F436096

General Info

Members Datasets Scaffolds Average Seq Length
405 250 393 200

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2935732158|2935733608
Length 204
Sequence ELSSVAGWGWRTNAWQQSKEYEMRIRDLSREEMSGAQRRVADEATSGKRGRVPAPLRAWLHSPVLGSRAQLLGEFARYDTILGPKLSELAILITARFWTSHYEWFAHKREALKAGLDPSIVDAIAAREVPIIEEAKSKAVYDYVVELQRTHLVSDQTHTTAVKELGEQGVVELVGVLGYYTLVAMTLNAFEIGLPEGEETELRS

Samples

Sample ID Description Type Environment
1 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
2 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
3 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
4 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
50 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
63 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
64 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
65 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
66 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
67 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
68 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
69 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
70 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
71 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
72 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
73 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
74 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
75 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
76 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
77 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
78 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
79 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
80 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
81 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
82 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
83 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
84 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
85 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
86 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
87 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
96 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
97 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
98 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
99 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
100 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
101 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
102 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
103 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
104 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
105 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
106 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
107 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
108 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
109 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
110 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
111 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
112 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
113 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
114 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
115 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
116 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
117 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
118 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
122 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
123 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
124 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
125 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
126 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
127 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
128 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
129 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
130 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
131 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
132 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
133 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
134 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
135 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
136 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
137 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
138 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
139 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
140 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
141 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
142 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
143 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
144 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
145 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
148 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
149 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
150 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
151 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
152 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
153 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
154 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
159 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
160 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
161 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
162 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
163 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
181 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
182 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
183 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
184 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
185 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
201 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
202 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
208 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
215 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
216 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
217 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
218 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
219 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
222 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
223 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
224 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
225 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
228 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
229 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
230 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
231 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
232 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
233 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
234 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
235 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
236 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
237 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
238 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
239 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
240 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
241 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
242 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
243 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
244 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
245 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
246 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
247 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
248 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
249 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
250 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.04
Metatranscriptomes 0
Isolates 2.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.36
Nodule 2.72
Rhizoplane 11.36
Rhizosphere 65.93
Stem 0
Stem Tuber 0
Unclassified 8.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10001477 3300003320 Bacteria 1151
2 Ga0070658_10066699 3300005327 Bacteria 2940
3 Ga0068869_101572205 3300005334 Bacteria 585
4 Ga0070689_100694011 3300005340 Bacteria 888
5 Ga0070668_100624073 3300005347 Bacteria 945
6 Ga0070710_10441396 3300005437 Bacteria 880
7 Ga0070711_100182755 3300005439 Bacteria 1606
8 Ga0070678_100020516 3300005456 Bacteria 4337
9 Ga0070681_10036946 3300005458 Bacteria 4902
10 Ga0070679_100184275 3300005530 Bacteria 2059
11 Ga0070686_101304045 3300005544 Unclassified 606
12 Ga0068859_100923353 3300005617 Unclassified 957
13 Ga0068860_100124473 3300005843 Bacteria 2471
14 Ga0068862_100049831 3300005844 Bacteria 3578
15 Ga0075365_10008427 3300006038 Bacteria 5852
16 Ga0075368_10000295 3300006042 Bacteria 14352
17 Ga0075368_10014974 3300006042 Bacteria 2871
18 Ga0075363_100014421 3300006048 Bacteria 3862
19 Ga0075363_100017534 3300006048 Bacteria 3552
20 Ga0075363_100117671 3300006048 Unclassified 1481
21 Ga0075364_10027040 3300006051 Bacteria 3662
22 Ga0075362_10021415 3300006177 Bacteria 2712
23 Ga0075367_10000730 3300006178 Bacteria 12773
24 Ga0075367_10002322 3300006178 Bacteria 8645
25 Ga0068871_100068643 3300006358 Bacteria 2911
26 Ga0075428_100006547 3300006844 Bacteria 12951
27 Ga0075430_100271638 3300006846 Bacteria 1403
28 Ga0075431_100176772 3300006847 Bacteria 2192
29 Ga0097620_100923034 3300006931 Unclassified 957
30 Ga0111539_11210582 3300009094 Unclassified 877
31 Ga0114129_10078906 3300009147 Bacteria 4578
32 Ga0105243_10076280 3300009148 Bacteria 2723
33 Ga0105248_10259252 3300009177 Bacteria 1957
34 Ga0105248_10626543 3300009177 Bacteria 1214
35 Ga0105237_10244365 3300009545 Bacteria 1796
36 Ga0105237_10444743 3300009545 Bacteria 1302
37 Ga0105238_10294999 3300009551 Bacteria 1604
38 Ga0105239_10059617 3300010375 Bacteria 4189
39 Ga0105239_11077087 3300010375 Bacteria 925
40 Ga0105246_10432696 3300011119 Bacteria 1101
41 Ga0157313_1004132 3300012503 Bacteria 980
42 Ga0157369_10008800 3300013105 Bacteria 11568
43 Ga0157374_10012415 3300013296 Bacteria 7411
44 Ga0163162_10026997 3300013306 Bacteria 5678
45 Ga0163162_10796080 3300013306 Bacteria 1063
46 Ga0163162_11141181 3300013306 Bacteria 884
47 Ga0157372_10283841 3300013307 Bacteria 1925
48 Ga0157375_10036499 3300013308 Bacteria 4703
49 Ga0157375_10184132 3300013308 Bacteria 2241
50 Ga0157375_10386971 3300013308 Bacteria 1565
51 Ga0163163_10278119 3300014325 Bacteria 1725
52 Ga0163163_10336132 3300014325 Bacteria 1565
53 Ga0157380_11318990 3300014326 Unclassified 770
54 Ga0182008_10070166 3300014497 Bacteria 1724
55 Ga0157379_10457936 3300014968 Bacteria 1178
56 Ga0157376_10276232 3300014969 Bacteria 1580
57 Ga0157376_10620860 3300014969 Bacteria 1078
58 Ga0213876_10010012 3300021384 Bacteria 5095
59 Ga0213876_10011280 3300021384 Bacteria 4772
60 Ga0207710_10060865 3300025900 Bacteria 1712
61 Ga0207705_10023420 3300025909 Bacteria 4405
62 Ga0207707_10004596 3300025912 Bacteria 12123
63 Ga0207695_10090524 3300025913 Bacteria 3074
64 Ga0207695_10406417 3300025913 Bacteria 1246
65 Ga0207671_10346612 3300025914 Bacteria 1177
66 Ga0207660_10050646 3300025917 Bacteria 2950
67 Ga0207652_10039873 3300025921 Bacteria 3987
68 Ga0207650_10814247 3300025925 Bacteria 792
69 Ga0207668_10534924 3300025972 Bacteria 1013
70 Ga0207678_10267012 3300026067 Bacteria 1467
71 Ga0207675_100349717 3300026118 Unclassified 1448
72 Ga0207698_10888261 3300026142 Bacteria 898
73 Ga0209813_10021634 3300027866 Bacteria 1810
74 Ga0209813_10023100 3300027866 Bacteria 1766
75 Ga0307511_10146226 3300030521 Bacteria 1372
76 Ga0307508_10058543 3300031616 Bacteria 3408
77 Ga0307516_10266508 3300031730 Bacteria 1401
78 Ga0307406_10393915 3300031901 Bacteria 1096
79 Ga0307409_100424876 3300031995 Bacteria 1276
80 Ga0307414_10379280 3300032004 Bacteria 1222
81 Ga0307411_10663578 3300032005 Unclassified 904
82 Ga0307411_10779708 3300032005 Unclassified 840
83 Ga0307507_10023773 3300033179 Bacteria 6708
84 Ga0373930_0036176 3300034816 Bacteria 1035
85 Ga0373934_0086548 3300035086 Bacteria 1261
86 Ga0373951_0058793 3300035091 Bacteria 959
87 Ga0373923_0062578 3300035111 Bacteria 1584
88 Ga0373936_0005423 3300035113 Bacteria 4809
89 Ga0373945_0017581 3300035116 Bacteria 2422
90 Ga0373945_0029541 3300035116 Bacteria 1927
91 Ga0373945_0164232 3300035116 Bacteria 907
92 Ga0373953_0052094 3300035117 Bacteria 1656
93 Ga0373953_0121117 3300035117 Bacteria 1111
94 Ga0373954_0007611 3300035118 Bacteria 4742
95 Ga0373954_0101070 3300035118 Bacteria 1391
96 Ga0373956_0156203 3300035119 Bacteria 1074
97 Ga0373957_0091856 3300035120 Bacteria 1207
98 Ga0373943_0029135 3300035170 Bacteria 2607
99 Ga0373943_0458457 3300035170 Unclassified 741
100 Ga0373955_0284299 3300035172 Bacteria 995
101 Ga0373924_0167326 3300035410 Bacteria 965
102 Ga0373924_0211381 3300035410 Bacteria 856
103 Ga0373931_0120931 3300035691 Bacteria 1496
104 Ga0373935_0001604 3300035692 Bacteria 12605
105 Ga0373935_0107985 3300035692 Bacteria 1843
106 Ga0373935_0570580 3300035692 Unclassified 826
107 Ga0373927_0000071 3300035695 Bacteria 73794
108 Ga0373927_0015519 3300035695 Bacteria 5031
109 Ga0373947_0008795 3300035725 Bacteria 5806
110 Ga0373947_0010412 3300035725 Bacteria 5336
111 Ga0373937_0068839 3300036401 Bacteria 3263
112 Ga0373937_0277750 3300036401 Bacteria 1581
113 Ga0373937_0770422 3300036401 Bacteria 910
114 Ga0373925_0001901 3300037068 Bacteria 17330
115 Ga0373925_0128987 3300037068 Bacteria 1970
116 Ga0395899_0045223 3300037312 Bacteria 3280
117 Ga0395900_0006407 3300037418 Bacteria 12267
118 Ga0395900_1009965 3300037418 Bacteria 751
119 Ga0395898_0017762 3300037466 Bacteria 7258
120 Ga0436364_0109537 3300037853 Bacteria 2187
121 Ga0436364_0163097 3300037853 Unclassified 1687
122 Ga0436364_1306917 3300037853 Bacteria 2228
123 Ga0395901_0019529 3300038443 Bacteria 6927
124 Ga0395901_0299843 3300038443 Bacteria 1666
125 Ga0436365_0078588 3300039437 Bacteria 908
126 Ga0436365_0396709 3300039437 Bacteria 84982
127 Ga0436365_0409965 3300039437 Bacteria 4733
128 Ga0436365_0947697 3300039437 Bacteria 43388
129 Ga0436365_1362388 3300039437 Unclassified 1299
130 Ga0436360_1264993 3300039438 Bacteria 2092
131 Ga0436363_0943801 3300039450 Unclassified 1436
132 Ga0436363_1144479 3300039450 Bacteria 1251
133 Ga0436363_1445334 3300039450 Bacteria 13114
134 Ga0436362_0149313 3300039453 Bacteria 26010
135 Ga0436362_1109287 3300039453 Bacteria 2870
136 Ga0436362_1168951 3300039453 Bacteria 1235
137 Ga0439459_0061502 3300042438 Bacteria 849
138 Ga0495592_0075845 3300046454 Bacteria 2441
139 Ga0495603_0000035 3300046455 Bacteria 57510
140 Ga0495603_0153694 3300046455 Bacteria 1336
141 Ga0495603_0596241 3300046455 Unclassified 632
142 Ga0495629_0000081 3300046459 Bacteria 85305
143 Ga0495629_0204749 3300046459 Bacteria 1364
144 Ga0495629_0390859 3300046459 Bacteria 946
145 Ga0495641_0000707 3300046461 Bacteria 28228
146 Ga0495651_0079274 3300046462 Bacteria 2482
147 Ga0495651_0354773 3300046462 Bacteria 968
148 Ga0495653_0082161 3300046463 Bacteria 2379
149 Ga0495653_0166261 3300046463 Bacteria 1527
150 Ga0495580_0008037 3300046472 Bacteria 8423
151 Ga0495580_0211625 3300046472 Bacteria 1334
152 Ga0495582_0000051 3300046473 Bacteria 59010
153 Ga0495582_0131080 3300046473 Bacteria 1416
154 Ga0495605_0053051 3300046474 Bacteria 1968
155 Ga0495639_0000010 3300046475 Bacteria 93685
156 Ga0495639_0023860 3300046475 Bacteria 2690
157 Ga0495662_0000034 3300046476 Bacteria 46636
158 Ga0495664_0096808 3300046477 Bacteria 1776
159 Ga0495664_0292234 3300046477 Bacteria 984
160 Ga0495585_0113936 3300046492 Bacteria 1436
161 Ga0495585_0239738 3300046492 Bacteria 908
162 Ga0495594_0001027 3300046499 Bacteria 14537
163 Ga0495607_0112637 3300046501 Bacteria 1440
164 Ga0495606_0000265 3300046507 Bacteria 92526
165 Ga0495608_0200238 3300046511 Bacteria 1258
166 Ga0495608_0359848 3300046511 Bacteria 894
167 Ga0495618_0072070 3300046514 Bacteria 2198
168 Ga0495618_0210326 3300046514 Bacteria 1229
169 Ga0495620_0071851 3300046515 Bacteria 1414
170 Ga0495628_0024773 3300046516 Bacteria 4908
171 Ga0495628_0049737 3300046516 Bacteria 3318
172 Ga0495628_0369297 3300046516 Bacteria 1052
173 Ga0495630_0010715 3300046517 Bacteria 6621
174 Ga0495644_0080029 3300046523 Bacteria 1231
175 Ga0495666_0034413 3300046526 Bacteria 2473
176 Ga0495652_0020294 3300046529 Bacteria 5907
177 Ga0495652_0108697 3300046529 Bacteria 2234
178 Ga0495652_0162673 3300046529 Bacteria 1731
179 Ga0495665_0000005 3300046531 Bacteria 86491
180 Ga0495640_0004617 3300046533 Bacteria 10987
181 Ga0495640_0031735 3300046533 Bacteria 3768
182 Ga0495586_0250001 3300046535 Bacteria 1011
183 Ga0495587_0095712 3300046536 Bacteria 1713
184 Ga0495587_0433155 3300046536 Bacteria 729
185 Ga0495598_0004797 3300046537 Bacteria 2954
186 Ga0495598_0065533 3300046537 Bacteria 1131
187 Ga0495645_0063319 3300046543 Bacteria 2678
188 Ga0495622_0002332 3300046557 Bacteria 9240
189 Ga0495622_0057783 3300046557 Bacteria 1797
190 Ga0495667_0008367 3300046559 Bacteria 7020
191 Ga0495667_0025441 3300046559 Bacteria 3989
192 Ga0495667_0081352 3300046559 Bacteria 2105
193 Ga0495656_0028967 3300046615 Bacteria 2226
194 Ga0495656_0034244 3300046615 Bacteria 2078
195 Ga0495668_0142042 3300046616 Bacteria 1314
196 Ga0495634_0000261 3300046642 Bacteria 49735
197 Ga0495634_0115672 3300046642 Bacteria 1721
198 Ga0495611_0126272 3300046648 Bacteria 1193
199 Ga0495635_0000281 3300046663 Bacteria 32699
200 Ga0495659_0055639 3300046664 Bacteria 1450
201 Ga0495588_0038474 3300046674 Bacteria 2433
202 Ga0495657_0025308 3300046675 Bacteria 4217
203 Ga0495599_0028338 3300046678 Bacteria 3510
204 Ga0495623_0063209 3300046679 Bacteria 2318
205 Ga0495646_0010554 3300046680 Bacteria 5867
206 Ga0495646_0167784 3300046680 Bacteria 1211
207 Ga0495647_0055373 3300046681 Bacteria 1552
208 Ga0495658_0000367 3300046683 Bacteria 25339
209 Ga0495658_0015658 3300046683 Bacteria 3892
210 Ga0495658_0328546 3300046683 Unclassified 970
211 Ga0495669_0008884 3300046684 Bacteria 4233
212 Ga0495669_0108194 3300046684 Bacteria 1296
213 Ga0495669_0249853 3300046684 Bacteria 852
214 Ga0495613_0182025 3300046689 Bacteria 1488
215 Ga0495613_0553824 3300046689 Bacteria 769
216 Ga0495624_0000094 3300046690 Bacteria 59911
217 Ga0495624_0055520 3300046690 Bacteria 2494
218 Ga0495670_0218320 3300046691 Bacteria 1012
219 Ga0495671_0083833 3300046692 Bacteria 1562
220 Ga0495600_0004278 3300046809 Bacteria 8533
221 Ga0495600_0275740 3300046809 Bacteria 1065
222 Ga0495660_0279531 3300046810 Bacteria 764
223 Ga0495581_0000018 3300047315 Bacteria 58791
224 Ga0495604_0011502 3300047317 Bacteria 7029
225 Ga0495604_0043250 3300047317 Bacteria 3527
226 Ga0495604_0117913 3300047317 Bacteria 1925
227 Ga0495636_0071193 3300047318 Bacteria 1484
228 Ga0495674_0000134 3300047319 Bacteria 56618
229 Ga0495674_0401309 3300047319 Bacteria 1107
230 Ga0495676_0008740 3300047321 Bacteria 9268
231 Ga0495676_0178263 3300047321 Bacteria 1491
232 Ga0495680_0014317 3300047322 Bacteria 6876
233 Ga0495680_0101645 3300047322 Bacteria 2141
234 Ga0495680_0165938 3300047322 Bacteria 1601
235 Ga0495675_0096940 3300047444 Bacteria 1848
236 Ga0495684_0026032 3300047471 Bacteria 4496
237 Ga0495684_0033555 3300047471 Bacteria 3936
238 Ga0495684_0383228 3300047471 Bacteria 991
239 Ga0495684_0647132 3300047471 Bacteria 707
240 Ga0495686_0101120 3300047472 Unclassified 1738
241 Ga0495686_0166021 3300047472 Bacteria 1287
242 Ga0495593_0000084 3300047673 Bacteria 41155
243 Ga0495602_0557097 3300048088 Bacteria 794
244 Ga0495615_0061164 3300048090 Bacteria 994
245 Ga0495615_0114891 3300048090 Bacteria 773
246 Ga0496100_0105070 3300048903 Bacteria 1952
247 Ga0496100_0346742 3300048903 Bacteria 1121
248 Ga0496101_0041489 3300048904 Bacteria 3281
249 Ga0496102_0068794 3300048905 Bacteria 3249
250 Ga0496102_0198823 3300048905 Bacteria 1889
251 Ga0496102_0330798 3300048905 Bacteria 1435
252 Ga0496103_0050428 3300048906 Bacteria 2575
253 Ga0496104_0005304 3300048907 Bacteria 11278
254 Ga0496104_0142978 3300048907 Bacteria 2298
255 Ga0496104_0150704 3300048907 Bacteria 2232
256 Ga0496105_0001391 3300048908 Bacteria 16986
257 Ga0496105_0025939 3300048908 Bacteria 4775
258 Ga0496106_0002204 3300048909 Bacteria 14547
259 Ga0496106_0066088 3300048909 Bacteria 2754
260 Ga0496106_0122058 3300048909 Bacteria 2037
261 Ga0496106_0271677 3300048909 Bacteria 1357
262 Ga0496107_0003794 3300048910 Bacteria 10148
263 Ga0496107_0023877 3300048910 Bacteria 4322
264 Ga0496107_0340410 3300048910 Bacteria 1116
265 Ga0496107_0750196 3300048910 Bacteria 716
266 Ga0496108_0028116 3300048911 Bacteria 4652
267 Ga0496108_0722086 3300048911 Bacteria 863
268 Ga0496108_1015103 3300048911 Unclassified 708
269 Ga0496109_0023062 3300048912 Bacteria 5520
270 Ga0496109_0052197 3300048912 Bacteria 3726
271 Ga0496109_0930093 3300048912 Bacteria 807
272 Ga0496110_0003520 3300048913 Bacteria 12018
273 Ga0496110_0056895 3300048913 Bacteria 3441
274 Ga0496110_0100346 3300048913 Bacteria 2594
275 Ga0496110_0426203 3300048913 Bacteria 1209
276 Ga0496111_0009771 3300048914 Bacteria 6413
277 Ga0496111_0042660 3300048914 Bacteria 3258
278 Ga0496112_0000019 3300048915 Bacteria 185531
279 Ga0496112_0002348 3300048915 Bacteria 15192
280 Ga0496112_0002747 3300048915 Bacteria 14260
281 Ga0496112_0019982 3300048915 Bacteria 6339
282 Ga0496112_0108631 3300048915 Bacteria 2744
283 Ga0496113_0028669 3300048916 Bacteria 4007
284 Ga0496113_0291990 3300048916 Bacteria 1304
285 Ga0496114_0024760 3300048917 Bacteria 4900
286 Ga0496114_0583668 3300048917 Bacteria 986
287 Ga0496114_1091923 3300048917 Bacteria 683
288 Ga0496115_0002185 3300048918 Bacteria 14005
289 Ga0496115_0152094 3300048918 Bacteria 1911
290 Ga0496115_0165923 3300048918 Bacteria 1826
291 Ga0496115_0340972 3300048918 Bacteria 1223
292 Ga0496116_0034442 3300048919 Bacteria 3573
293 Ga0496117_0009904 3300048920 Bacteria 8771
294 Ga0496117_0112078 3300048920 Bacteria 1697
295 Ga0496118_0002208 3300048921 Bacteria 27018
296 Ga0496118_0005404 3300048921 Bacteria 14536
297 Ga0496118_0014192 3300048921 Bacteria 7471
298 Ga0496121_0000099 3300048924 Bacteria 200160
299 Ga0496121_0001792 3300048924 Bacteria 34718
300 Ga0496121_0008393 3300048924 Bacteria 12175
301 Ga0496124_0000962 3300048927 Bacteria 45849
302 Ga0496124_0522597 3300048927 Unclassified 790
303 Ga0496125_0172454 3300048928 Bacteria 1452
304 Ga0496125_0223952 3300048928 Bacteria 1209
305 Ga0496126_0032057 3300048929 Bacteria 4956
306 Ga0496126_0034397 3300048929 Bacteria 4759
307 Ga0496126_0215219 3300048929 Bacteria 1616
308 Ga0501031_0006545 3300049568 Bacteria 7596
309 Ga0501032_0000048 3300049569 Bacteria 106326
310 Ga0501032_0459027 3300049569 Bacteria 816
311 Ga0501033_0000184 3300049570 Bacteria 59970
312 Ga0501033_0109164 3300049570 Bacteria 2015
313 Ga0501033_0252312 3300049570 Bacteria 1250
314 Ga0501034_0000082 3300049571 Bacteria 170039
315 Ga0501036_0000791 3300049572 Bacteria 23456
316 Ga0501037_0000063 3300049573 Bacteria 97745
317 Ga0501038_0000295 3300049574 Bacteria 42291
318 Ga0501038_0152410 3300049574 Bacteria 1884
319 Ga0501039_0000082 3300049575 Bacteria 72201
320 Ga0501039_0668817 3300049575 Bacteria 813
321 Ga0501042_0022058 3300049578 Bacteria 4445
322 Ga0501042_0072742 3300049578 Bacteria 2460
323 Ga0501043_0000148 3300049579 Bacteria 65190
324 Ga0501043_0797842 3300049579 Bacteria 683
325 Ga0501046_0000101 3300049580 Bacteria 91179
326 Ga0501046_0235119 3300049580 Bacteria 1353
327 Ga0501047_0000671 3300049581 Bacteria 35653
328 Ga0501047_0046578 3300049581 Bacteria 4190
329 Ga0501048_0006649 3300049582 Bacteria 8789
330 Ga0501067_0000056 3300049583 Bacteria 64757
331 Ga0501067_0128253 3300049583 Bacteria 1411
332 Ga0501068_0000310 3300049584 Bacteria 24404
333 Ga0501069_0001375 3300049585 Bacteria 11943
334 Ga0501070_0037088 3300049586 Bacteria 4069
335 Ga0501070_0125385 3300049586 Bacteria 2122
336 Ga0501072_0006466 3300049588 Bacteria 8922
337 Ga0501073_0002349 3300049589 Bacteria 14161
338 Ga0501074_0000331 3300049590 Bacteria 27484
339 Ga0501076_0189251 3300049592 Bacteria 1679
340 Ga0501076_0241244 3300049592 Bacteria 1479
341 Ga0501079_0000586 3300049741 Bacteria 24123
342 Ga0501080_0000922 3300049742 Bacteria 24020
343 Ga0501083_0005043 3300049744 Bacteria 9353
344 Ga0501035_0001078 3300049822 Bacteria 28573
345 Ga0501035_0008869 3300049822 Bacteria 9358
346 Ga0501044_0000408 3300049823 Bacteria 52994
347 Ga0501044_0110243 3300049823 Bacteria 2761
348 Ga0501045_0001959 3300049824 Bacteria 13895
349 nmdc:mga03n38_164094_c1 3300050490 Bacteria 1127
350 nmdc:mga03n38_69012_c1 3300050490 Bacteria 1631
351 nmdc:mga03n38_99385_c1 3300050490 Bacteria 1401
352 nmdc:mga00v17_339373_c1 3300050491 Bacteria 977
353 nmdc:mga00v17_60223_c1 3300050491 Bacteria 2331
354 nmdc:mga0yw44_11580_c1 3300050492 Bacteria 4562
355 nmdc:mga0yw44_13411_c1 3300050492 Bacteria 4315
356 nmdc:mga0yw44_198426_c1 3300050492 Bacteria 1325
357 nmdc:mga0yw44_77443_c1 3300050492 Bacteria 2077
358 nmdc:mga06z11_1542_c1 3300050494 Bacteria 8556
359 nmdc:mga06z11_195072_c1 3300050494 Bacteria 1174
360 nmdc:mga06z11_589_c1 3300050494 Bacteria 13291
361 nmdc:mga04h51_28884_c1 3300050495 Bacteria 1733
362 nmdc:mga04h51_6889_c1 3300050495 Bacteria 2973
363 nmdc:mga07m45_34949_c1 3300050496 Bacteria 2795
364 nmdc:mga07m45_88478_c1 3300050496 Bacteria 1772
365 nmdc:mga05p37_34591_c1 3300050507 Bacteria 6189
366 nmdc:mga0qj67_667259_c1 3300050509 Bacteria 829
367 nmdc:mga06r32_112571_c1 3300050510 Bacteria 2678
368 Ga0495601_0149778 3300053077 Bacteria 1523
369 Ga0495601_0308955 3300053077 Bacteria 1030
370 Ga0495601_0374064 3300053077 Bacteria 925
371 Ga0495655_0082247 3300053083 Bacteria 923
372 Ga0495595_0270287 3300053084 Bacteria 852
373 Ga0495619_0093811 3300053085 Bacteria 2035
374 Ga0500643_058399 3300053087 Bacteria 1088
375 Ga0500644_0039159 3300053088 Bacteria 1561
376 Ga0500566_0000754 3300053094 Bacteria 18223
377 Ga0500641_0010456 3300053096 Bacteria 3354
378 Ga0500572_000364 3300053111 Bacteria 16144
379 Ga0500595_001436 3300053119 Bacteria 12768
380 Ga0500595_045201 3300053119 Bacteria 1392
381 Ga0500559_0004285 3300053136 Bacteria 6825
382 Ga0500603_013603 3300053150 Bacteria 1889
383 Ga0500603_058442 3300053150 Bacteria 1073
384 Ga0500620_002400 3300053155 Bacteria 3766
385 Ga0500627_0236230 3300053158 Bacteria 812
386 Ga0500639_006776 3300053163 Bacteria 5924
387 Ga0500639_037566 3300053163 Bacteria 2551
388 Ga0500636_0022288 3300053177 Bacteria 3749
389 Ga0500636_0114509 3300053177 Bacteria 1519
390 Ga0500637_0193316 3300053178 Bacteria 1161
391 Ga0500645_057886 3300053730 Bacteria 1123
392 Ga0501084_0002066 3300054114 Bacteria 16019
393 Ga0501082_0001007 3300060353 Bacteria 24901

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300021384 Ga0213876_10011280 Ga0213876_100112804 166
2 3300039437 Ga0436365_0396709 Ga0436365_0396709_74548_75096 166
3 3300013306 Ga0163162_11141181 Ga0163162_111411812 171
4 3300035170 Ga0373943_0458457 Ga0373943_0458457_13_531 171
5 3300050491 nmdc:mga00v17_339373_c1 nmdc:mga00v17_339373_c1_449_967 171
6 3300005327 Ga0070658_10066699 Ga0070658_100666993 176
7 3300025909 Ga0207705_10023420 Ga0207705_100234201 176
8 3300037312 Ga0395899_0045223 Ga0395899_0045223_36_584 176
9 3300037418 Ga0395900_1009965 Ga0395900_1009965_119_667 176
10 3300038443 Ga0395901_0299843 Ga0395901_0299843_977_1525 176
11 3300049569 Ga0501032_0459027 Ga0501032_0459027_141_689 176
12 3300049570 Ga0501033_0109164 Ga0501033_0109164_1371_1919 176
13 3300049570 Ga0501033_0252312 Ga0501033_0252312_612_1160 176
14 3300049579 Ga0501043_0797842 Ga0501043_0797842_116_664 176
15 iso_pu_bacteria 2899803654 2899803988 176
16 iso_pu_bacteria 2545555834 2545672587 177
17 iso_pu_bacteria 8016522445 8016526613 177
18 iso_pu_bacteria 8016530956 8016531696 177
19 iso_pu_bacteria 8016539877 8016544893 177
20 iso_pu_bacteria 8016548790 8016557179 177
21 iso_pu_bacteria 8016557553 8016565534 177
22 iso_pu_bacteria 8016566248 8016569968 177
23 iso_pu_bacteria 8016575299 8016582544 177
24 iso_pu_bacteria 8016595262 8016603153 177
25 3300005334 Ga0068869_101572205 Ga0068869_1015722051 181
26 3300005340 Ga0070689_100694011 Ga0070689_1006940112 181
27 3300005347 Ga0070668_100624073 Ga0070668_1006240732 181
28 3300005437 Ga0070710_10441396 Ga0070710_104413962 181
29 3300005439 Ga0070711_100182755 Ga0070711_1001827552 181
30 3300005544 Ga0070686_101304045 Ga0070686_1013040451 181
31 3300005617 Ga0068859_100923353 Ga0068859_1009233532 181
32 3300005843 Ga0068860_100124473 Ga0068860_1001244732 181
33 3300005844 Ga0068862_100049831 Ga0068862_1000498313 181
34 3300006038 Ga0075365_10008427 Ga0075365_100084272 181
35 3300006042 Ga0075368_10000295 Ga0075368_1000029513 181
36 3300006042 Ga0075368_10014974 Ga0075368_100149743 181
37 3300006048 Ga0075363_100014421 Ga0075363_1000144215 181
38 3300006048 Ga0075363_100017534 Ga0075363_1000175344 181
39 3300006048 Ga0075363_100117671 Ga0075363_1001176712 181
40 3300006051 Ga0075364_10027040 Ga0075364_100270403 181
41 3300006178 Ga0075367_10000730 Ga0075367_100007308 181
42 3300006178 Ga0075367_10002322 Ga0075367_100023226 181
43 3300006844 Ga0075428_100006547 Ga0075428_1000065475 181
44 3300006846 Ga0075430_100271638 Ga0075430_1002716381 181
45 3300006847 Ga0075431_100176772 Ga0075431_1001767723 181
46 3300006931 Ga0097620_100923034 Ga0097620_1009230342 181
47 3300009094 Ga0111539_11210582 Ga0111539_112105822 181
48 3300009147 Ga0114129_10078906 Ga0114129_100789065 181
49 3300011119 Ga0105246_10432696 Ga0105246_104326961 181
50 3300014326 Ga0157380_11318990 Ga0157380_113189901 181
51 3300021384 Ga0213876_10010012 Ga0213876_100100122 181
52 3300025900 Ga0207710_10060865 Ga0207710_100608651 181
53 3300025914 Ga0207671_10346612 Ga0207671_103466122 181
54 3300025972 Ga0207668_10534924 Ga0207668_105349241 181
55 3300026118 Ga0207675_100349717 Ga0207675_1003497171 181
56 3300027866 Ga0209813_10021634 Ga0209813_100216342 181
57 3300027866 Ga0209813_10023100 Ga0209813_100231003 181
58 3300030521 Ga0307511_10146226 Ga0307511_101462262 181
59 3300031616 Ga0307508_10058543 Ga0307508_100585432 181
60 3300031730 Ga0307516_10266508 Ga0307516_102665082 181
61 3300031901 Ga0307406_10393915 Ga0307406_103939152 181
62 3300031995 Ga0307409_100424876 Ga0307409_1004248762 181
63 3300032004 Ga0307414_10379280 Ga0307414_103792802 181
64 3300032005 Ga0307411_10663578 Ga0307411_106635782 181
65 3300032005 Ga0307411_10779708 Ga0307411_107797081 181
66 3300033179 Ga0307507_10023773 Ga0307507_100237734 181
67 3300035692 Ga0373935_0570580 Ga0373935_0570580_76_624 181
68 3300035695 Ga0373927_0015519 Ga0373927_0015519_3092_3640 181
69 3300036401 Ga0373937_0770422 Ga0373937_0770422_226_774 181
70 3300037853 Ga0436364_0109537 Ga0436364_0109537_856_1404 181
71 3300037853 Ga0436364_0163097 Ga0436364_0163097_137_685 181
72 3300037853 Ga0436364_1306917 Ga0436364_1306917_897_1445 181
73 3300039437 Ga0436365_0078588 Ga0436365_0078588_245_793 181
74 3300039437 Ga0436365_0947697 Ga0436365_0947697_37636_38187 181
75 3300039437 Ga0436365_1362388 Ga0436365_1362388_735_1283 181
76 3300039438 Ga0436360_1264993 Ga0436360_1264993_870_1418 181
77 3300039450 Ga0436363_0943801 Ga0436363_0943801_142_690 181
78 3300039450 Ga0436363_1144479 Ga0436363_1144479_210_758 181
79 3300039450 Ga0436363_1445334 Ga0436363_1445334_8328_8876 181
80 3300039453 Ga0436362_0149313 Ga0436362_0149313_20609_21157 181
81 3300039453 Ga0436362_1168951 Ga0436362_1168951_367_915 181
82 3300046455 Ga0495603_0596241 Ga0495603_0596241_10_558 181
83 3300046462 Ga0495651_0354773 Ga0495651_0354773_256_804 181
84 3300046477 Ga0495664_0292234 Ga0495664_0292234_226_774 181
85 3300046529 Ga0495652_0162673 Ga0495652_0162673_917_1465 181
86 3300046559 Ga0495667_0025441 Ga0495667_0025441_2671_3219 181
87 3300046616 Ga0495668_0142042 Ga0495668_0142042_143_691 181
88 3300046810 Ga0495660_0279531 Ga0495660_0279531_97_645 181
89 3300047322 Ga0495680_0165938 Ga0495680_0165938_581_1129 181
90 3300047471 Ga0495684_0647132 Ga0495684_0647132_138_686 181
91 3300049574 Ga0501038_0152410 Ga0501038_0152410_370_915 181
92 3300049575 Ga0501039_0668817 Ga0501039_0668817_153_698 181
93 3300049581 Ga0501047_0046578 Ga0501047_0046578_1045_1590 181
94 3300049586 Ga0501070_0125385 Ga0501070_0125385_434_979 181
95 3300049822 Ga0501035_0008869 Ga0501035_0008869_2131_2676 181
96 3300049823 Ga0501044_0110243 Ga0501044_0110243_1860_2405 181
97 3300050490 nmdc:mga03n38_164094_c1 nmdc:mga03n38_164094_c1_344_892 181
98 3300050492 nmdc:mga0yw44_13411_c1 nmdc:mga0yw44_13411_c1_2497_3045 181
99 3300050494 nmdc:mga06z11_1542_c1 nmdc:mga06z11_1542_c1_134_682 181
100 3300050494 nmdc:mga06z11_589_c1 nmdc:mga06z11_589_c1_12069_12617 181
101 3300050495 nmdc:mga04h51_28884_c1 nmdc:mga04h51_28884_c1_560_1108 181
102 3300050495 nmdc:mga04h51_6889_c1 nmdc:mga04h51_6889_c1_1515_2063 181
103 3300050496 nmdc:mga07m45_88478_c1 nmdc:mga07m45_88478_c1_938_1486 181
104 3300050507 nmdc:mga05p37_34591_c1 nmdc:mga05p37_34591_c1_2196_2744 181
105 3300050509 nmdc:mga0qj67_667259_c1 nmdc:mga0qj67_667259_c1_254_802 181
106 3300050510 nmdc:mga06r32_112571_c1 nmdc:mga06r32_112571_c1_351_899 181
107 3300053077 Ga0495601_0308955 Ga0495601_0308955_49_597 181
108 3300053111 Ga0500572_000364 Ga0500572_000364_12172_12732 181
109 3300053136 Ga0500559_0004285 Ga0500559_0004285_3465_4025 181
110 3300053158 Ga0500627_0236230 Ga0500627_0236230_167_715 181
111 3300053163 Ga0500639_006776 Ga0500639_006776_2179_2739 181
112 3300053177 Ga0500636_0022288 Ga0500636_0022288_954_1502 181
113 3300009545 Ga0105237_10444743 Ga0105237_104447432 182
114 3300010375 Ga0105239_10059617 Ga0105239_100596172 182
115 3300035692 Ga0373935_0107985 Ga0373935_0107985_294_845 182
116 3300037068 Ga0373925_0128987 Ga0373925_0128987_28_621 182
117 3300046683 Ga0495658_0328546 Ga0495658_0328546_177_728 182
118 3300048909 Ga0496106_0002204 Ga0496106_0002204_9961_10512 182
119 3300048911 Ga0496108_1015103 Ga0496108_1015103_19_570 182
120 3300048920 Ga0496117_0009904 Ga0496117_0009904_5284_5835 182
121 3300048921 Ga0496118_0002208 Ga0496118_0002208_16742_17293 182
122 3300048924 Ga0496121_0000099 Ga0496121_0000099_65049_65600 182
123 3300048927 Ga0496124_0000962 Ga0496124_0000962_17002_17553 182
124 3300048929 Ga0496126_0034397 Ga0496126_0034397_3930_4481 182
125 3300053119 Ga0500595_045201 Ga0500595_045201_566_1117 182
126 3300053150 Ga0500603_013603 Ga0500603_013603_606_1157 182
127 3300053177 Ga0500636_0114509 Ga0500636_0114509_308_859 182
128 3300053178 Ga0500637_0193316 Ga0500637_0193316_416_967 182
129 3300048917 Ga0496114_0583668 Ga0496114_0583668_155_778 184
130 3300047472 Ga0495686_0101120 Ga0495686_0101120_30_590 185
131 3300048924 Ga0496121_0008393 Ga0496121_0008393_11019_11579 185
132 3300048927 Ga0496124_0522597 Ga0496124_0522597_37_597 185
133 3300048928 Ga0496125_0172454 Ga0496125_0172454_700_1260 185
134 3300048908 Ga0496105_0001391 Ga0496105_0001391_1329_1922 189
135 3300048912 Ga0496109_0023062 Ga0496109_0023062_2726_3319 189
136 3300048913 Ga0496110_0003520 Ga0496110_0003520_8528_9121 189
137 3300048914 Ga0496111_0009771 Ga0496111_0009771_2347_2940 189
138 3300048915 Ga0496112_0002747 Ga0496112_0002747_11401_11994 189
139 3300049580 Ga0501046_0235119 Ga0501046_0235119_359_946 192
140 3300009545 Ga0105237_10244365 Ga0105237_102443652 194
141 3300009551 Ga0105238_10294999 Ga0105238_102949992 194
142 3300048917 Ga0496114_1091923 Ga0496114_1091923_31_615 194
143 3300006177 Ga0075362_10021415 Ga0075362_100214153 195
144 3300009148 Ga0105243_10076280 Ga0105243_100762802 195
145 3300013306 Ga0163162_10796080 Ga0163162_107960802 195
146 3300013308 Ga0157375_10386971 Ga0157375_103869711 195
147 3300014968 Ga0157379_10457936 Ga0157379_104579362 195
148 3300025913 Ga0207695_10406417 Ga0207695_104064172 195
149 3300035086 Ga0373934_0086548 Ga0373934_0086548_434_1021 195
150 3300035116 Ga0373945_0164232 Ga0373945_0164232_90_677 195
151 3300035117 Ga0373953_0052094 Ga0373953_0052094_20_607 195
152 3300035118 Ga0373954_0101070 Ga0373954_0101070_495_1082 195
153 3300035119 Ga0373956_0156203 Ga0373956_0156203_51_638 195
154 3300035120 Ga0373957_0091856 Ga0373957_0091856_310_897 195
155 3300035172 Ga0373955_0284299 Ga0373955_0284299_33_620 195
156 3300035410 Ga0373924_0211381 Ga0373924_0211381_160_747 195
157 3300036401 Ga0373937_0277750 Ga0373937_0277750_653_1240 195
158 3300042438 Ga0439459_0061502 Ga0439459_0061502_227_814 195
159 3300046454 Ga0495592_0075845 Ga0495592_0075845_779_1366 195
160 3300046459 Ga0495629_0390859 Ga0495629_0390859_275_862 195
161 3300046462 Ga0495651_0079274 Ga0495651_0079274_1117_1704 195
162 3300046463 Ga0495653_0082161 Ga0495653_0082161_1649_2236 195
163 3300046492 Ga0495585_0239738 Ga0495585_0239738_240_827 195
164 3300046501 Ga0495607_0112637 Ga0495607_0112637_337_924 195
165 3300046511 Ga0495608_0200238 Ga0495608_0200238_412_999 195
166 3300046514 Ga0495618_0210326 Ga0495618_0210326_571_1158 195
167 3300046515 Ga0495620_0071851 Ga0495620_0071851_664_1251 195
168 3300046516 Ga0495628_0369297 Ga0495628_0369297_454_1041 195
169 3300046523 Ga0495644_0080029 Ga0495644_0080029_220_807 195
170 3300046529 Ga0495652_0108697 Ga0495652_0108697_1088_1675 195
171 3300046533 Ga0495640_0031735 Ga0495640_0031735_1938_2525 195
172 3300046536 Ga0495587_0095712 Ga0495587_0095712_764_1351 195
173 3300046537 Ga0495598_0004797 Ga0495598_0004797_1674_2261 195
174 3300046537 Ga0495598_0065533 Ga0495598_0065533_87_674 195
175 3300046559 Ga0495667_0081352 Ga0495667_0081352_1353_1940 195
176 3300046615 Ga0495656_0028967 Ga0495656_0028967_198_785 195
177 3300046615 Ga0495656_0034244 Ga0495656_0034244_355_942 195
178 3300046642 Ga0495634_0115672 Ga0495634_0115672_779_1366 195
179 3300046648 Ga0495611_0126272 Ga0495611_0126272_106_693 195
180 3300046664 Ga0495659_0055639 Ga0495659_0055639_270_857 195
181 3300046674 Ga0495588_0038474 Ga0495588_0038474_378_965 195
182 3300046680 Ga0495646_0167784 Ga0495646_0167784_608_1195 195
183 3300046684 Ga0495669_0008884 Ga0495669_0008884_2309_2896 195
184 3300046689 Ga0495613_0182025 Ga0495613_0182025_275_862 195
185 3300046691 Ga0495670_0218320 Ga0495670_0218320_411_998 195
186 3300046809 Ga0495600_0275740 Ga0495600_0275740_311_898 195
187 3300047317 Ga0495604_0011502 Ga0495604_0011502_3167_3754 195
188 3300047318 Ga0495636_0071193 Ga0495636_0071193_431_1018 195
189 3300047322 Ga0495680_0101645 Ga0495680_0101645_472_1059 195
190 3300047444 Ga0495675_0096940 Ga0495675_0096940_262_849 195
191 3300047471 Ga0495684_0033555 Ga0495684_0033555_29_616 195
192 3300047472 Ga0495686_0166021 Ga0495686_0166021_564_1154 195
193 3300048090 Ga0495615_0061164 Ga0495615_0061164_136_723 195
194 3300048090 Ga0495615_0114891 Ga0495615_0114891_31_618 195
195 3300048905 Ga0496102_0330798 Ga0496102_0330798_131_718 195
196 3300048911 Ga0496108_0722086 Ga0496108_0722086_11_598 195
197 3300048912 Ga0496109_0930093 Ga0496109_0930093_27_614 195
198 3300048921 Ga0496118_0014192 Ga0496118_0014192_3191_3796 195
199 3300049592 Ga0501076_0241244 Ga0501076_0241244_723_1310 195
200 3300050490 nmdc:mga03n38_69012_c1 nmdc:mga03n38_69012_c1_796_1383 195
201 3300050491 nmdc:mga00v17_60223_c1 nmdc:mga00v17_60223_c1_1267_1854 195
202 3300050492 nmdc:mga0yw44_77443_c1 nmdc:mga0yw44_77443_c1_583_1170 195
203 3300050494 nmdc:mga06z11_195072_c1 nmdc:mga06z11_195072_c1_437_1024 195
204 3300050496 nmdc:mga07m45_34949_c1 nmdc:mga07m45_34949_c1_1382_1969 195
205 3300053084 Ga0495595_0270287 Ga0495595_0270287_104_691 195
206 3300053087 Ga0500643_058399 Ga0500643_058399_212_799 195
207 3300053096 Ga0500641_0010456 Ga0500641_0010456_1984_2571 195
208 3300053119 Ga0500595_001436 Ga0500595_001436_11526_12116 195
209 3300053730 Ga0500645_057886 Ga0500645_057886_202_789 195
210 3300013308 Ga0157375_10184132 Ga0157375_101841323 196
211 3300014325 Ga0163163_10278119 Ga0163163_102781191 196
212 3300035091 Ga0373951_0058793 Ga0373951_0058793_284_904 196
213 3300039453 Ga0436362_1109287 Ga0436362_1109287_726_1361 196
214 3300048905 Ga0496102_0198823 Ga0496102_0198823_370_990 196
215 3300048907 Ga0496104_0005304 Ga0496104_0005304_376_996 196
216 3300048909 Ga0496106_0066088 Ga0496106_0066088_243_863 196
217 3300048910 Ga0496107_0023877 Ga0496107_0023877_2096_2716 196
218 3300048911 Ga0496108_0028116 Ga0496108_0028116_2044_2664 196
219 3300048913 Ga0496110_0100346 Ga0496110_0100346_1952_2572 196
220 3300048915 Ga0496112_0002348 Ga0496112_0002348_6046_6666 196
221 3300048918 Ga0496115_0152094 Ga0496115_0152094_549_1169 196
222 3300012503 Ga0157313_1004132 Ga0157313_10041322 197
223 3300046507 Ga0495606_0000265 Ga0495606_0000265_35736_36347 197
224 3300046684 Ga0495669_0249853 Ga0495669_0249853_158_769 197
225 3300048915 Ga0496112_0000019 Ga0496112_0000019_105181_105792 197
226 3300049583 Ga0501067_0128253 Ga0501067_0128253_374_988 197
227 3300035116 Ga0373945_0017581 Ga0373945_0017581_1410_2006 198
228 3300035117 Ga0373953_0121117 Ga0373953_0121117_206_802 198
229 3300035118 Ga0373954_0007611 Ga0373954_0007611_2905_3501 198
230 3300035410 Ga0373924_0167326 Ga0373924_0167326_206_802 198
231 3300035725 Ga0373947_0010412 Ga0373947_0010412_4422_5018 198
232 3300046473 Ga0495582_0131080 Ga0495582_0131080_735_1331 198
233 3300046475 Ga0495639_0023860 Ga0495639_0023860_2084_2680 198
234 3300046492 Ga0495585_0113936 Ga0495585_0113936_818_1423 198
235 3300046514 Ga0495618_0072070 Ga0495618_0072070_1461_2057 198
236 3300046536 Ga0495587_0433155 Ga0495587_0433155_100_705 198
237 3300046683 Ga0495658_0015658 Ga0495658_0015658_1653_2249 198
238 3300046690 Ga0495624_0055520 Ga0495624_0055520_1801_2397 198
239 3300047317 Ga0495604_0117913 Ga0495604_0117913_1100_1705 198
240 3300047471 Ga0495684_0026032 Ga0495684_0026032_2437_3033 198
241 3300048929 Ga0496126_0215219 Ga0496126_0215219_77_694 198
242 3300050492 nmdc:mga0yw44_198426_c1 nmdc:mga0yw44_198426_c1_380_985 198
243 3300047319 Ga0495674_0401309 Ga0495674_0401309_153_761 202
244 3300048910 Ga0496107_0750196 Ga0496107_0750196_42_650 202
245 3300053088 Ga0500644_0039159 Ga0500644_0039159_935_1543 202
246 iso_pu_bacteria 2935732158 2935733608 202
247 iso_pu_bacteria 2935741537 2935742987 202
248 3300005456 Ga0070678_100020516 Ga0070678_1000205163 203
249 3300013296 Ga0157374_10012415 Ga0157374_100124156 203
250 3300013306 Ga0163162_10026997 Ga0163162_100269975 203
251 3300013308 Ga0157375_10036499 Ga0157375_100364992 203
252 3300014325 Ga0163163_10336132 Ga0163163_103361322 203
253 3300014969 Ga0157376_10276232 Ga0157376_102762322 203
254 3300025925 Ga0207650_10814247 Ga0207650_108142471 203
255 3300046459 Ga0495629_0204749 Ga0495629_0204749_154_798 203
256 3300046684 Ga0495669_0108194 Ga0495669_0108194_308_952 203
257 3300048903 Ga0496100_0105070 Ga0496100_0105070_883_1527 203
258 3300048903 Ga0496100_0346742 Ga0496100_0346742_414_1070 203
259 3300048904 Ga0496101_0041489 Ga0496101_0041489_2270_2914 203
260 3300048905 Ga0496102_0068794 Ga0496102_0068794_1241_1885 203
261 3300048906 Ga0496103_0050428 Ga0496103_0050428_882_1526 203
262 3300048907 Ga0496104_0150704 Ga0496104_0150704_324_968 203
263 3300048908 Ga0496105_0025939 Ga0496105_0025939_4088_4732 203
264 3300048910 Ga0496107_0003794 Ga0496107_0003794_8534_9178 203
265 3300048916 Ga0496113_0028669 Ga0496113_0028669_1729_2373 203
266 3300048917 Ga0496114_0024760 Ga0496114_0024760_1096_1797 203
267 3300048918 Ga0496115_0002185 Ga0496115_0002185_11314_11958 203
268 3300048921 Ga0496118_0005404 Ga0496118_0005404_396_1052 203
269 3300048924 Ga0496121_0001792 Ga0496121_0001792_146_802 203
270 3300048928 Ga0496125_0223952 Ga0496125_0223952_134_790 203
271 3300048929 Ga0496126_0032057 Ga0496126_0032057_53_709 203
272 3300053083 Ga0495655_0082247 Ga0495655_0082247_246_890 203
273 3300003320 rootH2_10001477 rootH2_100014772 204
274 3300005458 Ga0070681_10036946 Ga0070681_100369462 204
275 3300005530 Ga0070679_100184275 Ga0070679_1001842752 204
276 3300006358 Ga0068871_100068643 Ga0068871_1000686432 204
277 3300009177 Ga0105248_10259252 Ga0105248_102592522 204
278 3300009177 Ga0105248_10626543 Ga0105248_106265432 204
279 3300010375 Ga0105239_11077087 Ga0105239_110770871 204
280 3300013105 Ga0157369_10008800 Ga0157369_100088002 204
281 3300013307 Ga0157372_10283841 Ga0157372_102838412 204
282 3300014497 Ga0182008_10070166 Ga0182008_100701662 204
283 3300014969 Ga0157376_10620860 Ga0157376_106208601 204
284 3300025912 Ga0207707_10004596 Ga0207707_1000459613 204
285 3300025913 Ga0207695_10090524 Ga0207695_100905243 204
286 3300025917 Ga0207660_10050646 Ga0207660_100506462 204
287 3300025921 Ga0207652_10039873 Ga0207652_100398733 204
288 3300026067 Ga0207678_10267012 Ga0207678_102670122 204
289 3300026142 Ga0207698_10888261 Ga0207698_108882611 204
290 3300034816 Ga0373930_0036176 Ga0373930_0036176_77_703 204
291 3300035111 Ga0373923_0062578 Ga0373923_0062578_806_1465 204
292 3300035113 Ga0373936_0005423 Ga0373936_0005423_2309_2968 204
293 3300035116 Ga0373945_0029541 Ga0373945_0029541_473_1132 204
294 3300035170 Ga0373943_0029135 Ga0373943_0029135_1279_1938 204
295 3300035691 Ga0373931_0120931 Ga0373931_0120931_367_981 204
296 3300035692 Ga0373935_0001604 Ga0373935_0001604_2461_3120 204
297 3300035695 Ga0373927_0000071 Ga0373927_0000071_52490_53149 204
298 3300035725 Ga0373947_0008795 Ga0373947_0008795_712_1371 204
299 3300036401 Ga0373937_0068839 Ga0373937_0068839_22_681 204
300 3300037068 Ga0373925_0001901 Ga0373925_0001901_16007_16666 204
301 3300037418 Ga0395900_0006407 Ga0395900_0006407_3931_4557 204
302 3300037466 Ga0395898_0017762 Ga0395898_0017762_2662_3288 204
303 3300038443 Ga0395901_0019529 Ga0395901_0019529_2679_3305 204
304 3300039437 Ga0436365_0409965 Ga0436365_0409965_3860_4495 204
305 3300046455 Ga0495603_0000035 Ga0495603_0000035_48852_49511 204
306 3300046455 Ga0495603_0153694 Ga0495603_0153694_593_1276 204
307 3300046459 Ga0495629_0000081 Ga0495629_0000081_31583_32242 204
308 3300046461 Ga0495641_0000707 Ga0495641_0000707_17091_17750 204
309 3300046463 Ga0495653_0166261 Ga0495653_0166261_393_1052 204
310 3300046472 Ga0495580_0008037 Ga0495580_0008037_5455_6114 204
311 3300046472 Ga0495580_0211625 Ga0495580_0211625_665_1309 204
312 3300046473 Ga0495582_0000051 Ga0495582_0000051_55032_55691 204
313 3300046474 Ga0495605_0053051 Ga0495605_0053051_62_745 204
314 3300046475 Ga0495639_0000010 Ga0495639_0000010_44746_45405 204
315 3300046476 Ga0495662_0000034 Ga0495662_0000034_25108_25767 204
316 3300046477 Ga0495664_0096808 Ga0495664_0096808_114_773 204
317 3300046499 Ga0495594_0001027 Ga0495594_0001027_2849_3508 204
318 3300046511 Ga0495608_0359848 Ga0495608_0359848_61_714 204
319 3300046516 Ga0495628_0024773 Ga0495628_0024773_3092_3751 204
320 3300046516 Ga0495628_0049737 Ga0495628_0049737_2593_3246 204
321 3300046517 Ga0495630_0010715 Ga0495630_0010715_4041_4700 204
322 3300046526 Ga0495666_0034413 Ga0495666_0034413_1510_2169 204
323 3300046529 Ga0495652_0020294 Ga0495652_0020294_3721_4380 204
324 3300046531 Ga0495665_0000005 Ga0495665_0000005_31873_32532 204
325 3300046533 Ga0495640_0004617 Ga0495640_0004617_7949_8608 204
326 3300046535 Ga0495586_0250001 Ga0495586_0250001_224_868 204
327 3300046543 Ga0495645_0063319 Ga0495645_0063319_283_936 204
328 3300046557 Ga0495622_0002332 Ga0495622_0002332_6788_7447 204
329 3300046557 Ga0495622_0057783 Ga0495622_0057783_652_1335 204
330 3300046559 Ga0495667_0008367 Ga0495667_0008367_3960_4619 204
331 3300046642 Ga0495634_0000261 Ga0495634_0000261_48228_48887 204
332 3300046663 Ga0495635_0000281 Ga0495635_0000281_17268_17927 204
333 3300046675 Ga0495657_0025308 Ga0495657_0025308_2603_3256 204
334 3300046678 Ga0495599_0028338 Ga0495599_0028338_1730_2383 204
335 3300046679 Ga0495623_0063209 Ga0495623_0063209_440_1093 204
336 3300046680 Ga0495646_0010554 Ga0495646_0010554_282_941 204
337 3300046681 Ga0495647_0055373 Ga0495647_0055373_501_1160 204
338 3300046683 Ga0495658_0000367 Ga0495658_0000367_19631_20290 204
339 3300046689 Ga0495613_0553824 Ga0495613_0553824_100_753 204
340 3300046690 Ga0495624_0000094 Ga0495624_0000094_9503_10162 204
341 3300046692 Ga0495671_0083833 Ga0495671_0083833_368_1021 204
342 3300046809 Ga0495600_0004278 Ga0495600_0004278_6647_7300 204
343 3300047315 Ga0495581_0000018 Ga0495581_0000018_47130_47789 204
344 3300047317 Ga0495604_0043250 Ga0495604_0043250_2580_3233 204
345 3300047319 Ga0495674_0000134 Ga0495674_0000134_33508_34167 204
346 3300047321 Ga0495676_0008740 Ga0495676_0008740_2782_3441 204
347 3300047321 Ga0495676_0178263 Ga0495676_0178263_214_897 204
348 3300047322 Ga0495680_0014317 Ga0495680_0014317_2697_3350 204
349 3300047471 Ga0495684_0383228 Ga0495684_0383228_283_936 204
350 3300047673 Ga0495593_0000084 Ga0495593_0000084_31711_32370 204
351 3300048088 Ga0495602_0557097 Ga0495602_0557097_96_755 204
352 3300048907 Ga0496104_0142978 Ga0496104_0142978_1279_1905 204
353 3300048909 Ga0496106_0122058 Ga0496106_0122058_779_1405 204
354 3300048909 Ga0496106_0271677 Ga0496106_0271677_505_1188 204
355 3300048910 Ga0496107_0340410 Ga0496107_0340410_166_849 204
356 3300048912 Ga0496109_0052197 Ga0496109_0052197_2978_3667 204
357 3300048913 Ga0496110_0056895 Ga0496110_0056895_2143_2769 204
358 3300048913 Ga0496110_0426203 Ga0496110_0426203_415_1104 204
359 3300048914 Ga0496111_0042660 Ga0496111_0042660_705_1331 204
360 3300048915 Ga0496112_0019982 Ga0496112_0019982_4475_5164 204
361 3300048915 Ga0496112_0108631 Ga0496112_0108631_1651_2277 204
362 3300048916 Ga0496113_0291990 Ga0496113_0291990_558_1184 204
363 3300048918 Ga0496115_0165923 Ga0496115_0165923_930_1556 204
364 3300048918 Ga0496115_0340972 Ga0496115_0340972_359_1042 204
365 3300048919 Ga0496116_0034442 Ga0496116_0034442_384_1067 204
366 3300048920 Ga0496117_0112078 Ga0496117_0112078_534_1217 204
367 3300049568 Ga0501031_0006545 Ga0501031_0006545_6660_7307 204
368 3300049569 Ga0501032_0000048 Ga0501032_0000048_23090_23737 204
369 3300049570 Ga0501033_0000184 Ga0501033_0000184_20420_21067 204
370 3300049571 Ga0501034_0000082 Ga0501034_0000082_77574_78221 204
371 3300049572 Ga0501036_0000791 Ga0501036_0000791_11998_12645 204
372 3300049573 Ga0501037_0000063 Ga0501037_0000063_82204_82851 204
373 3300049574 Ga0501038_0000295 Ga0501038_0000295_14077_14724 204
374 3300049575 Ga0501039_0000082 Ga0501039_0000082_43810_44457 204
375 3300049578 Ga0501042_0022058 Ga0501042_0022058_1173_1820 204
376 3300049578 Ga0501042_0072742 Ga0501042_0072742_431_1069 204
377 3300049579 Ga0501043_0000148 Ga0501043_0000148_31270_31917 204
378 3300049580 Ga0501046_0000101 Ga0501046_0000101_54673_55320 204
379 3300049581 Ga0501047_0000671 Ga0501047_0000671_4613_5260 204
380 3300049582 Ga0501048_0006649 Ga0501048_0006649_1042_1689 204
381 3300049583 Ga0501067_0000056 Ga0501067_0000056_56344_56991 204
382 3300049584 Ga0501068_0000310 Ga0501068_0000310_8915_9562 204
383 3300049585 Ga0501069_0001375 Ga0501069_0001375_6721_7368 204
384 3300049586 Ga0501070_0037088 Ga0501070_0037088_3072_3719 204
385 3300049588 Ga0501072_0006466 Ga0501072_0006466_4458_5105 204
386 3300049589 Ga0501073_0002349 Ga0501073_0002349_12812_13459 204
387 3300049590 Ga0501074_0000331 Ga0501074_0000331_5998_6645 204
388 3300049592 Ga0501076_0189251 Ga0501076_0189251_566_1204 204
389 3300049741 Ga0501079_0000586 Ga0501079_0000586_14885_15532 204
390 3300049742 Ga0501080_0000922 Ga0501080_0000922_12940_13587 204
391 3300049744 Ga0501083_0005043 Ga0501083_0005043_2970_3617 204
392 3300049822 Ga0501035_0001078 Ga0501035_0001078_367_1014 204
393 3300049823 Ga0501044_0000408 Ga0501044_0000408_28997_29644 204
394 3300049824 Ga0501045_0001959 Ga0501045_0001959_5338_5985 204
395 3300050490 nmdc:mga03n38_99385_c1 nmdc:mga03n38_99385_c1_288_914 204
396 3300050492 nmdc:mga0yw44_11580_c1 nmdc:mga0yw44_11580_c1_3062_3745 204
397 3300053077 Ga0495601_0149778 Ga0495601_0149778_706_1365 204
398 3300053077 Ga0495601_0374064 Ga0495601_0374064_49_702 204
399 3300053085 Ga0495619_0093811 Ga0495619_0093811_1032_1691 204
400 3300053094 Ga0500566_0000754 Ga0500566_0000754_13276_13902 204
401 3300053150 Ga0500603_058442 Ga0500603_058442_177_818 204
402 3300053155 Ga0500620_002400 Ga0500620_002400_1396_2052 204
403 3300053163 Ga0500639_037566 Ga0500639_037566_1564_2205 204
404 3300054114 Ga0501084_0002066 Ga0501084_0002066_6928_7575 204
405 3300060353 Ga0501082_0001007 Ga0501082_0001007_22687_23334 204

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ijc-assembly2.cif.gz_I structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa 0.875 60 194
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.8587 63 190
2gmy-assembly1.cif.gz_C crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd 0.8333 60 192
6e8l-assembly3.cif.gz_F crystal structure of alkyl hydroperoxidase d (ahpd) from streptococcus pneumoniae (strain d39/ nctc 7466) 0.8308 26 197
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.8236 63 190
ID Description Score Start End Superfamily
af_O53905_23_180_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8733 57 201 1.20.1290.10
af_O53749_49_187_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8545 65 190 1.20.1290.10
2ijcF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8543 60 185 1.20.1290.10
2gmyF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.846 60 200 1.20.1290.10
2o4dA00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8448 60 185 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A4Q0SW87-F1-model_v4 4-carboxymuconolactone decarboxylase 0.9995 24 204
AF-A0A850IWU6-F1-model_v4 deleted 0.9991 24 204
AF-A0A4Y9P9U5-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.998 24 204
AF-A0A0E4BP11-F1-model_v4 4-carboxymuconolactone decarboxylase 0.9964 34 204
AF-A0A850IBU8-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9953 24 204

Feature Viewer

pLDDT pTM Quality
88.71 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map