F436156

General Info

Members Datasets Scaffolds Average Seq Length
406 264 812 151

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100847238|Ga0070699_1008472381
Length 184
Sequence VAQPPDEWSTVACPAHRLTLAPGSEAIVMKMVKDLNGKARLVGVNHVALEVGNIEEALSFYGSLFEFSLRGRSAKMAFIDMGDQFIALSESRTQPPDKERHFGLVVDDKEKVRQKLKEAGAKILPGRGVEFRDPWGNRVQIVEYANIQFTKDKAVLEGMGCEGLRKSSEAIAELARKGMVVKEG

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
115 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
176 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
179 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
180 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
181 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
182 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
183 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
184 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
186 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
187 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
191 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
192 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
193 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
194 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
195 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
196 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
197 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
198 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
199 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
200 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
201 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
202 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
203 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
204 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
205 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
206 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
207 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
208 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
209 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
210 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
211 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
212 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
213 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
214 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
215 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
216 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
217 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
218 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
219 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
220 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
221 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
222 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
223 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
224 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
225 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
226 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
227 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
228 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
229 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
240 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
241 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
242 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
247 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
248 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
249 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
250 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
251 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
252 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
253 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
254 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
255 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
256 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
257 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
258 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
259 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
260 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
261 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
262 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
263 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
264 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.74
Nodule 0
Rhizoplane 3.45
Rhizosphere 93.84
Stem 0
Stem Tuber 0
Unclassified 9.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100847238 3300005518 Unclassified 837
2 JGI25406J46586_10094561 3300003203 Bacteria 897
3 Ga0058863_11641840 3300004799 Bacteria 566
4 Ga0065712_10807762 3300005290 Bacteria 510
5 Ga0065715_10889493 3300005293 Bacteria 578
6 Ga0070676_10257259 3300005328 Bacteria 1168
7 Ga0070683_100069261 3300005329 Bacteria 3289
8 Ga0070683_100895531 3300005329 Bacteria 851
9 Ga0070690_100194226 3300005330 Bacteria 1409
10 Ga0070677_10227034 3300005333 Bacteria 915
11 Ga0070677_10354898 3300005333 Bacteria 761
12 Ga0068869_100009697 3300005334 Bacteria 6253
13 Ga0068869_100851938 3300005334 Bacteria 786
14 Ga0070666_10200602 3300005335 Bacteria 1403
15 Ga0070680_100081778 3300005336 Bacteria 2665
16 Ga0070680_100383057 3300005336 Bacteria 1197
17 Ga0068868_100170455 3300005338 Bacteria 1802
18 Ga0068868_101335450 3300005338 Bacteria 667
19 Ga0070660_100140715 3300005339 Bacteria 1936
20 Ga0070689_100432937 3300005340 Bacteria 1117
21 Ga0070689_101003740 3300005340 Bacteria 743
22 Ga0070687_100266726 3300005343 Bacteria 1071
23 Ga0070661_100090787 3300005344 Bacteria 2262
24 Ga0070668_100152367 3300005347 Bacteria 1871
25 Ga0070668_102026431 3300005347 Unclassified 531
26 Ga0070669_100057500 3300005353 Bacteria 2854
27 Ga0070669_100312224 3300005353 Bacteria 1268
28 Ga0070675_100176484 3300005354 Bacteria 1845
29 Ga0070675_100623594 3300005354 Bacteria 979
30 Ga0070675_100638651 3300005354 Bacteria 967
31 Ga0070671_100041252 3300005355 Bacteria 3835
32 Ga0070671_101030915 3300005355 Bacteria 721
33 Ga0070673_102088419 3300005364 Bacteria 538
34 Ga0070688_101287666 3300005365 Bacteria 590
35 Ga0070659_100009283 3300005366 Bacteria 7221
36 Ga0070667_100167154 3300005367 Bacteria 1940
37 Ga0070667_100468701 3300005367 Bacteria 1152
38 Ga0070709_10086291 3300005434 Bacteria 2060
39 Ga0070714_100064350 3300005435 Bacteria 3156
40 Ga0070714_100315871 3300005435 Bacteria 1460
41 Ga0070714_101194480 3300005435 Unclassified 742
42 Ga0070714_101375508 3300005435 Bacteria 689
43 Ga0070713_100185057 3300005436 Bacteria 1874
44 Ga0070713_100528269 3300005436 Unclassified 1115
45 Ga0070713_100575446 3300005436 Bacteria 1068
46 Ga0070710_10584002 3300005437 Bacteria 776
47 Ga0070701_10148044 3300005438 Bacteria 1349
48 Ga0070711_100482255 3300005439 Bacteria 1019
49 Ga0070705_100594963 3300005440 Archaea 855
50 Ga0070700_100068125 3300005441 Bacteria 2262
51 Ga0070694_100481074 3300005444 Bacteria 985
52 Ga0070708_100573770 3300005445 Archaea 1064
53 Ga0070678_100062491 3300005456 Bacteria 2750
54 Ga0070678_100140821 3300005456 Bacteria 1930
55 Ga0070681_10019960 3300005458 Bacteria 6713
56 Ga0068867_100023932 3300005459 Bacteria 4375
57 Ga0068867_100397817 3300005459 Bacteria 1161
58 Ga0070706_100756568 3300005467 Bacteria 900
59 Ga0070707_100298119 3300005468 Bacteria 1566
60 Ga0070707_100475068 3300005468 Unclassified 1211
61 Ga0070707_101174337 3300005468 Bacteria 734
62 Ga0070698_100059940 3300005471 Bacteria 3842
63 Ga0070679_100232696 3300005530 Bacteria 1802
64 Ga0070684_100021505 3300005535 Bacteria 5369
65 Ga0070697_100429676 3300005536 Unclassified 1148
66 Ga0070697_100460387 3300005536 Bacteria 1109
67 Ga0068853_100048752 3300005539 Bacteria 3639
68 Ga0070672_100049022 3300005543 Bacteria 3284
69 Ga0070695_100356908 3300005545 Archaea 1097
70 Ga0070696_100530751 3300005546 Bacteria 940
71 Ga0070693_100059285 3300005547 Bacteria 2218
72 Ga0070665_100707164 3300005548 Bacteria 1021
73 Ga0070704_100336428 3300005549 Archaea 1270
74 Ga0068855_100020505 3300005563 Bacteria 7926
75 Ga0068855_102224362 3300005563 Unclassified 550
76 Ga0070664_100003404 3300005564 Bacteria 12839
77 Ga0068857_100004713 3300005577 Bacteria 11556
78 Ga0068857_100306714 3300005577 Bacteria 1464
79 Ga0068854_100175627 3300005578 Archaea 1670
80 Ga0068856_100001153 3300005614 Bacteria 27785
81 Ga0068856_100293894 3300005614 Bacteria 1641
82 Ga0070702_100081975 3300005615 Unclassified 1934
83 Ga0068852_100001592 3300005616 Bacteria 15444
84 Ga0068859_100104834 3300005617 Bacteria 2887
85 Ga0068859_100200817 3300005617 Bacteria 2078
86 Ga0068859_101238799 3300005617 Bacteria 822
87 Ga0068864_100070405 3300005618 Bacteria 3043
88 Ga0068864_101049470 3300005618 Bacteria 810
89 Ga0068866_10066715 3300005718 Bacteria 1887
90 Ga0068866_10066970 3300005718 Bacteria 1884
91 Ga0068861_100033288 3300005719 Bacteria 3801
92 Ga0068861_100226066 3300005719 Archaea 1584
93 Ga0068851_10056635 3300005834 Bacteria 2000
94 Ga0068870_10146514 3300005840 Bacteria 1386
95 Ga0068863_100043513 3300005841 Bacteria 4262
96 Ga0068863_100343778 3300005841 Bacteria 1452
97 Ga0068858_100033643 3300005842 Bacteria 4755
98 Ga0068860_100021236 3300005843 Bacteria 6288
99 Ga0068860_100153912 3300005843 Bacteria 2215
100 Ga0068860_100671793 3300005843 Archaea 1044
101 Ga0081455_10002754 3300005937 Bacteria 20741
102 Ga0081455_10078678 3300005937 Bacteria 2709
103 Ga0081538_10004632 3300005981 Bacteria 12624
104 Ga0081539_10002542 3300005985 Bacteria 25354
105 Ga0081539_10073405 3300005985 Bacteria 1825
106 Ga0070717_10103303 3300006028 Unclassified 2423
107 Ga0070717_10146400 3300006028 Bacteria 2040
108 Ga0070717_10447579 3300006028 Bacteria 1164
109 Ga0070717_11121260 3300006028 Unclassified 716
110 Ga0075365_10001514 3300006038 Bacteria 10618
111 Ga0075364_10020834 3300006051 Bacteria 4127
112 Ga0070715_10007313 3300006163 Bacteria 3798
113 Ga0070715_10255528 3300006163 Unclassified 918
114 Ga0070716_100019404 3300006173 Bacteria 3553
115 Ga0070716_100396918 3300006173 Unclassified 991
116 Ga0070712_100509702 3300006175 Bacteria 1009
117 Ga0070712_101752955 3300006175 Unclassified 544
118 Ga0075367_10510982 3300006178 Bacteria 762
119 Ga0097621_100117174 3300006237 Bacteria 2256
120 Ga0097621_100232185 3300006237 Bacteria 1611
121 Ga0068871_100014094 3300006358 Bacteria 5945
122 Ga0068871_100624732 3300006358 Bacteria 981
123 Ga0068865_100567054 3300006881 Bacteria 955
124 Ga0075436_100156287 3300006914 Bacteria 1607
125 Ga0075436_100951779 3300006914 Bacteria 643
126 Ga0075436_101086182 3300006914 Bacteria 602
127 Ga0097620_100104837 3300006931 Bacteria 2887
128 Ga0097620_100200818 3300006931 Bacteria 2078
129 Ga0097620_101238891 3300006931 Bacteria 822
130 Ga0075435_100153865 3300007076 Archaea 1935
131 Ga0075435_101064575 3300007076 Bacteria 707
132 Ga0099794_10037320 3300007265 Bacteria 2300
133 Ga0099794_10050778 3300007265 Unclassified 1995
134 Ga0099795_10062874 3300007788 Bacteria 1382
135 Ga0099795_10166195 3300007788 Bacteria 914
136 Ga0105240_10045294 3300009093 Bacteria 5582
137 Ga0111539_11485054 3300009094 Unclassified 786
138 Ga0105245_10130288 3300009098 Bacteria 2359
139 Ga0105245_11091372 3300009098 Unclassified 844
140 Ga0105243_10031023 3300009148 Bacteria 4120
141 Ga0105241_10115465 3300009174 Bacteria 2155
142 Ga0105241_10318306 3300009174 Bacteria 1341
143 Ga0105241_12112401 3300009174 Bacteria 557
144 Ga0105241_12217224 3300009174 Bacteria 545
145 Ga0105242_10130031 3300009176 Bacteria 2172
146 Ga0105242_10194774 3300009176 Bacteria 1797
147 Ga0105248_10441565 3300009177 Bacteria 1466
148 Ga0105248_10748742 3300009177 Bacteria 1102
149 Ga0105237_10594888 3300009545 Bacteria 1113
150 Ga0105238_10005752 3300009551 Bacteria 12266
151 Ga0105238_11838942 3300009551 Bacteria 638
152 Ga0105238_12622499 3300009551 Bacteria 540
153 Ga0105249_10145767 3300009553 Bacteria 2275
154 Ga0105249_10259552 3300009553 Archaea 1726
155 Ga0105239_10067086 3300010375 Bacteria 3941
156 Ga0105239_10738733 3300010375 Bacteria 1126
157 Ga0105246_11251202 3300011119 Bacteria 685
158 Ga0157373_10024671 3300013100 Bacteria 4355
159 Ga0157371_10080396 3300013102 Bacteria 2308
160 Ga0157371_10087460 3300013102 Unclassified 2207
161 Ga0157370_10003447 3300013104 Bacteria 18560
162 Ga0157369_10016928 3300013105 Bacteria 8193
163 Ga0157369_11176673 3300013105 Bacteria 783
164 Ga0157374_10205162 3300013296 Bacteria 1931
165 Ga0157374_10343396 3300013296 Unclassified 1482
166 Ga0157378_10044159 3300013297 Bacteria 3957
167 Ga0163162_10024879 3300013306 Bacteria 5913
168 Ga0163162_10813636 3300013306 Bacteria 1051
169 Ga0157372_10001120 3300013307 Bacteria 29116
170 Ga0157375_10639327 3300013308 Archaea 1221
171 Ga0157375_10642900 3300013308 Bacteria 1217
172 Ga0157375_11574808 3300013308 Bacteria 776
173 Ga0157375_11862749 3300013308 Bacteria 714
174 Ga0163163_10303484 3300014325 Bacteria 1649
175 Ga0163163_10310866 3300014325 Bacteria 1629
176 Ga0163163_12490306 3300014325 Bacteria 575
177 Ga0157380_10011428 3300014326 Bacteria 6416
178 Ga0157380_12120471 3300014326 Bacteria 625
179 Ga0157379_10142762 3300014968 Bacteria 2159
180 Ga0157379_10280505 3300014968 Bacteria 1516
181 Ga0157379_10432832 3300014968 Bacteria 1212
182 Ga0157379_10497866 3300014968 Bacteria 1129
183 Ga0157376_10012588 3300014969 Bacteria 6284
184 Ga0163161_10088715 3300017792 Bacteria 2286
185 Ga0213872_10016936 3300021361 Bacteria 3376
186 Ga0213872_10244750 3300021361 Unclassified 757
187 Ga0213876_10121131 3300021384 Bacteria 1389
188 Ga0213875_10000157 3300021388 Bacteria 71961
189 Ga0213875_10000766 3300021388 Bacteria 24181
190 Ga0213871_10017327 3300021441 Bacteria 1749
191 Ga0207697_10374360 3300025315 Bacteria 632
192 Ga0207656_10286406 3300025321 Bacteria 813
193 Ga0207653_10012136 3300025885 Bacteria 2690
194 Ga0207692_10367810 3300025898 Bacteria 890
195 Ga0207642_10003692 3300025899 Bacteria 4863
196 Ga0207642_10040093 3300025899 Bacteria 2041
197 Ga0207710_10257436 3300025900 Bacteria 874
198 Ga0207685_10101475 3300025905 Unclassified 1231
199 Ga0207685_10104949 3300025905 Bacteria 1215
200 Ga0207645_10235095 3300025907 Bacteria 1210
201 Ga0207705_10318847 3300025909 Bacteria 1194
202 Ga0207684_11073479 3300025910 Unclassified 671
203 Ga0207654_10035873 3300025911 Bacteria 2766
204 Ga0207654_10167910 3300025911 Bacteria 1422
205 Ga0207654_11295869 3300025911 Bacteria 531
206 Ga0207707_10106954 3300025912 Bacteria 2445
207 Ga0207695_10051437 3300025913 Bacteria 4326
208 Ga0207693_10003369 3300025915 Bacteria 13651
209 Ga0207663_10462316 3300025916 Bacteria 980
210 Ga0207660_10115494 3300025917 Bacteria 2026
211 Ga0207657_10143288 3300025919 Bacteria 1951
212 Ga0207649_10061485 3300025920 Bacteria 2364
213 Ga0207649_10329524 3300025920 Archaea 1124
214 Ga0207652_10347500 3300025921 Bacteria 1339
215 Ga0207694_10003307 3300025924 Bacteria 12829
216 Ga0207694_10679759 3300025924 Bacteria 868
217 Ga0207659_10090207 3300025926 Bacteria 2287
218 Ga0207687_10236039 3300025927 Bacteria 1447
219 Ga0207700_10083535 3300025928 Unclassified 2500
220 Ga0207700_10105916 3300025928 Bacteria 2253
221 Ga0207700_10250291 3300025928 Bacteria 1513
222 Ga0207700_11071152 3300025928 Bacteria 721
223 Ga0207664_10004342 3300025929 Bacteria 9603
224 Ga0207664_10019876 3300025929 Bacteria 4971
225 Ga0207664_10273760 3300025929 Bacteria 1479
226 Ga0207664_10416789 3300025929 Bacteria 1196
227 Ga0207644_10057988 3300025931 Bacteria 2797
228 Ga0207644_10101630 3300025931 Bacteria 2161
229 Ga0207690_10011971 3300025932 Bacteria 5187
230 Ga0207690_10163975 3300025932 Bacteria 1659
231 Ga0207706_10148101 3300025933 Bacteria 2065
232 Ga0207706_10548877 3300025933 Bacteria 995
233 Ga0207686_10351295 3300025934 Bacteria 1110
234 Ga0207709_10354008 3300025935 Bacteria 1109
235 Ga0207709_10378615 3300025935 Bacteria 1076
236 Ga0207670_10303132 3300025936 Bacteria 1251
237 Ga0207670_10681993 3300025936 Bacteria 849
238 Ga0207669_10392227 3300025937 Bacteria 1085
239 Ga0207665_10009195 3300025939 Bacteria 6488
240 Ga0207665_10446899 3300025939 Bacteria 991
241 Ga0207665_11029460 3300025939 Unclassified 655
242 Ga0207691_10015532 3300025940 Bacteria 7239
243 Ga0207711_10045143 3300025941 Bacteria 3765
244 Ga0207711_11589425 3300025941 Bacteria 597
245 Ga0207689_10010020 3300025942 Bacteria 8170
246 Ga0207689_10676191 3300025942 Bacteria 870
247 Ga0207661_10092024 3300025944 Bacteria 2528
248 Ga0207661_10502543 3300025944 Bacteria 1108
249 Ga0207661_11279726 3300025944 Bacteria 674
250 Ga0207679_10002606 3300025945 Bacteria 11110
251 Ga0207667_12153197 3300025949 Bacteria 515
252 Ga0207712_10061778 3300025961 Bacteria 2661
253 Ga0207640_10061291 3300025981 Bacteria 2491
254 Ga0207658_11074051 3300025986 Bacteria 735
255 Ga0207677_10636820 3300026023 Bacteria 939
256 Ga0207677_10862052 3300026023 Bacteria 814
257 Ga0207703_10971252 3300026035 Bacteria 815
258 Ga0207703_11158044 3300026035 Bacteria 743
259 Ga0207708_10112888 3300026075 Bacteria 2111
260 Ga0207702_10009361 3300026078 Bacteria 8227
261 Ga0207702_10243044 3300026078 Bacteria 1687
262 Ga0207641_10254640 3300026088 Bacteria 1641
263 Ga0207641_10389459 3300026088 Bacteria 1336
264 Ga0207648_10004108 3300026089 Bacteria 15067
265 Ga0207676_11034859 3300026095 Bacteria 810
266 Ga0207674_10000221 3300026116 Bacteria 70884
267 Ga0207674_11463029 3300026116 Bacteria 652
268 Ga0207675_100009954 3300026118 Bacteria 8901
269 Ga0207675_100051513 3300026118 Bacteria 3841
270 Ga0207675_100161832 3300026118 Archaea 2135
271 Ga0207675_100856089 3300026118 Bacteria 924
272 Ga0207675_101534676 3300026118 Bacteria 687
273 Ga0207683_10011873 3300026121 Bacteria 7433
274 Ga0207683_10330733 3300026121 Unclassified 1397
275 Ga0207698_10026517 3300026142 Bacteria 4100
276 Ga0268266_10814008 3300028379 Bacteria 902
277 Ga0268265_10103113 3300028380 Bacteria 2309
278 Ga0268264_10024820 3300028381 Bacteria 4897
279 Ga0265338_10199309 3300028800 Bacteria 1511
280 Ga0307413_10518613 3300031824 Bacteria 961
281 Ga0307409_101073386 3300031995 Bacteria 826
282 Ga0307416_100834169 3300032002 Bacteria 1019
283 Ga0373940_0213475 3300035088 Bacteria 639
284 Ga0373923_0240420 3300035111 Unclassified 845
285 Ga0373936_0175540 3300035113 Unclassified 938
286 Ga0373945_0155673 3300035116 Bacteria 929
287 Ga0373954_0100779 3300035118 Bacteria 1393
288 Ga0373956_0234530 3300035119 Bacteria 872
289 Ga0373957_0219261 3300035120 Bacteria 796
290 Ga0373946_0286490 3300035171 Bacteria 811
291 Ga0373946_0361853 3300035171 Unclassified 727
292 Ga0373955_0085730 3300035172 Bacteria 1788
293 Ga0373935_0859078 3300035692 Bacteria 671
294 Ga0373927_0031344 3300035695 Bacteria 3466
295 Ga0373927_0051185 3300035695 Unclassified 2671
296 Ga0373933_0060033 3300035724 Unclassified 2292
297 Ga0373947_0012880 3300035725 Bacteria 4795
298 Ga0373947_0041071 3300035725 Bacteria 2757
299 Ga0373937_0005561 3300036401 Bacteria 10810
300 Ga0373937_0068140 3300036401 Bacteria 3280
301 Ga0373937_0120740 3300036401 Bacteria 2442
302 Ga0373937_0266617 3300036401 Bacteria 1616
303 Ga0373925_0012356 3300037068 Bacteria 6183
304 Ga0373925_0017510 3300037068 Bacteria 5195
305 Ga0373925_1319213 3300037068 Bacteria 592
306 Ga0436364_0103806 3300037853 Bacteria 67638
307 Ga0436364_1562894 3300037853 Bacteria 22467
308 Ga0395901_0791947 3300038443 Bacteria 938
309 Ga0436365_0253704 3300039437 Bacteria 901
310 Ga0436365_0575697 3300039437 Bacteria 47908
311 Ga0436361_0204892 3300039447 Bacteria 1440
312 Ga0436361_0418318 3300039447 Unclassified 1582
313 Ga0436361_0716320 3300039447 Bacteria 9185
314 Ga0436361_1000751 3300039447 Bacteria 1990
315 Ga0436363_0064910 3300039450 Unclassified 587
316 Ga0436362_0681032 3300039453 Bacteria 631
317 Ga0436362_0799820 3300039453 Bacteria 2013
318 Ga0466963_0070830 3300044694 Bacteria 2346
319 Ga0466963_0229768 3300044694 Bacteria 1300
320 Ga0466970_0547662 3300044765 Bacteria 668
321 Ga0466957_0040977 3300044842 Bacteria 2800
322 Ga0466957_0612904 3300044842 Bacteria 763
323 Ga0466957_0785581 3300044842 Bacteria 676
324 Ga0466958_0246876 3300045836 Bacteria 1141
325 Ga0495592_0048364 3300046454 Bacteria 3164
326 Ga0495629_0087917 3300046459 Bacteria 2168
327 Ga0495651_0014780 3300046462 Bacteria 6036
328 Ga0495653_0643801 3300046463 Unclassified 648
329 Ga0495580_0001125 3300046472 Bacteria 23556
330 Ga0495580_0155074 3300046472 Bacteria 1586
331 Ga0495639_0058952 3300046475 Bacteria 1757
332 Ga0495639_0238854 3300046475 Bacteria 896
333 Ga0495662_0014041 3300046476 Bacteria 3899
334 Ga0495662_0015957 3300046476 Bacteria 3644
335 Ga0495662_0333365 3300046476 Unclassified 746
336 Ga0495594_0274315 3300046499 Bacteria 961
337 Ga0495618_0141384 3300046514 Bacteria 1539
338 Ga0495628_0305812 3300046516 Bacteria 1176
339 Ga0495630_0005615 3300046517 Bacteria 8859
340 Ga0495652_0453398 3300046529 Bacteria 897
341 Ga0495640_0004605 3300046533 Bacteria 10999
342 Ga0495640_0128676 3300046533 Bacteria 1640
343 Ga0495586_0076995 3300046535 Bacteria 1828
344 Ga0495586_0259543 3300046535 Bacteria 992
345 Ga0495587_0357881 3300046536 Bacteria 813
346 Ga0495598_0066008 3300046537 Bacteria 1128
347 Ga0495667_0181253 3300046559 Bacteria 1351
348 Ga0495634_0040332 3300046642 Bacteria 3176
349 Ga0495634_0061056 3300046642 Bacteria 2507
350 Ga0495635_0039129 3300046663 Bacteria 3282
351 Ga0495588_0048681 3300046674 Bacteria 2178
352 Ga0495599_0096607 3300046678 Bacteria 1842
353 Ga0495658_0118919 3300046683 Bacteria 1596
354 Ga0495658_1050741 3300046683 Bacteria 520
355 Ga0495613_0144259 3300046689 Bacteria 1700
356 Ga0495613_0593355 3300046689 Unclassified 738
357 Ga0495624_0179128 3300046690 Bacteria 1292
358 Ga0495581_0024273 3300047315 Bacteria 3514
359 Ga0495604_0065918 3300047317 Bacteria 2756
360 Ga0495636_0278175 3300047318 Bacteria 779
361 Ga0495676_0113071 3300047321 Bacteria 1988
362 Ga0495680_0032861 3300047322 Bacteria 4207
363 Ga0495614_0328717 3300048089 Bacteria 710
364 Ga0496101_0079535 3300048904 Bacteria 2420
365 Ga0496101_1484200 3300048904 Bacteria 528
366 Ga0496102_0118076 3300048905 Bacteria 2476
367 Ga0496103_0237351 3300048906 Archaea 1173
368 Ga0496103_0463695 3300048906 Bacteria 812
369 Ga0496104_1274574 3300048907 Bacteria 638
370 Ga0496105_0081790 3300048908 Bacteria 2667
371 Ga0496106_1220898 3300048909 Unclassified 586
372 Ga0496108_0050071 3300048911 Bacteria 3496
373 Ga0496109_0821529 3300048912 Bacteria 867
374 Ga0496110_0106075 3300048913 Bacteria 2521
375 Ga0496111_0093770 3300048914 Unclassified 2201
376 Ga0496114_0105238 3300048917 Bacteria 2413
377 Ga0496115_0491225 3300048918 Bacteria 987
378 Ga0501032_0025550 3300049569 Bacteria 4071
379 Ga0501037_0003086 3300049573 Bacteria 12077
380 Ga0501037_0278433 3300049573 Bacteria 1166
381 Ga0501042_0465299 3300049578 Bacteria 917
382 Ga0501046_0052482 3300049580 Bacteria 3213
383 Ga0501068_0862534 3300049584 Bacteria 595
384 Ga0501069_0041649 3300049585 Bacteria 2539
385 Ga0501070_0020483 3300049586 Bacteria 5547
386 Ga0501071_0584527 3300049587 Unclassified 858
387 Ga0501073_0194502 3300049589 Bacteria 1403
388 Ga0501074_0453814 3300049590 Unclassified 909
389 Ga0501075_0228107 3300049591 Bacteria 1420
390 Ga0501077_0102271 3300049593 Bacteria 1816
391 Ga0501077_0410773 3300049593 Bacteria 866
392 Ga0501079_0096085 3300049741 Bacteria 2297
393 Ga0501080_0116343 3300049742 Bacteria 2479
394 Ga0501081_0150482 3300049743 Bacteria 1672
395 Ga0501044_0054286 3300049823 Bacteria 4120
396 nmdc:mga08y16_1226266_c1 3300050511 Unclassified 720
397 nmdc:mga08y16_746620_c1 3300050511 Bacteria 975
398 Ga0495601_0005626 3300053077 Bacteria 7308
399 Ga0495601_0070075 3300053077 Bacteria 2237
400 Ga0495612_0255857 3300053078 Bacteria 779
401 Ga0495595_0055834 3300053084 Bacteria 1839
402 Ga0495619_0000762 3300053085 Bacteria 21029
403 Ga0495619_0010550 3300053085 Bacteria 5813
404 Ga0495619_0336021 3300053085 Bacteria 1045
405 Ga0501084_0117989 3300054114 Bacteria 2231
406 Ga0501082_0899758 3300060353 Bacteria 774
407 Ga0070699_100847238
408 JGI25406J46586_10094561
409 Ga0058863_11641840
410 Ga0065712_10807762
411 Ga0065715_10889493
412 Ga0070676_10257259
413 Ga0070683_100069261
414 Ga0070683_100895531
415 Ga0070690_100194226
416 Ga0070677_10227034
417 Ga0070677_10354898
418 Ga0068869_100009697
419 Ga0068869_100851938
420 Ga0070666_10200602
421 Ga0070680_100081778
422 Ga0070680_100383057
423 Ga0068868_100170455
424 Ga0068868_101335450
425 Ga0070660_100140715
426 Ga0070689_100432937
427 Ga0070689_101003740
428 Ga0070687_100266726
429 Ga0070661_100090787
430 Ga0070668_100152367
431 Ga0070668_102026431
432 Ga0070669_100057500
433 Ga0070669_100312224
434 Ga0070675_100176484
435 Ga0070675_100623594
436 Ga0070675_100638651
437 Ga0070671_100041252
438 Ga0070671_101030915
439 Ga0070673_102088419
440 Ga0070688_101287666
441 Ga0070659_100009283
442 Ga0070667_100167154
443 Ga0070667_100468701
444 Ga0070709_10086291
445 Ga0070714_100064350
446 Ga0070714_100315871
447 Ga0070714_101194480
448 Ga0070714_101375508
449 Ga0070713_100185057
450 Ga0070713_100528269
451 Ga0070713_100575446
452 Ga0070710_10584002
453 Ga0070701_10148044
454 Ga0070711_100482255
455 Ga0070705_100594963
456 Ga0070700_100068125
457 Ga0070694_100481074
458 Ga0070708_100573770
459 Ga0070678_100062491
460 Ga0070678_100140821
461 Ga0070681_10019960
462 Ga0068867_100023932
463 Ga0068867_100397817
464 Ga0070706_100756568
465 Ga0070707_100298119
466 Ga0070707_100475068
467 Ga0070707_101174337
468 Ga0070698_100059940
469 Ga0070679_100232696
470 Ga0070684_100021505
471 Ga0070697_100429676
472 Ga0070697_100460387
473 Ga0068853_100048752
474 Ga0070672_100049022
475 Ga0070695_100356908
476 Ga0070696_100530751
477 Ga0070693_100059285
478 Ga0070665_100707164
479 Ga0070704_100336428
480 Ga0068855_100020505
481 Ga0068855_102224362
482 Ga0070664_100003404
483 Ga0068857_100004713
484 Ga0068857_100306714
485 Ga0068854_100175627
486 Ga0068856_100001153
487 Ga0068856_100293894
488 Ga0070702_100081975
489 Ga0068852_100001592
490 Ga0068859_100104834
491 Ga0068859_100200817
492 Ga0068859_101238799
493 Ga0068864_100070405
494 Ga0068864_101049470
495 Ga0068866_10066715
496 Ga0068866_10066970
497 Ga0068861_100033288
498 Ga0068861_100226066
499 Ga0068851_10056635
500 Ga0068870_10146514
501 Ga0068863_100043513
502 Ga0068863_100343778
503 Ga0068858_100033643
504 Ga0068860_100021236
505 Ga0068860_100153912
506 Ga0068860_100671793
507 Ga0081455_10002754
508 Ga0081455_10078678
509 Ga0081538_10004632
510 Ga0081539_10002542
511 Ga0081539_10073405
512 Ga0070717_10103303
513 Ga0070717_10146400
514 Ga0070717_10447579
515 Ga0070717_11121260
516 Ga0075365_10001514
517 Ga0075364_10020834
518 Ga0070715_10007313
519 Ga0070715_10255528
520 Ga0070716_100019404
521 Ga0070716_100396918
522 Ga0070712_100509702
523 Ga0070712_101752955
524 Ga0075367_10510982
525 Ga0097621_100117174
526 Ga0097621_100232185
527 Ga0068871_100014094
528 Ga0068871_100624732
529 Ga0068865_100567054
530 Ga0075436_100156287
531 Ga0075436_100951779
532 Ga0075436_101086182
533 Ga0097620_100104837
534 Ga0097620_100200818
535 Ga0097620_101238891
536 Ga0075435_100153865
537 Ga0075435_101064575
538 Ga0099794_10037320
539 Ga0099794_10050778
540 Ga0099795_10062874
541 Ga0099795_10166195
542 Ga0105240_10045294
543 Ga0111539_11485054
544 Ga0105245_10130288
545 Ga0105245_11091372
546 Ga0105243_10031023
547 Ga0105241_10115465
548 Ga0105241_10318306
549 Ga0105241_12112401
550 Ga0105241_12217224
551 Ga0105242_10130031
552 Ga0105242_10194774
553 Ga0105248_10441565
554 Ga0105248_10748742
555 Ga0105237_10594888
556 Ga0105238_10005752
557 Ga0105238_11838942
558 Ga0105238_12622499
559 Ga0105249_10145767
560 Ga0105249_10259552
561 Ga0105239_10067086
562 Ga0105239_10738733
563 Ga0105246_11251202
564 Ga0157373_10024671
565 Ga0157371_10080396
566 Ga0157371_10087460
567 Ga0157370_10003447
568 Ga0157369_10016928
569 Ga0157369_11176673
570 Ga0157374_10205162
571 Ga0157374_10343396
572 Ga0157378_10044159
573 Ga0163162_10024879
574 Ga0163162_10813636
575 Ga0157372_10001120
576 Ga0157375_10639327
577 Ga0157375_10642900
578 Ga0157375_11574808
579 Ga0157375_11862749
580 Ga0163163_10303484
581 Ga0163163_10310866
582 Ga0163163_12490306
583 Ga0157380_10011428
584 Ga0157380_12120471
585 Ga0157379_10142762
586 Ga0157379_10280505
587 Ga0157379_10432832
588 Ga0157379_10497866
589 Ga0157376_10012588
590 Ga0163161_10088715
591 Ga0213872_10016936
592 Ga0213872_10244750
593 Ga0213876_10121131
594 Ga0213875_10000157
595 Ga0213875_10000766
596 Ga0213871_10017327
597 Ga0207697_10374360
598 Ga0207656_10286406
599 Ga0207653_10012136
600 Ga0207692_10367810
601 Ga0207642_10003692
602 Ga0207642_10040093
603 Ga0207710_10257436
604 Ga0207685_10101475
605 Ga0207685_10104949
606 Ga0207645_10235095
607 Ga0207705_10318847
608 Ga0207684_11073479
609 Ga0207654_10035873
610 Ga0207654_10167910
611 Ga0207654_11295869
612 Ga0207707_10106954
613 Ga0207695_10051437
614 Ga0207693_10003369
615 Ga0207663_10462316
616 Ga0207660_10115494
617 Ga0207657_10143288
618 Ga0207649_10061485
619 Ga0207649_10329524
620 Ga0207652_10347500
621 Ga0207694_10003307
622 Ga0207694_10679759
623 Ga0207659_10090207
624 Ga0207687_10236039
625 Ga0207700_10083535
626 Ga0207700_10105916
627 Ga0207700_10250291
628 Ga0207700_11071152
629 Ga0207664_10004342
630 Ga0207664_10019876
631 Ga0207664_10273760
632 Ga0207664_10416789
633 Ga0207644_10057988
634 Ga0207644_10101630
635 Ga0207690_10011971
636 Ga0207690_10163975
637 Ga0207706_10148101
638 Ga0207706_10548877
639 Ga0207686_10351295
640 Ga0207709_10354008
641 Ga0207709_10378615
642 Ga0207670_10303132
643 Ga0207670_10681993
644 Ga0207669_10392227
645 Ga0207665_10009195
646 Ga0207665_10446899
647 Ga0207665_11029460
648 Ga0207691_10015532
649 Ga0207711_10045143
650 Ga0207711_11589425
651 Ga0207689_10010020
652 Ga0207689_10676191
653 Ga0207661_10092024
654 Ga0207661_10502543
655 Ga0207661_11279726
656 Ga0207679_10002606
657 Ga0207667_12153197
658 Ga0207712_10061778
659 Ga0207640_10061291
660 Ga0207658_11074051
661 Ga0207677_10636820
662 Ga0207677_10862052
663 Ga0207703_10971252
664 Ga0207703_11158044
665 Ga0207708_10112888
666 Ga0207702_10009361
667 Ga0207702_10243044
668 Ga0207641_10254640
669 Ga0207641_10389459
670 Ga0207648_10004108
671 Ga0207676_11034859
672 Ga0207674_10000221
673 Ga0207674_11463029
674 Ga0207675_100009954
675 Ga0207675_100051513
676 Ga0207675_100161832
677 Ga0207675_100856089
678 Ga0207675_101534676
679 Ga0207683_10011873
680 Ga0207683_10330733
681 Ga0207698_10026517
682 Ga0268266_10814008
683 Ga0268265_10103113
684 Ga0268264_10024820
685 Ga0265338_10199309
686 Ga0307413_10518613
687 Ga0307409_101073386
688 Ga0307416_100834169
689 Ga0373940_0213475
690 Ga0373923_0240420
691 Ga0373936_0175540
692 Ga0373945_0155673
693 Ga0373954_0100779
694 Ga0373956_0234530
695 Ga0373957_0219261
696 Ga0373946_0286490
697 Ga0373946_0361853
698 Ga0373955_0085730
699 Ga0373935_0859078
700 Ga0373927_0031344
701 Ga0373927_0051185
702 Ga0373933_0060033
703 Ga0373947_0012880
704 Ga0373947_0041071
705 Ga0373937_0005561
706 Ga0373937_0068140
707 Ga0373937_0120740
708 Ga0373937_0266617
709 Ga0373925_0012356
710 Ga0373925_0017510
711 Ga0373925_1319213
712 Ga0436364_0103806
713 Ga0436364_1562894
714 Ga0395901_0791947
715 Ga0436365_0253704
716 Ga0436365_0575697
717 Ga0436361_0204892
718 Ga0436361_0418318
719 Ga0436361_0716320
720 Ga0436361_1000751
721 Ga0436363_0064910
722 Ga0436362_0681032
723 Ga0436362_0799820
724 Ga0466963_0070830
725 Ga0466963_0229768
726 Ga0466970_0547662
727 Ga0466957_0040977
728 Ga0466957_0612904
729 Ga0466957_0785581
730 Ga0466958_0246876
731 Ga0495592_0048364
732 Ga0495629_0087917
733 Ga0495651_0014780
734 Ga0495653_0643801
735 Ga0495580_0001125
736 Ga0495580_0155074
737 Ga0495639_0058952
738 Ga0495639_0238854
739 Ga0495662_0014041
740 Ga0495662_0015957
741 Ga0495662_0333365
742 Ga0495594_0274315
743 Ga0495618_0141384
744 Ga0495628_0305812
745 Ga0495630_0005615
746 Ga0495652_0453398
747 Ga0495640_0004605
748 Ga0495640_0128676
749 Ga0495586_0076995
750 Ga0495586_0259543
751 Ga0495587_0357881
752 Ga0495598_0066008
753 Ga0495667_0181253
754 Ga0495634_0040332
755 Ga0495634_0061056
756 Ga0495635_0039129
757 Ga0495588_0048681
758 Ga0495599_0096607
759 Ga0495658_0118919
760 Ga0495658_1050741
761 Ga0495613_0144259
762 Ga0495613_0593355
763 Ga0495624_0179128
764 Ga0495581_0024273
765 Ga0495604_0065918
766 Ga0495636_0278175
767 Ga0495676_0113071
768 Ga0495680_0032861
769 Ga0495614_0328717
770 Ga0496101_0079535
771 Ga0496101_1484200
772 Ga0496102_0118076
773 Ga0496103_0237351
774 Ga0496103_0463695
775 Ga0496104_1274574
776 Ga0496105_0081790
777 Ga0496106_1220898
778 Ga0496108_0050071
779 Ga0496109_0821529
780 Ga0496110_0106075
781 Ga0496111_0093770
782 Ga0496114_0105238
783 Ga0496115_0491225
784 Ga0501032_0025550
785 Ga0501037_0003086
786 Ga0501037_0278433
787 Ga0501042_0465299
788 Ga0501046_0052482
789 Ga0501068_0862534
790 Ga0501069_0041649
791 Ga0501070_0020483
792 Ga0501071_0584527
793 Ga0501073_0194502
794 Ga0501074_0453814
795 Ga0501075_0228107
796 Ga0501077_0102271
797 Ga0501077_0410773
798 Ga0501079_0096085
799 Ga0501080_0116343
800 Ga0501081_0150482
801 Ga0501044_0054286
802 nmdc:mga08y16_1226266_c1
803 nmdc:mga08y16_746620_c1
804 Ga0495601_0005626
805 Ga0495601_0070075
806 Ga0495612_0255857
807 Ga0495595_0055834
808 Ga0495619_0000762
809 Ga0495619_0010550
810 Ga0495619_0336021
811 Ga0501084_0117989
812 Ga0501082_0899758

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

43

141

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p7m-assembly4.cif.gz_A crystal structure of monoclinic form of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes at ph 6.5 0.8472 8 109
2p7l-assembly4.cif.gz_A crystal structure of monoclinic form of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes at ph 5.75 0.8436 8 109
2p7p-assembly4.cif.gz_B crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and sulfate ion 0.8424 8 109
2p7m-assembly4.cif.gz_E-3 crystal structure of monoclinic form of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes at ph 6.5 0.8413 8 109
2p7k-assembly1.cif.gz_B crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes (hexagonal form) 0.839 8 111
ID Description Score Start End Superfamily
2pjsB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8878 71 109 3.10.180.10
af_Q0D8H0_68_188_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8558 10 111 3.10.180.10
2p7kA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8394 8 111 3.10.180.10
af_C6KSP5_186_307_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8029 13 111 3.10.180.10
1xqaB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8026 11 110 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A6B7LH09-F1-model_v4 Putative 3-hydroxyanthranilate 3,4-dioxygenase 0.9871 5 136 GO:0051213
AF-A0A7W0N0F1-F1-model_v4 VOC family protein 0.9762 4 111
AF-A0A7W0N0F1-F1-model_v4 VOC family protein 0.9587 4 111
AF-A0A8A2VL44-F1-model_v4 VOC family protein 0.9467 4 150
AF-A0A6B7LH09-F1-model_v4 Putative 3-hydroxyanthranilate 3,4-dioxygenase 0.9446 5 136 GO:0051213

Map