698_10577429 3300026142 Bacteria 1105
314 Ga0207698_10603629 3300026142 Bacteria 1082
315 Ga0207698_10778871 3300026142 Bacteria 957
316 Ga0268266_10028773 3300028379 Bacteria 4723
317 Ga0268266_10504648 3300028379 Bacteria 1155
318 Ga0268264_10003563 3300028381 Bacteria 13405
319 Ga0307408_100059687 3300031548 Bacteria 2777
320 Ga0307405_10136893 3300031731 Bacteria 1701
321 Ga0307405_10197475 3300031731 Bacteria 1458
322 Ga0307413_10054026 3300031824 Bacteria 2435
323 Ga0307413_10194006 3300031824 Bacteria 1460
324 Ga0307410_10002317 3300031852 Bacteria 9147
325 Ga0307410_10042850 3300031852 Bacteria 2994
326 Ga0307410_10212897 3300031852 Bacteria 1482
327 Ga0307410_10430119 3300031852 Bacteria 1073
328 Ga0307406_10076878 3300031901 Bacteria 2207
329 Ga0307407_10089082 3300031903 Bacteria 1887
330 Ga0307407_10838854 3300031903 Bacteria 701
331 Ga0307412_10208437 3300031911 Bacteria 1489
332 Ga0307412_10535170 3300031911 Bacteria 981
333 Ga0307409_100051155 3300031995 Bacteria 3160
334 Ga0307409_100292097 3300031995 Bacteria 1512
335 Ga0307409_101500181 3300031995 Unclassified 701
336 Ga0307416_100085530 3300032002 Bacteria 2684
337 Ga0307416_101402695 3300032002 Bacteria 804
338 Ga0307416_101922428 3300032002 Bacteria 695
339 Ga0307414_10003349 3300032004 Bacteria 8556
340 Ga0307414_10577351 3300032004 Bacteria 1005
341 Ga0307414_10688162 3300032004 Bacteria 925
342 Ga0307414_10856652 3300032004 Bacteria 831
343 Ga0307411_10013504 3300032005 Bacteria 4508
344 Ga0307411_10121582 3300032005 Bacteria 1890
345 Ga0307411_10171806 3300032005 Bacteria 1635
346 Ga0307411_10173628 3300032005 Bacteria 1628
347 Ga0307415_100596458 3300032126 Bacteria 982
348 Ga0373944_0142981 3300035089 Bacteria 839
349 Ga0395899_0010382 3300037312 Bacteria 7135
350 Ga0395899_0703474 3300037312 Bacteria 633
351 Ga0395900_0379171 3300037418 Bacteria 1382
352 Ga0395900_0419618 3300037418 Bacteria 1299
353 Ga0395900_0444770 3300037418 Bacteria 1253
354 Ga0395900_0856474 3300037418 Bacteria 834
355 Ga0395898_0486175 3300037466 Bacteria 1174
356 Ga0395905_0061573 3300037471 Bacteria 3511
357 Ga0395905_0067197 3300037471 Bacteria 3358
358 Ga0395905_0072927 3300037471 Bacteria 3218
359 Ga0395905_0191153 3300037471 Bacteria 1920
360 Ga0395901_0264963 3300038443 Bacteria 1788
361 Ga0395901_0635024 3300038443 Bacteria 1073
362 Ga0439432_066662 3300042006 Bacteria 1102
363 Ga0466972_0109219 3300044658 Bacteria 1307
364 Ga0466966_0324849 3300044684 Bacteria 924
365 Ga0466961_0030937 3300044693 Bacteria 3440
366 Ga0466961_0061266 3300044693 Bacteria 2392
367 Ga0466961_0123781 3300044693 Bacteria 1623
368 Ga0466963_0494622 3300044694 Bacteria 863
369 Ga0466963_0517688 3300044694 Bacteria 842
370 Ga0466964_0034899 3300044706 Bacteria 2009
371 Ga0466964_0072747 3300044706 Bacteria 1458
372 Ga0466971_0037455 3300044719 Bacteria 2174
373 Ga0466971_0102170 3300044719 Bacteria 1318
374 Ga0466957_0085328 3300044842 Bacteria 1972
375 Ga0466957_0453578 3300044842 Bacteria 884
376 Ga0466958_0006118 3300045836 Bacteria 6526
377 Ga0466967_0044220 3300045976 Bacteria 3861
378 Ga0466967_0051519 3300045976 Bacteria 3608
379 Ga0466967_0140922 3300045976 Bacteria 2246
380 Ga0466967_0149067 3300045976 Bacteria 2185
381 Ga0466967_0197748 3300045976 Bacteria 1903
382 Ga0495629_0208295 3300046459 Bacteria 1351
383 Ga0495585_0040993 3300046492 Bacteria 2598
384 Ga0495663_0001863 3300046525 Bacteria 6504
385 Ga0495598_0030145 3300046537 Bacteria 1517
386 Ga0495633_0002025 3300046558 Bacteria 14632
387 Ga0495668_0022830 3300046616 Bacteria 3574
388 Ga0495661_0020941 3300046665 Bacteria 4265
389 Ga0495647_0024202 3300046681 Bacteria 2209
390 Ga0495669_0022897 3300046684 Bacteria 2715
391 Ga0495669_0029032 3300046684 Bacteria 2424
392 Ga0495669_0358576 3300046684 Bacteria 705
393 Ga0495670_0012140 3300046691 Bacteria 4237
394 Ga0495677_0003343 3300047445 Bacteria 6241
395 Ga0495615_0054935 3300048090 Bacteria 1035
396 Ga0496103_0363744 3300048906 Bacteria 930
397 Ga0496108_0200325 3300048911 Bacteria 1733
398 Ga0496109_0343610 3300048912 Bacteria 1409
399 Ga0496109_0440454 3300048912 Bacteria 1231
400 Ga0496111_0002961 3300048914 Bacteria 10399
401 Ga0496111_0196650 3300048914 Bacteria 1499
402 Ga0496112_0493764 3300048915 Bacteria 1160
403 Ga0496115_0021940 3300048918 Bacteria 4938
404 Ga0501069_0466525 3300049585 Bacteria 751
405 Ga0501071_0451598 3300049587 Bacteria 984
406 Ga0466962_0001337 3300061719 Bacteria 11395

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005328 Ga0070676_10967688 Ga0070676_109676881 147
2 3300005539 Ga0068853_100862515 Ga0068853_1008625151 149
3 3300044693 Ga0466961_0123781 Ga0466961_0123781_59_532 149
4 3300037471 Ga0395905_0072927 Ga0395905_0072927_2738_3193 151
5 3300025231 Ga0207427_102533 Ga0207427_1025333 156
6 3300025250 Ga0209026_1003011 Ga0209026_10030114 156
7 3300025261 Ga0209233_1000003 Ga0209233_1000003302 156
8 3300025944 Ga0207661_10279412 Ga0207661_102794122 159
9 3300009177 Ga0105248_10011200 Ga0105248_100112008 161
10 3300013306 Ga0163162_10269609 Ga0163162_102696092 161
11 3300013308 Ga0157375_10542675 Ga0157375_105426752 161
12 3300014325 Ga0163163_10653823 Ga0163163_106538231 161
13 3300046684 Ga0495669_0029032 Ga0495669_0029032_150_635 161
14 3300048911 Ga0496108_0200325 Ga0496108_0200325_631_1116 161
15 3300048912 Ga0496109_0343610 Ga0496109_0343610_163_648 161
16 3300048914 Ga0496111_0002961 Ga0496111_0002961_6787_7272 161
17 3300031731 Ga0307405_10197475 Ga0307405_101974754 164
18 3300031824 Ga0307413_10054026 Ga0307413_100540263 164
19 3300031852 Ga0307410_10212897 Ga0307410_102128972 164
20 3300046684 Ga0495669_0358576 Ga0495669_0358576_174_671 165
21 3300037418 Ga0395900_0379171 Ga0395900_0379171_17_517 166
22 3300009093 Ga0105240_11182329 Ga0105240_111823292 174
23 3300037312 Ga0395899_0703474 Ga0395899_0703474_29_553 174
24 3300046459 Ga0495629_0208295 Ga0495629_0208295_621_1145 174
25 3300046681 Ga0495647_0024202 Ga0495647_0024202_577_1101 174
26 3300044694 Ga0466963_0494622 Ga0466963_0494622_174_731 179
27 3300001990 JGI24737J22298_10005149 JGI24737J22298_100051493 180
28 3300003214 JGI25165J46597_1000040 JGI25165J46597_1000040181 180
29 3300005327 Ga0070658_10120693 Ga0070658_101206932 180
30 3300005327 Ga0070658_10433550 Ga0070658_104335502 180
31 3300005328 Ga0070676_10000328 Ga0070676_1000032823 180
32 3300005339 Ga0070660_100031231 Ga0070660_1000312315 180
33 3300005354 Ga0070675_100006324 Ga0070675_1000063248 180
34 3300005355 Ga0070671_100070782 Ga0070671_1000707823 180
35 3300005356 Ga0070674_100009408 Ga0070674_1000094085 180
36 3300005366 Ga0070659_100035891 Ga0070659_1000358915 180
37 3300005455 Ga0070663_100001889 Ga0070663_10000188914 180
38 3300005456 Ga0070678_100016725 Ga0070678_1000167255 180
39 3300005457 Ga0070662_100123385 Ga0070662_1001233852 180
40 3300005547 Ga0070693_100102989 Ga0070693_1001029894 180
41 3300005563 Ga0068855_100000085 Ga0068855_100000085100 180
42 3300005578 Ga0068854_100004970 Ga0068854_1000049702 180
43 3300005578 Ga0068854_100014935 Ga0068854_1000149356 180
44 3300005614 Ga0068856_100010923 Ga0068856_1000109238 180
45 3300006237 Ga0097621_100017939 Ga0097621_1000179396 180
46 3300006358 Ga0068871_100127469 Ga0068871_1001274694 180
47 3300009093 Ga0105240_10154375 Ga0105240_101543752 180
48 3300009545 Ga0105237_10311284 Ga0105237_103112843 180
49 3300009551 Ga0105238_10621772 Ga0105238_106217722 180
50 3300010375 Ga0105239_10501251 Ga0105239_105012512 180
51 3300013102 Ga0157371_10440277 Ga0157371_104402772 180
52 3300013104 Ga0157370_10000189 Ga0157370_1000018921 180
53 3300013105 Ga0157369_10006976 Ga0157369_100069765 180
54 3300025272 Ga0209455_1000472 Ga0209455_100047218 180
55 3300025904 Ga0207647_10303174 Ga0207647_103031742 180
56 3300025909 Ga0207705_10009986 Ga0207705_100099862 180
57 3300025913 Ga0207695_10011477 Ga0207695_100114772 180
58 3300025913 Ga0207695_10219981 Ga0207695_102199813 180
59 3300025914 Ga0207671_10197957 Ga0207671_101979573 180
60 3300025919 Ga0207657_10031605 Ga0207657_100316055 180
61 3300025926 Ga0207659_10018539 Ga0207659_100185395 180
62 3300025931 Ga0207644_10043900 Ga0207644_100439004 180
63 3300025932 Ga0207690_10049209 Ga0207690_100492092 180
64 3300025933 Ga0207706_10052443 Ga0207706_100524433 180
65 3300025937 Ga0207669_10035213 Ga0207669_100352134 180
66 3300025940 Ga0207691_10048123 Ga0207691_100481234 180
67 3300025949 Ga0207667_10000017 Ga0207667_10000017165 180
68 3300025981 Ga0207640_10000353 Ga0207640_1000035325 180
69 3300025981 Ga0207640_10010788 Ga0207640_100107882 180
70 3300025981 Ga0207640_10845566 Ga0207640_108455661 180
71 3300026041 Ga0207639_10477221 Ga0207639_104772211 180
72 3300026067 Ga0207678_10009201 Ga0207678_100092019 180
73 3300026078 Ga0207702_10004093 Ga0207702_100040935 180
74 3300026078 Ga0207702_10011842 Ga0207702_100118422 180
75 3300026116 Ga0207674_10021887 Ga0207674_100218876 180
76 3300026116 Ga0207674_10343685 Ga0207674_103436851 180
77 3300026121 Ga0207683_10012981 Ga0207683_100129813 180
78 3300026142 Ga0207698_10008243 Ga0207698_100082437 180
79 3300037312 Ga0395899_0010382 Ga0395899_0010382_44_610 180
80 3300037418 Ga0395900_0856474 Ga0395900_0856474_136_702 180
81 3300037471 Ga0395905_0067197 Ga0395905_0067197_2672_3238 180
82 3300038443 Ga0395901_0264963 Ga0395901_0264963_796_1362 180
83 3300044719 Ga0466971_0102170 Ga0466971_0102170_237_803 180
84 3300044842 Ga0466957_0085328 Ga0466957_0085328_1168_1734 180
85 3300045836 Ga0466958_0006118 Ga0466958_0006118_973_1539 180
86 3300045976 Ga0466967_0140922 Ga0466967_0140922_1161_1727 180
87 3300061719 Ga0466962_0001337 Ga0466962_0001337_10165_10731 180
88 3300044684 Ga0466966_0324849 Ga0466966_0324849_29_577 181
89 3300044693 Ga0466961_0030937 Ga0466961_0030937_647_1195 181
90 3300044719 Ga0466971_0037455 Ga0466971_0037455_610_1158 181
91 3300001904 JGI24736J21556_1016893 JGI24736J21556_10168932 182
92 3300001979 JGI24740J21852_10014073 JGI24740J21852_100140733 182
93 3300001989 JGI24739J22299_10001357 JGI24739J22299_100013573 182
94 3300001990 JGI24737J22298_10001192 JGI24737J22298_1000119212 182
95 3300001990 JGI24737J22298_10019149 JGI24737J22298_100191494 182
96 3300002067 JGI24735J21928_10111490 JGI24735J21928_101114902 182
97 3300002073 JGI24745J21846_1024168 JGI24745J21846_10241682 182
98 3300002126 JGI24035J26624_1003800 JGI24035J26624_10038002 182
99 3300002244 JGI24742J22300_10021943 JGI24742J22300_100219432 182
100 3300005327 Ga0070658_10075942 Ga0070658_100759423 182
101 3300005327 Ga0070658_10090684 Ga0070658_100906843 182
102 3300005327 Ga0070658_10098575 Ga0070658_100985754 182
103 3300005327 Ga0070658_10215808 Ga0070658_102158083 182
104 3300005327 Ga0070658_10392880 Ga0070658_103928802 182
105 3300005328 Ga0070676_10012034 Ga0070676_100120343 182
106 3300005329 Ga0070683_100649092 Ga0070683_1006490922 182
107 3300005330 Ga0070690_100086058 Ga0070690_1000860582 182
108 3300005331 Ga0070670_100001101 Ga0070670_10000110117 182
109 3300005331 Ga0070670_100022850 Ga0070670_1000228502 182
110 3300005331 Ga0070670_100233677 Ga0070670_1002336773 182
111 3300005333 Ga0070677_10171750 Ga0070677_101717502 182
112 3300005334 Ga0068869_100000037 Ga0068869_10000003746 182
113 3300005335 Ga0070666_10028508 Ga0070666_100285084 182
114 3300005335 Ga0070666_10037936 Ga0070666_100379364 182
115 3300005335 Ga0070666_10039080 Ga0070666_100390804 182
116 3300005336 Ga0070680_100003004 Ga0070680_10000300414 182
117 3300005336 Ga0070680_100310025 Ga0070680_1003100252 182
118 3300005338 Ga0068868_100003289 Ga0068868_1000032898 182
119 3300005339 Ga0070660_100014087 Ga0070660_1000140878 182
120 3300005339 Ga0070660_100084070 Ga0070660_1000840703 182
121 3300005339 Ga0070660_100088578 Ga0070660_1000885782 182
122 3300005340 Ga0070689_100035844 Ga0070689_1000358442 182
123 3300005341 Ga0070691_10060374 Ga0070691_100603743 182
124 3300005344 Ga0070661_100077432 Ga0070661_1000774322 182
125 3300005344 Ga0070661_100080475 Ga0070661_1000804754 182
126 3300005344 Ga0070661_100388856 Ga0070661_1003888562 182
127 3300005347 Ga0070668_100147108 Ga0070668_1001471083 182
128 3300005353 Ga0070669_100000553 Ga0070669_10000055335 182
129 3300005353 Ga0070669_100132178 Ga0070669_1001321783 182
130 3300005353 Ga0070669_100244232 Ga0070669_1002442323 182
131 3300005353 Ga0070669_100766397 Ga0070669_1007663971 182
132 3300005354 Ga0070675_100005630 Ga0070675_1000056305 182
133 3300005354 Ga0070675_100100684 Ga0070675_1001006843 182
134 3300005354 Ga0070675_101092376 Ga0070675_1010923761 182
135 3300005355 Ga0070671_100000868 Ga0070671_10000086817 182
136 3300005355 Ga0070671_100017714 Ga0070671_1000177143 182
137 3300005355 Ga0070671_100658111 Ga0070671_1006581112 182
138 3300005356 Ga0070674_100230450 Ga0070674_1002304501 182
139 3300005356 Ga0070674_100879094 Ga0070674_1008790942 182
140 3300005364 Ga0070673_100000617 Ga0070673_1000006178 182
141 3300005364 Ga0070673_100031280 Ga0070673_1000312804 182
142 3300005365 Ga0070688_100144678 Ga0070688_1001446783 182
143 3300005366 Ga0070659_100000226 Ga0070659_10000022644 182
144 3300005366 Ga0070659_100035671 Ga0070659_1000356713 182
145 3300005366 Ga0070659_100269470 Ga0070659_1002694702 182
146 3300005367 Ga0070667_100006736 Ga0070667_10000673613 182
147 3300005367 Ga0070667_100146332 Ga0070667_1001463323 182
148 3300005434 Ga0070709_10142427 Ga0070709_101424272 182
149 3300005435 Ga0070714_100003924 Ga0070714_10000392414 182
150 3300005435 Ga0070714_100023027 Ga0070714_1000230272 182
151 3300005435 Ga0070714_100037222 Ga0070714_1000372224 182
152 3300005435 Ga0070714_100289338 Ga0070714_1002893382 182
153 3300005435 Ga0070714_100638292 Ga0070714_1006382922 182
154 3300005436 Ga0070713_100281619 Ga0070713_1002816192 182
155 3300005455 Ga0070663_100418503 Ga0070663_1004185032 182
156 3300005456 Ga0070678_100088764 Ga0070678_1000887643 182
157 3300005456 Ga0070678_100283187 Ga0070678_1002831871 182
158 3300005457 Ga0070662_100000705 Ga0070662_10000070525 182
159 3300005457 Ga0070662_100034481 Ga0070662_1000344812 182
160 3300005457 Ga0070662_100154180 Ga0070662_1001541802 182
161 3300005457 Ga0070662_100209445 Ga0070662_1002094452 182
162 3300005458 Ga0070681_10042740 Ga0070681_100427402 182
163 3300005459 Ga0068867_100000435 Ga0068867_1000004354 182
164 3300005459 Ga0068867_100747195 Ga0068867_1007471952 182
165 3300005466 Ga0070685_10170526 Ga0070685_101705262 182
166 3300005530 Ga0070679_100226247 Ga0070679_1002262472 182
167 3300005530 Ga0070679_100292664 Ga0070679_1002926642 182
168 3300005530 Ga0070679_100469398 Ga0070679_1004693982 182
169 3300005539 Ga0068853_100007949 Ga0068853_10000794912 182
170 3300005539 Ga0068853_100009556 Ga0068853_1000095562 182
171 3300005543 Ga0070672_100001515 Ga0070672_10000151512 182
172 3300005543 Ga0070672_100039938 Ga0070672_1000399383 182
173 3300005543 Ga0070672_100071996 Ga0070672_1000719964 182
174 3300005544 Ga0070686_100981433 Ga0070686_1009814331 182
175 3300005548 Ga0070665_100032168 Ga0070665_1000321685 182
176 3300005548 Ga0070665_100159328 Ga0070665_1001593284 182
177 3300005563 Ga0068855_100038922 Ga0068855_1000389228 182
178 3300005563 Ga0068855_100047240 Ga0068855_1000472407 182
179 3300005563 Ga0068855_100061623 Ga0068855_1000616237 182
180 3300005563 Ga0068855_100227769 Ga0068855_1002277693 182
181 3300005563 Ga0068855_100622160 Ga0068855_1006221601 182
182 3300005564 Ga0070664_100001534 Ga0070664_10000153416 182
183 3300005577 Ga0068857_100004366 Ga0068857_1000043666 182
184 3300005578 Ga0068854_100000415 Ga0068854_10000041534 182
185 3300005578 Ga0068854_100211313 Ga0068854_1002113133 182
186 3300005578 Ga0068854_100257084 Ga0068854_1002570842 182
187 3300005614 Ga0068856_100013946 Ga0068856_10001394611 182
188 3300005615 Ga0070702_100090091 Ga0070702_1000900912 182
189 3300005616 Ga0068852_100000998 Ga0068852_10000099810 182
190 3300005616 Ga0068852_100002226 Ga0068852_10000222616 182
191 3300005616 Ga0068852_100385584 Ga0068852_1003855843 182
192 3300005616 Ga0068852_100573227 Ga0068852_1005732272 182
193 3300005617 Ga0068859_100003734 Ga0068859_10000373420 182
194 3300005618 Ga0068864_100003081 Ga0068864_10000308111 182
195 3300005718 Ga0068866_10105035 Ga0068866_101050352 182
196 3300005841 Ga0068863_100079745 Ga0068863_1000797453 182
197 3300005841 Ga0068863_101113911 Ga0068863_1011139111 182
198 3300005842 Ga0068858_100074051 Ga0068858_1000740514 182
199 3300005843 Ga0068860_100003826 Ga0068860_1000038269 182
200 3300005985 Ga0081539_10008291 Ga0081539_1000829111 182
201 3300006028 Ga0070717_10199809 Ga0070717_101998094 182
202 3300006173 Ga0070716_101076355 Ga0070716_1010763551 182
203 3300006175 Ga0070712_100046681 Ga0070712_1000466814 182
204 3300006175 Ga0070712_100335291 Ga0070712_1003352912 182
205 3300006237 Ga0097621_100992917 Ga0097621_1009929171 182
206 3300006358 Ga0068871_100081800 Ga0068871_1000818004 182
207 3300006358 Ga0068871_100804129 Ga0068871_1008041292 182
208 3300006881 Ga0068865_100003562 Ga0068865_1000035629 182
209 3300006931 Ga0097620_100003734 Ga0097620_10000373420 182
210 3300009093 Ga0105240_10003525 Ga0105240_1000352511 182
211 3300009093 Ga0105240_10279113 Ga0105240_102791133 182
212 3300009098 Ga0105245_10003832 Ga0105245_1000383216 182
213 3300009148 Ga0105243_10073259 Ga0105243_100732593 182
214 3300009174 Ga0105241_10126086 Ga0105241_101260862 182
215 3300009174 Ga0105241_10986335 Ga0105241_109863352 182
216 3300009176 Ga0105242_10552221 Ga0105242_105522212 182
217 3300009177 Ga0105248_10004678 Ga0105248_100046789 182
218 3300009545 Ga0105237_10745597 Ga0105237_107455972 182
219 3300009551 Ga0105238_10018382 Ga0105238_100183821 182
220 3300009551 Ga0105238_10127662 Ga0105238_101276622 182
221 3300009551 Ga0105238_11832918 Ga0105238_118329181 182
222 3300010375 Ga0105239_10229432 Ga0105239_102294323 182
223 3300011119 Ga0105246_10006203 Ga0105246_1000620310 182
224 3300011119 Ga0105246_10184312 Ga0105246_101843123 182
225 3300013100 Ga0157373_10211741 Ga0157373_102117412 182
226 3300013102 Ga0157371_10004280 Ga0157371_100042807 182
227 3300013102 Ga0157371_10187065 Ga0157371_101870653 182
228 3300013102 Ga0157371_10241627 Ga0157371_102416272 182
229 3300013104 Ga0157370_10504334 Ga0157370_105043341 182
230 3300013104 Ga0157370_10555878 Ga0157370_105558781 182
231 3300013105 Ga0157369_10007765 Ga0157369_100077652 182
232 3300013296 Ga0157374_10107447 Ga0157374_101074473 182
233 3300013297 Ga0157378_10008452 Ga0157378_1000845212 182
234 3300013306 Ga0163162_10037511 Ga0163162_100375117 182
235 3300013306 Ga0163162_10103179 Ga0163162_101031793 182
236 3300013307 Ga0157372_10018495 Ga0157372_1001849511 182
237 3300013307 Ga0157372_10035290 Ga0157372_100352904 182
238 3300013308 Ga0157375_10007475 Ga0157375_100074759 182
239 3300013308 Ga0157375_10077885 Ga0157375_100778852 182
240 3300014497 Ga0182008_10084523 Ga0182008_100845234 182
241 3300025290 Ga0207673_1002098 Ga0207673_10020982 182
242 3300025315 Ga0207697_10002743 Ga0207697_100027433 182
243 3300025321 Ga0207656_10222210 Ga0207656_102222102 182
244 3300025899 Ga0207642_10247624 Ga0207642_102476241 182
245 3300025901 Ga0207688_10007911 Ga0207688_100079115 182
246 3300025901 Ga0207688_10038718 Ga0207688_100387183 182
247 3300025903 Ga0207680_10512320 Ga0207680_105123202 182
248 3300025904 Ga0207647_10000106 Ga0207647_100001069 182
249 3300025904 Ga0207647_10009434 Ga0207647_1000943410 182
250 3300025906 Ga0207699_10100651 Ga0207699_101006514 182
251 3300025907 Ga0207645_10019552 Ga0207645_100195526 182
252 3300025908 Ga0207643_10025544 Ga0207643_100255443 182
253 3300025909 Ga0207705_10045360 Ga0207705_100453604 182
254 3300025909 Ga0207705_10320550 Ga0207705_103205502 182
255 3300025914 Ga0207671_10227379 Ga0207671_102273792 182
256 3300025915 Ga0207693_10204977 Ga0207693_102049773 182
257 3300025917 Ga0207660_10000188 Ga0207660_100001885 182
258 3300025917 Ga0207660_10297782 Ga0207660_102977822 182
259 3300025919 Ga0207657_10003988 Ga0207657_100039883 182
260 3300025919 Ga0207657_10006522 Ga0207657_100065222 182
261 3300025919 Ga0207657_10024747 Ga0207657_100247477 182
262 3300025919 Ga0207657_10312380 Ga0207657_103123803 182
263 3300025920 Ga0207649_10061471 Ga0207649_100614713 182
264 3300025920 Ga0207649_10157422 Ga0207649_101574222 182
265 3300025920 Ga0207649_10289475 Ga0207649_102894752 182
266 3300025921 Ga0207652_10179967 Ga0207652_101799672 182
267 3300025921 Ga0207652_10410587 Ga0207652_104105872 182
268 3300025923 Ga0207681_10075320 Ga0207681_100753203 182
269 3300025923 Ga0207681_10225793 Ga0207681_102257933 182
270 3300025923 Ga0207681_10613176 Ga0207681_106131762 182
271 3300025924 Ga0207694_10005798 Ga0207694_1000579811 182
272 3300025924 Ga0207694_10005951 Ga0207694_1000595111 182
273 3300025924 Ga0207694_10088233 Ga0207694_100882333 182
274 3300025925 Ga0207650_10018261 Ga0207650_100182612 182
275 3300025925 Ga0207650_10025948 Ga0207650_100259483 182
276 3300025926 Ga0207659_10002870 Ga0207659_100028705 182
277 3300025926 Ga0207659_10115795 Ga0207659_101157953 182
278 3300025927 Ga0207687_10005376 Ga0207687_100053764 182
279 3300025928 Ga0207700_10107545 Ga0207700_101075453 182
280 3300025928 Ga0207700_10257986 Ga0207700_102579862 182
281 3300025929 Ga0207664_10439606 Ga0207664_104396062 182
282 3300025931 Ga0207644_10009135 Ga0207644_100091354 182
283 3300025931 Ga0207644_10115538 Ga0207644_101155383 182
284 3300025931 Ga0207644_10866576 Ga0207644_108665761 182
285 3300025932 Ga0207690_10005022 Ga0207690_100050229 182
286 3300025932 Ga0207690_10118133 Ga0207690_101181333 182
287 3300025933 Ga0207706_10003248 Ga0207706_100032483 182
288 3300025933 Ga0207706_10029373 Ga0207706_100293737 182
289 3300025933 Ga0207706_10057174 Ga0207706_100571742 182
290 3300025933 Ga0207706_10146265 Ga0207706_101462653 182
291 3300025934 Ga0207686_10365080 Ga0207686_103650802 182
292 3300025936 Ga0207670_10074587 Ga0207670_100745873 182
293 3300025937 Ga0207669_10059087 Ga0207669_100590873 182
294 3300025938 Ga0207704_10005443 Ga0207704_100054437 182
295 3300025939 Ga0207665_10385405 Ga0207665_103854052 182
296 3300025940 Ga0207691_10000143 Ga0207691_1000014335 182
297 3300025940 Ga0207691_10003928 Ga0207691_100039289 182
298 3300025941 Ga0207711_10002755 Ga0207711_1000275512 182
299 3300025941 Ga0207711_10073880 Ga0207711_100738803 182
300 3300025942 Ga0207689_10001967 Ga0207689_1000196720 182
301 3300025944 Ga0207661_10613956 Ga0207661_106139562 182
302 3300025945 Ga0207679_10003827 Ga0207679_100038275 182
303 3300025945 Ga0207679_10432146 Ga0207679_104321461 182
304 3300025945 Ga0207679_10581165 Ga0207679_105811652 182
305 3300025945 Ga0207679_10656827 Ga0207679_106568272 182
306 3300025949 Ga0207667_10033268 Ga0207667_100332688 182
307 3300025949 Ga0207667_10145960 Ga0207667_101459603 182
308 3300025949 Ga0207667_10194918 Ga0207667_101949183 182
309 3300025949 Ga0207667_10232853 Ga0207667_102328534 182
310 3300025960 Ga0207651_10000825 Ga0207651_1000082510 182
311 3300025960 Ga0207651_10014359 Ga0207651_100143596 182
312 3300025960 Ga0207651_10042691 Ga0207651_100426913 182
313 3300025960 Ga0207651_10328343 Ga0207651_103283432 182
314 3300025972 Ga0207668_10779140 Ga0207668_107791402 182
315 3300025981 Ga0207640_10003645 Ga0207640_100036458 182
316 3300025981 Ga0207640_10079761 Ga0207640_100797613 182
317 3300025981 Ga0207640_10222785 Ga0207640_102227852 182
318 3300025986 Ga0207658_10013873 Ga0207658_100138737 182
319 3300025986 Ga0207658_10403356 Ga0207658_104033563 182
320 3300026023 Ga0207677_10007256 Ga0207677_100072568 182
321 3300026035 Ga0207703_10043628 Ga0207703_100436284 182
322 3300026041 Ga0207639_10000923 Ga0207639_1000092326 182
323 3300026041 Ga0207639_10045692 Ga0207639_100456924 182
324 3300026041 Ga0207639_10258498 Ga0207639_102584983 182
325 3300026067 Ga0207678_10310696 Ga0207678_103106961 182
326 3300026088 Ga0207641_10197987 Ga0207641_101979873 182
327 3300026088 Ga0207641_10854306 Ga0207641_108543062 182
328 3300026089 Ga0207648_10002130 Ga0207648_100021309 182
329 3300026089 Ga0207648_10743868 Ga0207648_107438682 182
330 3300026095 Ga0207676_10001969 Ga0207676_1000196912 182
331 3300026116 Ga0207674_10001507 Ga0207674_100015078 182
332 3300026116 Ga0207674_10002427 Ga0207674_100024274 182
333 3300026116 Ga0207674_10005518 Ga0207674_1000551812 182
334 3300026121 Ga0207683_10101356 Ga0207683_101013563 182
335 3300026121 Ga0207683_10164925 Ga0207683_101649253 182
336 3300026142 Ga0207698_10003682 Ga0207698_100036826 182
337 3300026142 Ga0207698_10066691 Ga0207698_100666912 182
338 3300026142 Ga0207698_10071760 Ga0207698_100717604 182
339 3300026142 Ga0207698_10320489 Ga0207698_103204892 182
340 3300026142 Ga0207698_10577429 Ga0207698_105774292 182
341 3300026142 Ga0207698_10603629 Ga0207698_106036292 182
342 3300026142 Ga0207698_10778871 Ga0207698_107788711 182
343 3300028379 Ga0268266_10028773 Ga0268266_100287737 182
344 3300028379 Ga0268266_10504648 Ga0268266_105046482 182
345 3300028381 Ga0268264_10003563 Ga0268264_1000356312 182
346 3300031548 Ga0307408_100059687 Ga0307408_1000596873 182
347 3300031731 Ga0307405_10136893 Ga0307405_101368932 182
348 3300031824 Ga0307413_10194006 Ga0307413_101940062 182
349 3300031852 Ga0307410_10002317 Ga0307410_100023173 182
350 3300031852 Ga0307410_10042850 Ga0307410_100428503 182
351 3300031852 Ga0307410_10430119 Ga0307410_104301192 182
352 3300031901 Ga0307406_10076878 Ga0307406_100768783 182
353 3300031903 Ga0307407_10089082 Ga0307407_100890822 182
354 3300031903 Ga0307407_10838854 Ga0307407_108388542 182
355 3300031911 Ga0307412_10208437 Ga0307412_102084373 182
356 3300031911 Ga0307412_10535170 Ga0307412_105351702 182
357 3300031995 Ga0307409_100051155 Ga0307409_1000511554 182
358 3300031995 Ga0307409_100292097 Ga0307409_1002920972 182
359 3300031995 Ga0307409_101500181 Ga0307409_1015001812 182
360 3300032002 Ga0307416_100085530 Ga0307416_1000855303 182
361 3300032002 Ga0307416_101402695 Ga0307416_1014026952 182
362 3300032002 Ga0307416_101922428 Ga0307416_1019224282 182
363 3300032004 Ga0307414_10003349 Ga0307414_100033498 182
364 3300032004 Ga0307414_10577351 Ga0307414_105773512 182
365 3300032004 Ga0307414_10688162 Ga0307414_106881622 182
366 3300032004 Ga0307414_10856652 Ga0307414_108566522 182
367 3300032005 Ga0307411_10013504 Ga0307411_100135044 182
368 3300032005 Ga0307411_10121582 Ga0307411_101215822 182
369 3300032005 Ga0307411_10171806 Ga0307411_101718062 182
370 3300032005 Ga0307411_10173628 Ga0307411_101736282 182
371 3300032126 Ga0307415_100596458 Ga0307415_1005964582 182
372 3300035089 Ga0373944_0142981 Ga0373944_0142981_29_580 182
373 3300037418 Ga0395900_0419618 Ga0395900_0419618_579_1130 182
374 3300037418 Ga0395900_0444770 Ga0395900_0444770_440_991 182
375 3300037466 Ga0395898_0486175 Ga0395898_0486175_589_1140 182
376 3300037471 Ga0395905_0061573 Ga0395905_0061573_2137_2688 182
377 3300037471 Ga0395905_0191153 Ga0395905_0191153_702_1253 182
378 3300038443 Ga0395901_0635024 Ga0395901_0635024_136_687 182
379 3300042006 Ga0439432_066662 Ga0439432_066662_483_1034 182
380 3300044658 Ga0466972_0109219 Ga0466972_0109219_678_1229 182
381 3300044693 Ga0466961_0061266 Ga0466961_0061266_608_1159 182
382 3300044694 Ga0466963_0517688 Ga0466963_0517688_215_766 182
383 3300044706 Ga0466964_0034899 Ga0466964_0034899_87_638 182
384 3300044706 Ga0466964_0072747 Ga0466964_0072747_739_1290 182
385 3300044842 Ga0466957_0453578 Ga0466957_0453578_216_767 182
386 3300045976 Ga0466967_0044220 Ga0466967_0044220_2700_3251 182
387 3300045976 Ga0466967_0051519 Ga0466967_0051519_246_797 182
388 3300045976 Ga0466967_0149067 Ga0466967_0149067_1062_1613 182
389 3300045976 Ga0466967_0197748 Ga0466967_0197748_288_839 182
390 3300046492 Ga0495585_0040993 Ga0495585_0040993_772_1323 182
391 3300046525 Ga0495663_0001863 Ga0495663_0001863_1029_1580 182
392 3300046537 Ga0495598_0030145 Ga0495598_0030145_619_1170 182
393 3300046558 Ga0495633_0002025 Ga0495633_0002025_13773_14324 182
394 3300046616 Ga0495668_0022830 Ga0495668_0022830_823_1374 182
395 3300046665 Ga0495661_0020941 Ga0495661_0020941_2856_3407 182
396 3300046684 Ga0495669_0022897 Ga0495669_0022897_1508_2059 182
397 3300046691 Ga0495670_0012140 Ga0495670_0012140_42_593 182
398 3300047445 Ga0495677_0003343 Ga0495677_0003343_5105_5656 182
399 3300048090 Ga0495615_0054935 Ga0495615_0054935_442_993 182
400 3300048906 Ga0496103_0363744 Ga0496103_0363744_210_761 182
401 3300048912 Ga0496109_0440454 Ga0496109_0440454_107_658 182
402 3300048914 Ga0496111_0196650 Ga0496111_0196650_618_1169 182
403 3300048915 Ga0496112_0493764 Ga0496112_0493764_430_981 182
404 3300048918 Ga0496115_0021940 Ga0496115_0021940_3937_4488 182
405 3300049585 Ga0501069_0466525 Ga0501069_0466525_127_678 182
406 3300049587 Ga0501071_0451598 Ga0501071_0451598_145_732 182

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

29

155

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lkz-assembly1.cif.gz_A structure of atp-bound human abca4 0.9362 2 169
7e7q-assembly1.cif.gz_A cryo-em structure of human abca4 in atp-bound state 0.936 2 169
7f04-assembly1.cif.gz_A cytochrome c-type biogenesis protein ccmabcd from e. coli in complex with heme and atp. 0.9341 1 180
3fvq-assembly1.cif.gz_A crystal structure of the nucleotide binding domain fbpc complexed with atp 0.9296 4 169
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.9288 4 169
ID Description Score Start End Superfamily
af_P78363_1926_2175_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9479 2 169 3.40.50.300
af_O33189_10_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9448 1 169 3.40.50.300
af_Q1RS86_1791_2054_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9381 2 169 3.40.50.300
af_P33931_1_204_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9374 1 182 3.40.50.300
af_Q9VVK6_1124_1370_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9369 2 169 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A4P7RU73-F1-model_v4 Heme ABC exporter ATP-binding protein CcmA 0.9815 2 182 GO:0005524
GO:0016020
GO:0016887
GO:0017004
GO:0022857
AF-W0AEB2-F1-model_v4 ABC transporter domain-containing protein 0.9793 4 181 GO:0005524
GO:0015439
GO:0016020
GO:0016887
GO:0017004
AF-A0A6G7ZK48-F1-model_v4 Heme ABC exporter ATP-binding protein CcmA 0.9792 1 182 GO:0005524
GO:0016020
GO:0016887
GO:0017004
GO:0022857
AF-A0A5B8LGC4-F1-model_v4 Heme ABC exporter ATP-binding protein CcmA 0.9786 1 180 GO:0005524
GO:0015439
GO:0016020
GO:0016887
GO:0017004
AF-A0A4Q1KIB0-F1-model_v4 Heme ABC exporter ATP-binding protein CcmA (EC 3.6.3.41) 0.9772 3 179 GO:0005524
GO:0016020
GO:0016887
GO:0017004
GO:0022857

Feature Viewer

pLDDT pTM Quality
93.34 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map