F436125

General Info

Members Datasets Scaffolds Average Seq Length
406 243 812 144

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100028768|Ga0070683_1000287687
Length 150
Sequence MTMQTTTGALHERLNRVSAIIGSLLVDGFHYLALFAIGGAIVWSAVHAFLGMAAAGRASIDDILLLFIYLELGAMVGIYFKTNHMPVRFLIYVGITALTRLLVGDIASHHTIGTGVIMVSGAILLLALANLVVRFGSARFPSPKQGGDRP

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
83 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
138 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
139 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
140 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
143 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
148 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
149 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
150 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
151 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
152 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
153 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
154 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
155 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
156 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
158 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
160 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
161 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
162 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
163 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
164 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
165 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
168 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
169 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
170 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
171 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
172 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
176 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
179 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
180 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
181 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
182 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
183 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
184 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
185 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
186 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
189 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
190 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
191 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
194 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
195 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
196 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
197 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
198 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
203 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
204 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
205 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
208 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
209 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
210 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
211 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
212 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
213 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
214 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
215 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
216 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
217 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
218 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
219 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
220 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
221 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
222 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
223 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
224 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
225 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
226 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
227 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
231 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
234 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
235 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
236 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
237 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
238 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
239 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
240 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
241 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
242 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
243 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 0.49
Rhizosphere 99.26
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100028768 3300005329 Bacteria 5026
2 ARSoilOldRDRAFT_c009598 3300000044 Bacteria 807
3 JGI24738J21930_10037873 3300002075 Bacteria 980
4 Ga0065704_10741046 3300005289 Bacteria 545
5 Ga0065707_10011026 3300005295 Bacteria 3164
6 Ga0065707_10283301 3300005295 Bacteria 1034
7 Ga0065707_10906398 3300005295 Bacteria 565
8 Ga0070658_10943773 3300005327 Bacteria 750
9 Ga0070676_10287467 3300005328 Bacteria 1110
10 Ga0070676_10439831 3300005328 Bacteria 915
11 Ga0070690_100000497 3300005330 Bacteria 19649
12 Ga0070690_100497326 3300005330 Bacteria 912
13 Ga0068869_100002100 3300005334 Bacteria 11972
14 Ga0068869_100322732 3300005334 Bacteria 1253
15 Ga0070666_10153687 3300005335 Bacteria 1606
16 Ga0070680_100001571 3300005336 Bacteria 16654
17 Ga0070680_100185206 3300005336 Bacteria 1754
18 Ga0070682_100016604 3300005337 Bacteria 4284
19 Ga0070682_100113347 3300005337 Bacteria 1811
20 Ga0068868_100004467 3300005338 Bacteria 9813
21 Ga0070689_100009090 3300005340 Bacteria 7034
22 Ga0070689_100271280 3300005340 Bacteria 1405
23 Ga0070689_100298779 3300005340 Bacteria 1340
24 Ga0070691_10001745 3300005341 Bacteria 9442
25 Ga0070691_10602122 3300005341 Bacteria 649
26 Ga0070687_100000268 3300005343 Bacteria 17660
27 Ga0070687_100437580 3300005343 Bacteria 866
28 Ga0070687_100864132 3300005343 Bacteria 646
29 Ga0070661_100969432 3300005344 Bacteria 704
30 Ga0070692_10000432 3300005345 Bacteria 12705
31 Ga0070692_10051279 3300005345 Bacteria 2145
32 Ga0070669_100029801 3300005353 Bacteria 3936
33 Ga0070669_100443702 3300005353 Bacteria 1069
34 Ga0070675_100124379 3300005354 Bacteria 2193
35 Ga0070675_100202779 3300005354 Bacteria 1722
36 Ga0070671_100153948 3300005355 Bacteria 1942
37 Ga0070674_100761811 3300005356 Bacteria 833
38 Ga0070673_100189052 3300005364 Bacteria 1767
39 Ga0070688_100393092 3300005365 Bacteria 1025
40 Ga0070703_10045638 3300005406 Bacteria 1383
41 Ga0070701_10000083 3300005438 Bacteria 26254
42 Ga0070701_10173687 3300005438 Bacteria 1257
43 Ga0070705_100000645 3300005440 Bacteria 19939
44 Ga0070705_100818090 3300005440 Bacteria 742
45 Ga0070705_101385263 3300005440 Bacteria 586
46 Ga0070700_100000249 3300005441 Bacteria 29271
47 Ga0070700_100017861 3300005441 Bacteria 4067
48 Ga0070700_100080284 3300005441 Bacteria 2104
49 Ga0070700_101085849 3300005441 Bacteria 662
50 Ga0070694_100000382 3300005444 Bacteria 23947
51 Ga0070694_100037526 3300005444 Bacteria 3214
52 Ga0070694_100293327 3300005444 Bacteria 1244
53 Ga0070678_100353862 3300005456 Bacteria 1263
54 Ga0070662_100912696 3300005457 Bacteria 750
55 Ga0070662_100982628 3300005457 Bacteria 722
56 Ga0070681_10000281 3300005458 Bacteria 40930
57 Ga0070681_10030881 3300005458 Bacteria 5378
58 Ga0068867_100000534 3300005459 Bacteria 25071
59 Ga0070679_100007368 3300005530 Bacteria 10280
60 Ga0070684_100440394 3300005535 Bacteria 1204
61 Ga0070697_100864089 3300005536 Bacteria 802
62 Ga0070672_100293242 3300005543 Bacteria 1378
63 Ga0070686_100000299 3300005544 Bacteria 33122
64 Ga0070686_100247524 3300005544 Bacteria 1300
65 Ga0070686_100259650 3300005544 Bacteria 1273
66 Ga0070695_100000816 3300005545 Bacteria 16788
67 Ga0070695_100009787 3300005545 Bacteria 5710
68 Ga0070696_100002955 3300005546 Bacteria 11296
69 Ga0070696_101163123 3300005546 Bacteria 651
70 Ga0070693_100000281 3300005547 Bacteria 23879
71 Ga0070693_100402208 3300005547 Bacteria 950
72 Ga0070704_100000420 3300005549 Bacteria 19697
73 Ga0070704_100016890 3300005549 Bacteria 4627
74 Ga0070704_101214812 3300005549 Bacteria 688
75 Ga0068855_100002028 3300005563 Bacteria 25117
76 Ga0070664_100581126 3300005564 Bacteria 1038
77 Ga0068857_100173627 3300005577 Bacteria 1960
78 Ga0068854_100003188 3300005578 Bacteria 10238
79 Ga0068856_101792393 3300005614 Bacteria 626
80 Ga0070702_100004547 3300005615 Bacteria 6347
81 Ga0070702_100056050 3300005615 Bacteria 2275
82 Ga0070702_100314420 3300005615 Bacteria 1089
83 Ga0068852_100260290 3300005616 Bacteria 1666
84 Ga0068859_100017570 3300005617 Bacteria 7192
85 Ga0068859_100882149 3300005617 Bacteria 980
86 Ga0068864_100224262 3300005618 Bacteria 1735
87 Ga0068866_10000506 3300005718 Bacteria 18014
88 Ga0068866_10416165 3300005718 Bacteria 871
89 Ga0068861_100000192 3300005719 Bacteria 32743
90 Ga0068861_100027893 3300005719 Bacteria 4117
91 Ga0068870_10095825 3300005840 Bacteria 1668
92 Ga0068863_101007838 3300005841 Bacteria 836
93 Ga0068858_100005818 3300005842 Bacteria 12045
94 Ga0068860_100002610 3300005843 Bacteria 18852
95 Ga0068860_100305352 3300005843 Bacteria 1560
96 Ga0068862_100005986 3300005844 Bacteria 10126
97 Ga0068862_100062344 3300005844 Bacteria 3206
98 Ga0068862_100164333 3300005844 Bacteria 1983
99 Ga0097621_100001387 3300006237 Bacteria 16676
100 Ga0097621_100004557 3300006237 Bacteria 9670
101 Ga0068871_100005563 3300006358 Bacteria 8832
102 Ga0068871_100006222 3300006358 Bacteria 8418
103 Ga0075428_100012898 3300006844 Bacteria 9297
104 Ga0075428_100033852 3300006844 Bacteria 5636
105 Ga0075428_100112140 3300006844 Bacteria 2970
106 Ga0075428_100283034 3300006844 Bacteria 1784
107 Ga0075428_100654336 3300006844 Bacteria 1120
108 Ga0075430_100003086 3300006846 Bacteria 13917
109 Ga0075431_100003399 3300006847 Bacteria 15428
110 Ga0075431_100116063 3300006847 Bacteria 2764
111 Ga0075431_100320765 3300006847 Bacteria 1562
112 Ga0075431_100396797 3300006847 Bacteria 1381
113 Ga0075431_100427251 3300006847 Bacteria 1323
114 Ga0075433_10226689 3300006852 Bacteria 1660
115 Ga0075433_10237122 3300006852 Bacteria 1620
116 Ga0075433_10484263 3300006852 Bacteria 1090
117 Ga0075433_11417932 3300006852 Bacteria 601
118 Ga0075434_100003193 3300006871 Bacteria 14616
119 Ga0075434_100015589 3300006871 Bacteria 7294
120 Ga0075434_100264994 3300006871 Bacteria 1737
121 Ga0075434_101467612 3300006871 Bacteria 692
122 Ga0075434_102052700 3300006871 Bacteria 577
123 Ga0075429_100001188 3300006880 Bacteria 21049
124 Ga0075429_100083802 3300006880 Bacteria 2779
125 Ga0075429_100100749 3300006880 Bacteria 2521
126 Ga0075429_100128289 3300006880 Bacteria 2218
127 Ga0075429_100738233 3300006880 Bacteria 862
128 Ga0068865_100000300 3300006881 Bacteria 27230
129 Ga0068865_100024268 3300006881 Bacteria 3976
130 Ga0075436_100002839 3300006914 Bacteria 11864
131 Ga0075436_100177276 3300006914 Bacteria 1506
132 Ga0097620_100017569 3300006931 Bacteria 7192
133 Ga0097620_100882313 3300006931 Bacteria 980
134 Ga0105250_10238311 3300009092 Bacteria 775
135 Ga0105240_10306831 3300009093 Bacteria 1814
136 Ga0111539_10011072 3300009094 Bacteria 11348
137 Ga0111539_10042374 3300009094 Bacteria 5466
138 Ga0111539_10045087 3300009094 Bacteria 5279
139 Ga0111539_10082567 3300009094 Bacteria 3779
140 Ga0111539_10141530 3300009094 Bacteria 2816
141 Ga0111539_10653503 3300009094 Bacteria 1224
142 Ga0105245_10000821 3300009098 Bacteria 28312
143 Ga0105245_12063203 3300009098 Bacteria 624
144 Ga0114129_10000249 3300009147 Bacteria 60701
145 Ga0114129_10276604 3300009147 Bacteria 2244
146 Ga0114129_10877174 3300009147 Bacteria 1139
147 Ga0105243_10001374 3300009148 Bacteria 21561
148 Ga0105243_10041257 3300009148 Bacteria 3609
149 Ga0105241_10081780 3300009174 Bacteria 2531
150 Ga0105241_10105540 3300009174 Bacteria 2247
151 Ga0105242_10007413 3300009176 Bacteria 8448
152 Ga0105242_11899851 3300009176 Bacteria 636
153 Ga0105237_12251947 3300009545 Bacteria 555
154 Ga0105249_10000348 3300009553 Bacteria 46377
155 Ga0105249_10046388 3300009553 Bacteria 3954
156 Ga0105239_10188151 3300010375 Bacteria 2311
157 Ga0105239_10203197 3300010375 Bacteria 2220
158 Ga0105246_10211276 3300011119 Bacteria 1515
159 Ga0105246_11409405 3300011119 Bacteria 650
160 Ga0157336_1008557 3300012477 Bacteria 746
161 Ga0157314_1025422 3300012500 Bacteria 633
162 Ga0157369_11258653 3300013105 Bacteria 754
163 Ga0157378_10001675 3300013297 Bacteria 19966
164 Ga0157378_11690619 3300013297 Bacteria 680
165 Ga0163162_10224721 3300013306 Bacteria 2007
166 Ga0157375_10895242 3300013308 Bacteria 1032
167 Ga0157380_10078186 3300014326 Bacteria 2698
168 Ga0157380_10233312 3300014326 Bacteria 1654
169 Ga0157377_10211207 3300014745 Bacteria 1238
170 Ga0157379_10233506 3300014968 Bacteria 1668
171 Ga0157376_10005372 3300014969 Bacteria 8953
172 Ga0157376_10274815 3300014969 Bacteria 1584
173 Ga0207682_10007693 3300025893 Bacteria 4287
174 Ga0207692_10104717 3300025898 Bacteria 1560
175 Ga0207642_10000533 3300025899 Bacteria 11649
176 Ga0207642_10009936 3300025899 Bacteria 3332
177 Ga0207642_10576022 3300025899 Bacteria 698
178 Ga0207688_10288598 3300025901 Bacteria 1001
179 Ga0207688_10649217 3300025901 Bacteria 666
180 Ga0207680_10103122 3300025903 Bacteria 1837
181 Ga0207685_10136202 3300025905 Bacteria 1096
182 Ga0207645_10147488 3300025907 Bacteria 1535
183 Ga0207645_10179813 3300025907 Bacteria 1388
184 Ga0207643_10033481 3300025908 Bacteria 2875
185 Ga0207643_10624256 3300025908 Bacteria 694
186 Ga0207654_10113018 3300025911 Bacteria 1693
187 Ga0207707_10009521 3300025912 Bacteria 8428
188 Ga0207707_10022575 3300025912 Bacteria 5500
189 Ga0207695_10328479 3300025913 Bacteria 1418
190 Ga0207660_10020585 3300025917 Bacteria 4429
191 Ga0207660_10237791 3300025917 Bacteria 1434
192 Ga0207662_10000155 3300025918 Bacteria 32464
193 Ga0207662_10078813 3300025918 Bacteria 2006
194 Ga0207662_10561870 3300025918 Bacteria 791
195 Ga0207652_10013379 3300025921 Bacteria 6644
196 Ga0207681_10140896 3300025923 Bacteria 1795
197 Ga0207681_10680448 3300025923 Bacteria 854
198 Ga0207659_10118963 3300025926 Bacteria 2021
199 Ga0207659_10148704 3300025926 Bacteria 1827
200 Ga0207687_10004271 3300025927 Bacteria 9555
201 Ga0207644_10103349 3300025931 Bacteria 2144
202 Ga0207706_10093321 3300025933 Bacteria 2647
203 Ga0207706_10182090 3300025933 Bacteria 1845
204 Ga0207686_10000347 3300025934 Bacteria 33269
205 Ga0207709_10000647 3300025935 Bacteria 28268
206 Ga0207709_10211368 3300025935 Bacteria 1393
207 Ga0207670_10017983 3300025936 Bacteria 4284
208 Ga0207670_10100919 3300025936 Bacteria 2061
209 Ga0207670_10174852 3300025936 Bacteria 1613
210 Ga0207670_11000367 3300025936 Bacteria 703
211 Ga0207704_10002446 3300025938 Bacteria 8354
212 Ga0207704_10026527 3300025938 Bacteria 3180
213 Ga0207691_10100076 3300025940 Bacteria 2588
214 Ga0207689_10002111 3300025942 Bacteria 18686
215 Ga0207689_10172526 3300025942 Bacteria 1783
216 Ga0207661_10078085 3300025944 Bacteria 2724
217 Ga0207667_10038575 3300025949 Bacteria 5100
218 Ga0207651_10121603 3300025960 Bacteria 1981
219 Ga0207651_10237631 3300025960 Bacteria 1483
220 Ga0207651_10517796 3300025960 Bacteria 1033
221 Ga0207712_10004246 3300025961 Bacteria 9039
222 Ga0207712_10301538 3300025961 Bacteria 1315
223 Ga0207640_10002134 3300025981 Bacteria 10621
224 Ga0207677_10002515 3300026023 Bacteria 9609
225 Ga0207703_10005929 3300026035 Bacteria 9790
226 Ga0207708_10000502 3300026075 Bacteria 30107
227 Ga0207708_10068942 3300026075 Bacteria 2707
228 Ga0207708_10071080 3300026075 Bacteria 2665
229 Ga0207708_10161961 3300026075 Bacteria 1767
230 Ga0207708_10375859 3300026075 Bacteria 1171
231 Ga0207702_10131874 3300026078 Bacteria 2249
232 Ga0207641_10949664 3300026088 Bacteria 855
233 Ga0207648_10001446 3300026089 Bacteria 26151
234 Ga0207648_10021067 3300026089 Bacteria 5863
235 Ga0207675_100000334 3300026118 Bacteria 45029
236 Ga0207675_100007076 3300026118 Bacteria 10601
237 Ga0207675_100438924 3300026118 Bacteria 1292
238 Ga0207675_100529924 3300026118 Bacteria 1175
239 Ga0207683_10769094 3300026121 Bacteria 894
240 Ga0207698_10329262 3300026142 Bacteria 1434
241 Ga0209981_1070749 3300027378 Bacteria 539
242 Ga0209995_1072651 3300027471 Bacteria 589
243 Ga0209999_1085224 3300027543 Bacteria 611
244 Ga0207428_10000688 3300027907 Bacteria 39292
245 Ga0207428_10004110 3300027907 Bacteria 13948
246 Ga0207428_10069586 3300027907 Bacteria 2767
247 Ga0207428_10103545 3300027907 Bacteria 2197
248 Ga0207428_10124393 3300027907 Bacteria 1976
249 Ga0268265_10003429 3300028380 Bacteria 11406
250 Ga0268265_10128235 3300028380 Bacteria 2103
251 Ga0268264_10008076 3300028381 Bacteria 8755
252 Ga0268264_10221353 3300028381 Bacteria 1742
253 Ga0265328_10048903 3300031239 Bacteria 1553
254 Ga0265325_10079125 3300031241 Bacteria 1636
255 Ga0265339_10007733 3300031249 Bacteria 6910
256 Ga0265316_10230868 3300031344 Bacteria 1363
257 Ga0307408_100115727 3300031548 Bacteria 2068
258 Ga0316575_10163274 3300031665 Bacteria 922
259 Ga0265314_10144618 3300031711 Bacteria 1466
260 Ga0307412_10044294 3300031911 Bacteria 2903
261 Ga0307416_100273075 3300032002 Bacteria 1661
262 Ga0307416_101122693 3300032002 Bacteria 891
263 Ga0307416_103090447 3300032002 Bacteria 557
264 Ga0307411_10261308 3300032005 Bacteria 1367
265 Ga0373950_0010292 3300034818 Bacteria 1508
266 Ga0373950_0098379 3300034818 Bacteria 628
267 Ga0373958_0016755 3300034819 Bacteria 1309
268 Ga0373938_0007419 3300034957 Bacteria 1928
269 Ga0373926_0039553 3300035083 Bacteria 1681
270 Ga0373928_0006877 3300035084 Bacteria 2191
271 Ga0373934_0047911 3300035086 Bacteria 1691
272 Ga0373944_0003286 3300035089 Bacteria 4162
273 Ga0373949_0003409 3300035090 Bacteria 3793
274 Ga0373949_0058425 3300035090 Bacteria 987
275 Ga0373951_0005820 3300035091 Bacteria 2848
276 Ga0373923_0034389 3300035111 Bacteria 2057
277 Ga0373923_0224009 3300035111 Bacteria 875
278 Ga0373932_0003854 3300035112 Bacteria 3577
279 Ga0373936_0052851 3300035113 Bacteria 1646
280 Ga0373939_0031976 3300035114 Bacteria 1525
281 Ga0373939_0131285 3300035114 Bacteria 894
282 Ga0373941_0466047 3300035115 Bacteria 532
283 Ga0373945_0005160 3300035116 Bacteria 4173
284 Ga0373953_0156931 3300035117 Bacteria 977
285 Ga0373954_0000034 3300035118 Bacteria 52216
286 Ga0373956_0417223 3300035119 Bacteria 640
287 Ga0373960_0032199 3300035121 Bacteria 1471
288 Ga0373943_0047535 3300035170 Bacteria 2098
289 Ga0373946_0133963 3300035171 Bacteria 1142
290 Ga0373955_0048893 3300035172 Bacteria 2295
291 Ga0373955_0155636 3300035172 Bacteria 1346
292 Ga0373942_0005132 3300035207 Bacteria 3036
293 Ga0373942_0041384 3300035207 Bacteria 1259
294 Ga0373961_0006847 3300035241 Bacteria 2741
295 Ga0316574_0307100 3300035398 Bacteria 1008
296 Ga0373924_0020122 3300035410 Bacteria 2591
297 Ga0373924_0093595 3300035410 Bacteria 1287
298 Ga0373931_0000452 3300035691 Bacteria 16749
299 Ga0373931_0014473 3300035691 Bacteria 3857
300 Ga0373931_0216901 3300035691 Bacteria 1150
301 Ga0373931_1235356 3300035691 Bacteria 512
302 Ga0373935_0071165 3300035692 Bacteria 2243
303 Ga0373935_0116217 3300035692 Bacteria 1782
304 Ga0373927_0010513 3300035695 Bacteria 6168
305 Ga0373933_0006070 3300035724 Bacteria 6574
306 Ga0373933_0157868 3300035724 Bacteria 1439
307 Ga0373937_0000166 3300036401 Bacteria 63970
308 Ga0373937_0064456 3300036401 Bacteria 3370
309 Ga0436361_0148632 3300039447 Bacteria 2080
310 Ga0439453_0023194 3300041408 Bacteria 1131
311 Ga0451804_0850480 3300041463 Bacteria 935
312 Ga0451807_0017135 3300041486 Bacteria 2085
313 Ga0439446_0006978 3300042156 Bacteria 2960
314 Ga0439434_0002530 3300042435 Bacteria 5322
315 Ga0439435_0003248 3300042436 Bacteria 3358
316 Ga0451577_0831509 3300042876 Bacteria 833
317 Ga0453684_0900114 3300044712 Bacteria 948
318 Ga0451576_0002079 3300045051 Bacteria 31278
319 Ga0495592_0001375 3300046454 Bacteria 16827
320 Ga0495592_0613775 3300046454 Bacteria 662
321 Ga0495603_0053006 3300046455 Bacteria 2407
322 Ga0495641_0040439 3300046461 Bacteria 2168
323 Ga0495651_0050549 3300046462 Bacteria 3207
324 Ga0495651_0369137 3300046462 Bacteria 944
325 Ga0495580_0013907 3300046472 Bacteria 6126
326 Ga0495639_0017180 3300046475 Bacteria 3143
327 Ga0495662_0015901 3300046476 Bacteria 3652
328 Ga0495594_0045009 3300046499 Bacteria 2422
329 Ga0495594_0636656 3300046499 Bacteria 604
330 Ga0495608_0000746 3300046511 Bacteria 22716
331 Ga0495618_0044016 3300046514 Bacteria 2816
332 Ga0495628_0026620 3300046516 Bacteria 4711
333 Ga0495628_1049124 3300046516 Bacteria 559
334 Ga0495630_0001540 3300046517 Bacteria 16001
335 Ga0495630_0629206 3300046517 Bacteria 822
336 Ga0495666_0020142 3300046526 Bacteria 3308
337 Ga0495652_0633438 3300046529 Bacteria 726
338 Ga0495665_0043290 3300046531 Bacteria 2395
339 Ga0495640_0007837 3300046533 Bacteria 8401
340 Ga0495586_0002270 3300046535 Bacteria 10459
341 Ga0495586_0002644 3300046535 Bacteria 9686
342 Ga0495621_0165856 3300046539 Bacteria 876
343 Ga0495645_0059683 3300046543 Bacteria 2765
344 Ga0495667_0001154 3300046559 Bacteria 17216
345 Ga0495667_0188799 3300046559 Bacteria 1321
346 Ga0495634_0002937 3300046642 Bacteria 13929
347 Ga0495635_0131910 3300046663 Bacteria 1703
348 Ga0495659_0046939 3300046664 Bacteria 1561
349 Ga0495588_0063072 3300046674 Bacteria 1921
350 Ga0495657_0285287 3300046675 Bacteria 987
351 Ga0495599_0012349 3300046678 Bacteria 5262
352 Ga0495599_0173267 3300046678 Bacteria 1331
353 Ga0495647_0000634 3300046681 Bacteria 10380
354 Ga0495658_0001932 3300046683 Bacteria 10593
355 Ga0495658_0014117 3300046683 Bacteria 4074
356 Ga0495613_0003811 3300046689 Bacteria 11301
357 Ga0495624_0043163 3300046690 Bacteria 2877
358 Ga0495670_0513489 3300046691 Bacteria 651
359 Ga0495600_0009368 3300046809 Bacteria 6050
360 Ga0495581_0231260 3300047315 Bacteria 1081
361 Ga0495604_0213483 3300047317 Bacteria 1332
362 Ga0495636_0006809 3300047318 Bacteria 4493
363 Ga0495676_0032303 3300047321 Bacteria 4420
364 Ga0495680_0005504 3300047322 Bacteria 11895
365 Ga0501291_033775 3300049514 Bacteria 874
366 Ga0501298_017844 3300049521 Bacteria 1299
367 Ga0501031_0889967 3300049568 Bacteria 570
368 Ga0501036_1700892 3300049572 Bacteria 508
369 Ga0501041_0172003 3300049577 Bacteria 1356
370 Ga0501070_0544309 3300049586 Bacteria 930
371 Ga0501045_1415937 3300049824 Bacteria 505
372 nmdc:mga05p37_200_c1 3300050507 Bacteria 59779
373 nmdc:mga05p37_365445_c1 3300050507 Bacteria 1695
374 nmdc:mga05p37_38025_c1 3300050507 Bacteria 5902
375 nmdc:mga09592_103887_c1 3300050508 Bacteria 2435
376 nmdc:mga09592_1056747_c1 3300050508 Bacteria 677
377 nmdc:mga09592_10_c1 3300050508 Bacteria 106937
378 nmdc:mga09592_117633_c1 3300050508 Bacteria 1804
379 nmdc:mga09592_16139_c1 3300050508 Bacteria 6104
380 nmdc:mga0qj67_16518_c1 3300050509 Bacteria 5601
381 nmdc:mga0qj67_578397_c1 3300050509 Bacteria 900
382 nmdc:mga0qj67_762435_c1 3300050509 Bacteria 767
383 nmdc:mga06r32_181286_c1 3300050510 Bacteria 2092
384 nmdc:mga06r32_41847_c1 3300050510 Bacteria 4354
385 nmdc:mga06r32_831622_c1 3300050510 Bacteria 883
386 nmdc:mga08y16_11238_c1 3300050511 Bacteria 9405
387 nmdc:mga08y16_204712_c1 3300050511 Bacteria 2045
388 nmdc:mga08y16_23154_c1 3300050511 Bacteria 6558
389 nmdc:mga08y16_363410_c1 3300050511 Bacteria 1486
390 nmdc:mga08y16_81369_c1 3300050511 Bacteria 3377
391 nmdc:mga0n895_1412778_c1 3300050512 Bacteria 664
392 nmdc:mga0n895_178_c1 3300050512 Bacteria 38979
393 nmdc:mga0n895_27409_c1 3300050512 Bacteria 5413
394 nmdc:mga0n895_454247_c1 3300050512 Bacteria 1293
395 nmdc:mga0n895_89007_c1 3300050512 Bacteria 3088
396 nmdc:mga0rr50_1042_c1 3300050513 Bacteria 15040
397 nmdc:mga0rr50_184090_c1 3300050513 Bacteria 1709
398 nmdc:mga0rr50_548798_c1 3300050513 Bacteria 984
399 nmdc:mga08x19_2450_c1 3300050514 Bacteria 11279
400 nmdc:mga08x19_51888_c1 3300050514 Bacteria 2636
401 nmdc:mga0a205_29225_c1 3300050515 Bacteria 5275
402 nmdc:mga0a205_444453_c1 3300050515 Bacteria 1157
403 nmdc:mga0a205_5618_c1 3300050515 Bacteria 4378
404 Ga0495601_0008188 3300053077 Bacteria 6166
405 Ga0495619_0583302 3300053085 Bacteria 766
406 Ga0500566_0286572 3300053094 Bacteria 782
407 Ga0070683_100028768
408 ARSoilOldRDRAFT_c009598
409 JGI24738J21930_10037873
410 Ga0065704_10741046
411 Ga0065707_10011026
412 Ga0065707_10283301
413 Ga0065707_10906398
414 Ga0070658_10943773
415 Ga0070676_10287467
416 Ga0070676_10439831
417 Ga0070690_100000497
418 Ga0070690_100497326
419 Ga0068869_100002100
420 Ga0068869_100322732
421 Ga0070666_10153687
422 Ga0070680_100001571
423 Ga0070680_100185206
424 Ga0070682_100016604
425 Ga0070682_100113347
426 Ga0068868_100004467
427 Ga0070689_100009090
428 Ga0070689_100271280
429 Ga0070689_100298779
430 Ga0070691_10001745
431 Ga0070691_10602122
432 Ga0070687_100000268
433 Ga0070687_100437580
434 Ga0070687_100864132
435 Ga0070661_100969432
436 Ga0070692_10000432
437 Ga0070692_10051279
438 Ga0070669_100029801
439 Ga0070669_100443702
440 Ga0070675_100124379
441 Ga0070675_100202779
442 Ga0070671_100153948
443 Ga0070674_100761811
444 Ga0070673_100189052
445 Ga0070688_100393092
446 Ga0070703_10045638
447 Ga0070701_10000083
448 Ga0070701_10173687
449 Ga0070705_100000645
450 Ga0070705_100818090
451 Ga0070705_101385263
452 Ga0070700_100000249
453 Ga0070700_100017861
454 Ga0070700_100080284
455 Ga0070700_101085849
456 Ga0070694_100000382
457 Ga0070694_100037526
458 Ga0070694_100293327
459 Ga0070678_100353862
460 Ga0070662_100912696
461 Ga0070662_100982628
462 Ga0070681_10000281
463 Ga0070681_10030881
464 Ga0068867_100000534
465 Ga0070679_100007368
466 Ga0070684_100440394
467 Ga0070697_100864089
468 Ga0070672_100293242
469 Ga0070686_100000299
470 Ga0070686_100247524
471 Ga0070686_100259650
472 Ga0070695_100000816
473 Ga0070695_100009787
474 Ga0070696_100002955
475 Ga0070696_101163123
476 Ga0070693_100000281
477 Ga0070693_100402208
478 Ga0070704_100000420
479 Ga0070704_100016890
480 Ga0070704_101214812
481 Ga0068855_100002028
482 Ga0070664_100581126
483 Ga0068857_100173627
484 Ga0068854_100003188
485 Ga0068856_101792393
486 Ga0070702_100004547
487 Ga0070702_100056050
488 Ga0070702_100314420
489 Ga0068852_100260290
490 Ga0068859_100017570
491 Ga0068859_100882149
492 Ga0068864_100224262
493 Ga0068866_10000506
494 Ga0068866_10416165
495 Ga0068861_100000192
496 Ga0068861_100027893
497 Ga0068870_10095825
498 Ga0068863_101007838
499 Ga0068858_100005818
500 Ga0068860_100002610
501 Ga0068860_100305352
502 Ga0068862_100005986
503 Ga0068862_100062344
504 Ga0068862_100164333
505 Ga0097621_100001387
506 Ga0097621_100004557
507 Ga0068871_100005563
508 Ga0068871_100006222
509 Ga0075428_100012898
510 Ga0075428_100033852
511 Ga0075428_100112140
512 Ga0075428_100283034
513 Ga0075428_100654336
514 Ga0075430_100003086
515 Ga0075431_100003399
516 Ga0075431_100116063
517 Ga0075431_100320765
518 Ga0075431_100396797
519 Ga0075431_100427251
520 Ga0075433_10226689
521 Ga0075433_10237122
522 Ga0075433_10484263
523 Ga0075433_11417932
524 Ga0075434_100003193
525 Ga0075434_100015589
526 Ga0075434_100264994
527 Ga0075434_101467612
528 Ga0075434_102052700
529 Ga0075429_100001188
530 Ga0075429_100083802
531 Ga0075429_100100749
532 Ga0075429_100128289
533 Ga0075429_100738233
534 Ga0068865_100000300
535 Ga0068865_100024268
536 Ga0075436_100002839
537 Ga0075436_100177276
538 Ga0097620_100017569
539 Ga0097620_100882313
540 Ga0105250_10238311
541 Ga0105240_10306831
542 Ga0111539_10011072
543 Ga0111539_10042374
544 Ga0111539_10045087
545 Ga0111539_10082567
546 Ga0111539_10141530
547 Ga0111539_10653503
548 Ga0105245_10000821
549 Ga0105245_12063203
550 Ga0114129_10000249
551 Ga0114129_10276604
552 Ga0114129_10877174
553 Ga0105243_10001374
554 Ga0105243_10041257
555 Ga0105241_10081780
556 Ga0105241_10105540
557 Ga0105242_10007413
558 Ga0105242_11899851
559 Ga0105237_12251947
560 Ga0105249_10000348
561 Ga0105249_10046388
562 Ga0105239_10188151
563 Ga0105239_10203197
564 Ga0105246_10211276
565 Ga0105246_11409405
566 Ga0157336_1008557
567 Ga0157314_1025422
568 Ga0157369_11258653
569 Ga0157378_10001675
570 Ga0157378_11690619
571 Ga0163162_10224721
572 Ga0157375_10895242
573 Ga0157380_10078186
574 Ga0157380_10233312
575 Ga0157377_10211207
576 Ga0157379_10233506
577 Ga0157376_10005372
578 Ga0157376_10274815
579 Ga0207682_10007693
580 Ga0207692_10104717
581 Ga0207642_10000533
582 Ga0207642_10009936
583 Ga0207642_10576022
584 Ga0207688_10288598
585 Ga0207688_10649217
586 Ga0207680_10103122
587 Ga0207685_10136202
588 Ga0207645_10147488
589 Ga0207645_10179813
590 Ga0207643_10033481
591 Ga0207643_10624256
592 Ga0207654_10113018
593 Ga0207707_10009521
594 Ga0207707_10022575
595 Ga0207695_10328479
596 Ga0207660_10020585
597 Ga0207660_10237791
598 Ga0207662_10000155
599 Ga0207662_10078813
600 Ga0207662_10561870
601 Ga0207652_10013379
602 Ga0207681_10140896
603 Ga0207681_10680448
604 Ga0207659_10118963
605 Ga0207659_10148704
606 Ga0207687_10004271
607 Ga0207644_10103349
608 Ga0207706_10093321
609 Ga0207706_10182090
610 Ga0207686_10000347
611 Ga0207709_10000647
612 Ga0207709_10211368
613 Ga0207670_10017983
614 Ga0207670_10100919
615 Ga0207670_10174852
616 Ga0207670_11000367
617 Ga0207704_10002446
618 Ga0207704_10026527
619 Ga0207691_10100076
620 Ga0207689_10002111
621 Ga0207689_10172526
622 Ga0207661_10078085
623 Ga0207667_10038575
624 Ga0207651_10121603
625 Ga0207651_10237631
626 Ga0207651_10517796
627 Ga0207712_10004246
628 Ga0207712_10301538
629 Ga0207640_10002134
630 Ga0207677_10002515
631 Ga0207703_10005929
632 Ga0207708_10000502
633 Ga0207708_10068942
634 Ga0207708_10071080
635 Ga0207708_10161961
636 Ga0207708_10375859
637 Ga0207702_10131874
638 Ga0207641_10949664
639 Ga0207648_10001446
640 Ga0207648_10021067
641 Ga0207675_100000334
642 Ga0207675_100007076
643 Ga0207675_100438924
644 Ga0207675_100529924
645 Ga0207683_10769094
646 Ga0207698_10329262
647 Ga0209981_1070749
648 Ga0209995_1072651
649 Ga0209999_1085224
650 Ga0207428_10000688
651 Ga0207428_10004110
652 Ga0207428_10069586
653 Ga0207428_10103545
654 Ga0207428_10124393
655 Ga0268265_10003429
656 Ga0268265_10128235
657 Ga0268264_10008076
658 Ga0268264_10221353
659 Ga0265328_10048903
660 Ga0265325_10079125
661 Ga0265339_10007733
662 Ga0265316_10230868
663 Ga0307408_100115727
664 Ga0316575_10163274
665 Ga0265314_10144618
666 Ga0307412_10044294
667 Ga0307416_100273075
668 Ga0307416_101122693
669 Ga0307416_103090447
670 Ga0307411_10261308
671 Ga0373950_0010292
672 Ga0373950_0098379
673 Ga0373958_0016755
674 Ga0373938_0007419
675 Ga0373926_0039553
676 Ga0373928_0006877
677 Ga0373934_0047911
678 Ga0373944_0003286
679 Ga0373949_0003409
680 Ga0373949_0058425
681 Ga0373951_0005820
682 Ga0373923_0034389
683 Ga0373923_0224009
684 Ga0373932_0003854
685 Ga0373936_0052851
686 Ga0373939_0031976
687 Ga0373939_0131285
688 Ga0373941_0466047
689 Ga0373945_0005160
690 Ga0373953_0156931
691 Ga0373954_0000034
692 Ga0373956_0417223
693 Ga0373960_0032199
694 Ga0373943_0047535
695 Ga0373946_0133963
696 Ga0373955_0048893
697 Ga0373955_0155636
698 Ga0373942_0005132
699 Ga0373942_0041384
700 Ga0373961_0006847
701 Ga0316574_0307100
702 Ga0373924_0020122
703 Ga0373924_0093595
704 Ga0373931_0000452
705 Ga0373931_0014473
706 Ga0373931_0216901
707 Ga0373931_1235356
708 Ga0373935_0071165
709 Ga0373935_0116217
710 Ga0373927_0010513
711 Ga0373933_0006070
712 Ga0373933_0157868
713 Ga0373937_0000166
714 Ga0373937_0064456
715 Ga0436361_0148632
716 Ga0439453_0023194
717 Ga0451804_0850480
718 Ga0451807_0017135
719 Ga0439446_0006978
720 Ga0439434_0002530
721 Ga0439435_0003248
722 Ga0451577_0831509
723 Ga0453684_0900114
724 Ga0451576_0002079
725 Ga0495592_0001375
726 Ga0495592_0613775
727 Ga0495603_0053006
728 Ga0495641_0040439
729 Ga0495651_0050549
730 Ga0495651_0369137
731 Ga0495580_0013907
732 Ga0495639_0017180
733 Ga0495662_0015901
734 Ga0495594_0045009
735 Ga0495594_0636656
736 Ga0495608_0000746
737 Ga0495618_0044016
738 Ga0495628_0026620
739 Ga0495628_1049124
740 Ga0495630_0001540
741 Ga0495630_0629206
742 Ga0495666_0020142
743 Ga0495652_0633438
744 Ga0495665_0043290
745 Ga0495640_0007837
746 Ga0495586_0002270
747 Ga0495586_0002644
748 Ga0495621_0165856
749 Ga0495645_0059683
750 Ga0495667_0001154
751 Ga0495667_0188799
752 Ga0495634_0002937
753 Ga0495635_0131910
754 Ga0495659_0046939
755 Ga0495588_0063072
756 Ga0495657_0285287
757 Ga0495599_0012349
758 Ga0495599_0173267
759 Ga0495647_0000634
760 Ga0495658_0001932
761 Ga0495658_0014117
762 Ga0495613_0003811
763 Ga0495624_0043163
764 Ga0495670_0513489
765 Ga0495600_0009368
766 Ga0495581_0231260
767 Ga0495604_0213483
768 Ga0495636_0006809
769 Ga0495676_0032303
770 Ga0495680_0005504
771 Ga0501291_033775
772 Ga0501298_017844
773 Ga0501031_0889967
774 Ga0501036_1700892
775 Ga0501041_0172003
776 Ga0501070_0544309
777 Ga0501045_1415937
778 nmdc:mga05p37_200_c1
779 nmdc:mga05p37_365445_c1
780 nmdc:mga05p37_38025_c1
781 nmdc:mga09592_103887_c1
782 nmdc:mga09592_1056747_c1
783 nmdc:mga09592_10_c1
784 nmdc:mga09592_117633_c1
785 nmdc:mga09592_16139_c1
786 nmdc:mga0qj67_16518_c1
787 nmdc:mga0qj67_578397_c1
788 nmdc:mga0qj67_762435_c1
789 nmdc:mga06r32_181286_c1
790 nmdc:mga06r32_41847_c1
791 nmdc:mga06r32_831622_c1
792 nmdc:mga08y16_11238_c1
793 nmdc:mga08y16_204712_c1
794 nmdc:mga08y16_23154_c1
795 nmdc:mga08y16_363410_c1
796 nmdc:mga08y16_81369_c1
797 nmdc:mga0n895_1412778_c1
798 nmdc:mga0n895_178_c1
799 nmdc:mga0n895_27409_c1
800 nmdc:mga0n895_454247_c1
801 nmdc:mga0n895_89007_c1
802 nmdc:mga0rr50_1042_c1
803 nmdc:mga0rr50_184090_c1
804 nmdc:mga0rr50_548798_c1
805 nmdc:mga08x19_2450_c1
806 nmdc:mga08x19_51888_c1
807 nmdc:mga0a205_29225_c1
808 nmdc:mga0a205_444453_c1
809 nmdc:mga0a205_5618_c1
810 Ga0495601_0008188
811 Ga0495619_0583302
812 Ga0500566_0286572

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06146

PsiE

Phosphate-starvation-inducible E family

28

138

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nfd-assembly2.cif.gz_B antiparallel monomeric coiled coil of kif21a 0.6993 58 138
7l2i-assembly1.cif.gz_A cryo-em structure of full-length trpv1 at ph6a state 0.6455 26 109
7l2k-assembly1.cif.gz_B cryo-em structure of full-length trpv1 at ph6b state 0.644 24 101
4wwf-assembly2.cif.gz_B-2 high-resolution structure of two ni-bound forms of the m123c mutant of c. metallidurans cnrxs 0.643 67 132
4knf-assembly1.cif.gz_A crystal structure of a blue-light absorbing proteorhodopsin double-mutant d97n/q105l from hot75 0.6316 31 103
ID Description Score Start End Superfamily
1fouB01 Mainly Alpha;Orthogonal Bundle;Serum Albumin; Chain A, Domain 1; 0.8407 88 132 1.10.246.30
af_P37147_6_115_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7629 15 75 1.10.1760.20
2c0sA00 Few Secondary Structures;Irregular;MYOD Basic-Helix-Loop-Helix Domain, subunit B;Helix-loop-helix DNA-binding domain 0.7199 84 141 4.10.280.10
af_Q9NAP9_125_216_1.10.287.10 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.6731 60 123 1.10.287.10
af_K7L1C5_158_447_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.67 30 127 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A658G2Y8-F1-model_v4 deleted 0.9313 1 98
AF-A0A2R7TGH3-F1-model_v4 deleted 0.924 1 97
AF-A0A658G2Y8-F1-model_v4 deleted 0.9138 1 98
AF-A0A2R7TGH3-F1-model_v4 deleted 0.9066 1 97
AF-S5THC9-F1-model_v4 Protein PsiE 0.8515 18 138 GO:0005886

Map