F436082

General Info

Members Datasets Scaffolds Average Seq Length
405 255 395 180

Family's Representative Sequence

Representative Sequence 3300059421|Ga0590071_012085|Ga0590071_012085_957_1574
Length 205
Sequence LRLLKEAAWVAGEQETEMTRWIDRYCRLLDAISASCLALMVVLVFGNVVLRYAFSSGITVSEELSRWLFVWMTFLGAIVALKEHSHLGTDMLVAHLPLWGKKACLVVGQLAMLYVTWLLFQGSLEQARINWDVQAPVSGASMGIFYGSGVVFAVSAALLLVRELLRTLSGRAAESELVMVQESEDLAQVQALHLTEAAPSPGPKR

Samples

Sample ID Description Type Environment
1 2547132374 Acidovorax radicis N35 Isolate Unclassified
2 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
3 2643221609 Acidovorax sp. Root217 Isolate Unclassified
4 2643221611 Acidovorax sp. Root219 Isolate Unclassified
5 2643221717 Acidovorax sp. Root267 Isolate Unclassified
6 2738543012 Acidovorax sp. CF301 Isolate Unclassified
7 2816332133 Acidovorax radicis 2721A Isolate Unclassified
8 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
9 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
137 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
138 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
139 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
140 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
141 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
142 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
152 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
153 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
154 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
158 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
170 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
171 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
172 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
173 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
174 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
175 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
176 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
177 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
178 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
179 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
180 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
181 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
182 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
183 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
184 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
185 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
186 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
187 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
188 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
189 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
193 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
194 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
195 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
196 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
197 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
198 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
199 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
200 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
201 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
202 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
203 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
204 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
205 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
206 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
207 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
208 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
209 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
218 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
219 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
226 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
229 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
230 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
231 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
232 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
233 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
234 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
235 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
236 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
237 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
238 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
239 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
242 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
243 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
244 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
245 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
246 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
247 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
248 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
249 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
250 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
251 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
252 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
253 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
254 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.53
Metatranscriptomes 0
Isolates 2.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.05
Nodule 0
Rhizoplane 3.7
Rhizosphere 74.81
Stem 0
Stem Tuber 0
Unclassified 5.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055526_1000223 3300003771 Bacteria 49048
2 Ga0055534_1000530 3300003784 Bacteria 20526
3 Ga0055531_10000281 3300003794 Bacteria 51971
4 Ga0055531_10036086 3300003794 Bacteria 1533
5 Ga0065165_1027648 3300005262 Bacteria 1844
6 Ga0070658_10424417 3300005327 Bacteria 1144
7 Ga0070658_10548060 3300005327 Bacteria 1001
8 Ga0070690_100005316 3300005330 Bacteria 7224
9 Ga0070690_100005945 3300005330 Bacteria 6890
10 Ga0070670_100114694 3300005331 Bacteria 2323
11 Ga0070670_100234960 3300005331 Bacteria 1596
12 Ga0070677_10003525 3300005333 Bacteria 5049
13 Ga0068869_100004452 3300005334 Bacteria 8711
14 Ga0068869_100020317 3300005334 Bacteria 4553
15 Ga0068869_100252864 3300005334 Bacteria 1408
16 Ga0070666_10003673 3300005335 Bacteria 9298
17 Ga0070666_10015525 3300005335 Bacteria 4859
18 Ga0070666_10637476 3300005335 Bacteria 779
19 Ga0068868_100001845 3300005338 Bacteria 14549
20 Ga0070660_100520178 3300005339 Bacteria 991
21 Ga0070689_100083075 3300005340 Bacteria 2517
22 Ga0070687_100044388 3300005343 Bacteria 2264
23 Ga0070668_100002035 3300005347 Bacteria 14789
24 Ga0070669_100000367 3300005353 Bacteria 34943
25 Ga0070669_100022170 3300005353 Bacteria 4542
26 Ga0070675_100001536 3300005354 Bacteria 17075
27 Ga0070675_100018070 3300005354 Bacteria 5612
28 Ga0070675_100083660 3300005354 Bacteria 2664
29 Ga0070671_100012515 3300005355 Bacteria 6833
30 Ga0070671_100018132 3300005355 Bacteria 5715
31 Ga0070674_100000914 3300005356 Bacteria 15401
32 Ga0070673_100109086 3300005364 Bacteria 2293
33 Ga0070673_100126047 3300005364 Bacteria 2143
34 Ga0070673_101160419 3300005364 Bacteria 723
35 Ga0070688_100365456 3300005365 Bacteria 1060
36 Ga0070667_100001366 3300005367 Bacteria 21894
37 Ga0070667_100158996 3300005367 Bacteria 1989
38 Ga0070701_10083819 3300005438 Bacteria 1732
39 Ga0070700_100037542 3300005441 Bacteria 2947
40 Ga0070678_100002045 3300005456 Bacteria 10919
41 Ga0070678_100006589 3300005456 Bacteria 6826
42 Ga0070662_100004024 3300005457 Bacteria 9224
43 Ga0070662_100893163 3300005457 Bacteria 758
44 Ga0068867_100001126 3300005459 Bacteria 18309
45 Ga0068853_101322113 3300005539 Bacteria 697
46 Ga0070672_100064753 3300005543 Bacteria 2889
47 Ga0070672_100093084 3300005543 Bacteria 2434
48 Ga0070686_100257213 3300005544 Bacteria 1278
49 Ga0070665_100292020 3300005548 Bacteria 1633
50 Ga0070664_100290525 3300005564 Bacteria 1476
51 Ga0068854_100225143 3300005578 Bacteria 1486
52 Ga0068854_100595818 3300005578 Bacteria 943
53 Ga0068852_100220495 3300005616 Bacteria 1803
54 Ga0068859_100002482 3300005617 Bacteria 18764
55 Ga0068859_100029448 3300005617 Bacteria 5508
56 Ga0068859_100216410 3300005617 Bacteria 2003
57 Ga0068859_101599315 3300005617 Bacteria 720
58 Ga0068864_100002261 3300005618 Bacteria 15918
59 Ga0068864_100057316 3300005618 Bacteria 3366
60 Ga0068866_10002754 3300005718 Bacteria 7252
61 Ga0068866_10137040 3300005718 Bacteria 1400
62 Ga0068861_100001059 3300005719 Bacteria 16923
63 Ga0068861_100037832 3300005719 Bacteria 3588
64 Ga0068861_100051481 3300005719 Bacteria 3126
65 Ga0068851_10131764 3300005834 Bacteria 1353
66 Ga0068863_100000556 3300005841 Bacteria 37892
67 Ga0068863_100006103 3300005841 Bacteria 11819
68 Ga0068863_100289525 3300005841 Bacteria 1588
69 Ga0068858_100005250 3300005842 Bacteria 12693
70 Ga0068858_100006727 3300005842 Bacteria 11188
71 Ga0068860_100018085 3300005843 Bacteria 6864
72 Ga0068860_100064627 3300005843 Bacteria 3475
73 Ga0068860_101689737 3300005843 Bacteria 655
74 Ga0068862_100006583 3300005844 Bacteria 9632
75 Ga0075365_10005634 3300006038 Bacteria 6779
76 Ga0075365_10025877 3300006038 Bacteria 3718
77 Ga0075368_10002604 3300006042 Bacteria 5915
78 Ga0075363_100006903 3300006048 Bacteria 5192
79 Ga0075364_10164132 3300006051 Bacteria 1500
80 Ga0075362_10011910 3300006177 Bacteria 3437
81 Ga0075362_10348433 3300006177 Bacteria 741
82 Ga0075367_10010157 3300006178 Bacteria 4938
83 Ga0075366_10008595 3300006195 Bacteria 5685
84 Ga0075366_10027807 3300006195 Bacteria 3319
85 Ga0075366_10044263 3300006195 Bacteria 2638
86 Ga0075366_10077925 3300006195 Bacteria 1978
87 Ga0075366_10536979 3300006195 Bacteria 724
88 Ga0097621_100086102 3300006237 Bacteria 2622
89 Ga0097621_100695020 3300006237 Bacteria 936
90 Ga0075370_10009589 3300006353 Bacteria 5034
91 Ga0075370_10254597 3300006353 Bacteria 1041
92 Ga0075370_10541087 3300006353 Bacteria 704
93 Ga0068871_100068926 3300006358 Bacteria 2904
94 Ga0068871_100404808 3300006358 Bacteria 1216
95 Ga0068865_100003419 3300006881 Bacteria 9497
96 Ga0068865_100003603 3300006881 Bacteria 9309
97 Ga0068865_100095930 3300006881 Bacteria 2161
98 Ga0097620_100002482 3300006931 Bacteria 18764
99 Ga0097620_100029448 3300006931 Bacteria 5508
100 Ga0097620_100216430 3300006931 Bacteria 2003
101 Ga0097620_101599132 3300006931 Bacteria 720
102 Ga0111539_10474776 3300009094 Bacteria 1456
103 Ga0105245_10023471 3300009098 Bacteria 5415
104 Ga0105247_10053536 3300009101 Bacteria 2490
105 Ga0105243_10001350 3300009148 Bacteria 21852
106 Ga0105243_10131582 3300009148 Bacteria 2123
107 Ga0105243_10192546 3300009148 Bacteria 1782
108 Ga0105243_10455062 3300009148 Bacteria 1202
109 Ga0105242_11142530 3300009176 Bacteria 795
110 Ga0105248_10004752 3300009177 Bacteria 15032
111 Ga0105248_10006219 3300009177 Bacteria 13091
112 Ga0105248_10016122 3300009177 Bacteria 8223
113 Ga0105248_10121723 3300009177 Bacteria 2944
114 Ga0105248_10359640 3300009177 Bacteria 1639
115 Ga0105237_10168192 3300009545 Bacteria 2192
116 Ga0105238_10802328 3300009551 Bacteria 957
117 Ga0105249_10001023 3300009553 Bacteria 24728
118 Ga0105249_10180690 3300009553 Bacteria 2052
119 Ga0105249_10285219 3300009553 Bacteria 1651
120 Ga0105246_11834605 3300011119 Bacteria 580
121 Ga0157369_10022086 3300013105 Bacteria 7109
122 Ga0157374_10180500 3300013296 Bacteria 2062
123 Ga0157378_10001679 3300013297 Bacteria 19946
124 Ga0157378_10010746 3300013297 Bacteria 8001
125 Ga0157378_10115565 3300013297 Bacteria 2466
126 Ga0157378_10856488 3300013297 Bacteria 937
127 Ga0157378_10998885 3300013297 Bacteria 871
128 Ga0163162_10000847 3300013306 Bacteria 28426
129 Ga0163162_10001712 3300013306 Bacteria 20568
130 Ga0163162_10023139 3300013306 Bacteria 6129
131 Ga0163162_10074309 3300013306 Bacteria 3458
132 Ga0157375_10002808 3300013308 Bacteria 15075
133 Ga0157375_10109007 3300013308 Bacteria 2864
134 Ga0163163_10003078 3300014325 Bacteria 14125
135 Ga0163163_10008006 3300014325 Bacteria 9353
136 Ga0163163_10413539 3300014325 Bacteria 1407
137 Ga0157380_10002813 3300014326 Bacteria 11827
138 Ga0157380_10058691 3300014326 Bacteria 3068
139 Ga0157379_10005874 3300014968 Bacteria 10560
140 Ga0157379_10021652 3300014968 Bacteria 5693
141 Ga0157379_10119072 3300014968 Bacteria 2375
142 Ga0157379_10138734 3300014968 Bacteria 2191
143 Ga0157379_10213375 3300014968 Bacteria 1748
144 Ga0157379_11051693 3300014968 Bacteria 778
145 Ga0157376_10399391 3300014969 Bacteria 1329
146 Ga0157376_10546920 3300014969 Bacteria 1145
147 Ga0157376_11270519 3300014969 Bacteria 766
148 Ga0163161_10001420 3300017792 Bacteria 17665
149 Ga0209673_1005024 3300025273 Bacteria 6831
150 Ga0209673_1013143 3300025273 Bacteria 3288
151 Ga0209673_1049117 3300025273 Bacteria 1130
152 Ga0209130_1001418 3300025284 Bacteria 15969
153 Ga0209675_1000811 3300025291 Bacteria 20589
154 Ga0209676_1002690 3300025292 Bacteria 12026
155 Ga0209025_1045913 3300025294 Bacteria 1805
156 Ga0209564_1000694 3300025295 Bacteria 49312
157 Ga0209758_1032551 3300025297 Bacteria 2113
158 Ga0209050_1018355 3300025298 Bacteria 2722
159 Ga0209051_1000172 3300025303 Bacteria 117180
160 Ga0209051_1000301 3300025303 Bacteria 77933
161 Ga0209051_1006266 3300025303 Bacteria 6742
162 Ga0209257_1000015 3300025304 Bacteria 908141
163 Ga0209257_1000022 3300025304 Bacteria 765258
164 Ga0209257_1000108 3300025304 Bacteria 240229
165 Ga0209257_1004206 3300025304 Bacteria 11418
166 Ga0207656_10216344 3300025321 Bacteria 930
167 Ga0207682_10003755 3300025893 Bacteria 6523
168 Ga0207642_10001859 3300025899 Bacteria 6510
169 Ga0207642_10081262 3300025899 Bacteria 1574
170 Ga0207680_10018907 3300025903 Bacteria 3675
171 Ga0207680_10054795 3300025903 Bacteria 2401
172 Ga0207645_10002177 3300025907 Bacteria 15651
173 Ga0207645_10045526 3300025907 Bacteria 2804
174 Ga0207662_10009715 3300025918 Bacteria 5304
175 Ga0207662_10054895 3300025918 Bacteria 2376
176 Ga0207657_10451902 3300025919 Bacteria 1008
177 Ga0207681_10001841 3300025923 Bacteria 13588
178 Ga0207681_10290358 3300025923 Bacteria 1290
179 Ga0207650_10050224 3300025925 Bacteria 3083
180 Ga0207650_10076178 3300025925 Bacteria 2534
181 Ga0207650_10286796 3300025925 Bacteria 1342
182 Ga0207650_10422935 3300025925 Bacteria 1106
183 Ga0207650_10487644 3300025925 Bacteria 1029
184 Ga0207659_10008547 3300025926 Bacteria 6363
185 Ga0207659_10027172 3300025926 Bacteria 3870
186 Ga0207659_10134475 3300025926 Bacteria 1913
187 Ga0207644_10007613 3300025931 Bacteria 7061
188 Ga0207644_10010666 3300025931 Bacteria 6056
189 Ga0207690_10230103 3300025932 Bacteria 1423
190 Ga0207706_10001403 3300025933 Bacteria 24089
191 Ga0207686_10697365 3300025934 Bacteria 807
192 Ga0207709_10014788 3300025935 Bacteria 4315
193 Ga0207709_10035320 3300025935 Bacteria 2954
194 Ga0207709_10456792 3300025935 Bacteria 988
195 Ga0207670_10081587 3300025936 Bacteria 2264
196 Ga0207669_10113673 3300025937 Bacteria 1820
197 Ga0207669_10430345 3300025937 Bacteria 1041
198 Ga0207704_10001013 3300025938 Bacteria 12463
199 Ga0207704_10207013 3300025938 Bacteria 1441
200 Ga0207704_10265733 3300025938 Bacteria 1296
201 Ga0207691_10002981 3300025940 Bacteria 16524
202 Ga0207691_10014458 3300025940 Bacteria 7525
203 Ga0207691_10020243 3300025940 Bacteria 6292
204 Ga0207711_10011478 3300025941 Bacteria 7363
205 Ga0207711_10041473 3300025941 Bacteria 3920
206 Ga0207689_10006793 3300025942 Bacteria 10070
207 Ga0207689_10012467 3300025942 Bacteria 7262
208 Ga0207689_10199578 3300025942 Bacteria 1651
209 Ga0207689_10824880 3300025942 Bacteria 783
210 Ga0207679_10258169 3300025945 Bacteria 1485
211 Ga0207651_10042474 3300025960 Bacteria 3026
212 Ga0207651_10094589 3300025960 Bacteria 2197
213 Ga0207712_10001809 3300025961 Bacteria 14129
214 Ga0207712_10145567 3300025961 Bacteria 1824
215 Ga0207668_10021037 3300025972 Bacteria 4155
216 Ga0207668_10042985 3300025972 Bacteria 3063
217 Ga0207640_10421889 3300025981 Bacteria 1092
218 Ga0207658_10002800 3300025986 Bacteria 12544
219 Ga0207658_10052033 3300025986 Bacteria 3021
220 Ga0207677_10002314 3300026023 Bacteria 10013
221 Ga0207677_10431468 3300026023 Bacteria 1125
222 Ga0207703_10007787 3300026035 Bacteria 8478
223 Ga0207703_10017445 3300026035 Bacteria 5603
224 Ga0207639_10798250 3300026041 Bacteria 879
225 Ga0207678_10165419 3300026067 Bacteria 1889
226 Ga0207708_10034069 3300026075 Bacteria 3872
227 Ga0207708_10049066 3300026075 Bacteria 3214
228 Ga0207641_10000726 3300026088 Bacteria 35364
229 Ga0207641_10002775 3300026088 Bacteria 15958
230 Ga0207648_10004174 3300026089 Bacteria 14931
231 Ga0207648_10183764 3300026089 Bacteria 1851
232 Ga0207648_10253908 3300026089 Bacteria 1568
233 Ga0207676_10002749 3300026095 Bacteria 12513
234 Ga0207676_10057145 3300026095 Bacteria 3071
235 Ga0207676_10627761 3300026095 Bacteria 1035
236 Ga0207675_100002646 3300026118 Bacteria 17684
237 Ga0207675_100023489 3300026118 Bacteria 5735
238 Ga0207675_100093216 3300026118 Bacteria 2833
239 Ga0207683_10004205 3300026121 Bacteria 12444
240 Ga0207698_10047208 3300026142 Bacteria 3260
241 Ga0209970_1001359 3300027614 Bacteria 4269
242 Ga0268265_10002862 3300028380 Bacteria 12685
243 Ga0268265_10048182 3300028380 Bacteria 3197
244 Ga0268264_10001098 3300028381 Bacteria 26710
245 Ga0268264_10034183 3300028381 Bacteria 4180
246 Ga0307515_10076790 3300028794 Bacteria 4423
247 Ga0265329_10021615 3300031242 Bacteria 2160
248 Ga0265316_10261127 3300031344 Bacteria 1270
249 Ga0307513_10046191 3300031456 Bacteria 4752
250 Ga0307514_10001361 3300031649 Bacteria 30951
251 Ga0265314_10093951 3300031711 Bacteria 1945
252 Ga0307516_10000705 3300031730 Bacteria 45448
253 Ga0307516_10199113 3300031730 Bacteria 1723
254 Ga0307405_10004807 3300031731 Bacteria 6443
255 Ga0307406_10000278 3300031901 Bacteria 30154
256 Ga0307406_10072805 3300031901 Bacteria 2257
257 Ga0307412_10149785 3300031911 Bacteria 1720
258 Ga0307412_10204469 3300031911 Bacteria 1502
259 Ga0307412_10582376 3300031911 Bacteria 945
260 Ga0307409_100000391 3300031995 Bacteria 18590
261 Ga0307416_100013186 3300032002 Bacteria 5608
262 Ga0307416_101019553 3300032002 Bacteria 931
263 Ga0307414_10455421 3300032004 Bacteria 1123
264 Ga0307411_10069851 3300032005 Bacteria 2374
265 Ga0307415_100000694 3300032126 Bacteria 14977
266 Ga0307415_100003110 3300032126 Bacteria 8397
267 Ga0307510_10262188 3300033180 Bacteria 1209
268 Ga0373944_0162409 3300035089 Bacteria 793
269 Ga0373953_0194424 3300035117 Bacteria 877
270 Ga0373954_0314011 3300035118 Bacteria 773
271 Ga0373943_0076828 3300035170 Bacteria 1704
272 Ga0373946_0021296 3300035171 Bacteria 2513
273 Ga0373955_0015462 3300035172 Bacteria 3738
274 Ga0373924_0059664 3300035410 Bacteria 1594
275 Ga0373931_0110449 3300035691 Bacteria 1559
276 Ga0373935_0030421 3300035692 Bacteria 3347
277 Ga0373947_0070660 3300035725 Bacteria 2140
278 Ga0373937_0120766 3300036401 Bacteria 2442
279 Ga0373925_0082032 3300037068 Bacteria 2453
280 Ga0395900_0179925 3300037418 Bacteria 2149
281 Ga0395900_0843695 3300037418 Bacteria 842
282 Ga0395900_1027789 3300037418 Bacteria 743
283 Ga0395898_0162952 3300037466 Bacteria 2133
284 Ga0395905_0007854 3300037471 Bacteria 10567
285 Ga0395905_0097307 3300037471 Bacteria 2763
286 Ga0395905_0553168 3300037471 Bacteria 1052
287 Ga0395905_0559878 3300037471 Bacteria 1044
288 Ga0395905_0924297 3300037471 Bacteria 775
289 Ga0395901_0206749 3300038443 Bacteria 2056
290 Ga0436365_0842267 3300039437 Bacteria 1101
291 Ga0451789_0663994 3300041443 Bacteria 13519
292 Ga0451793_1260512 3300041452 Bacteria 1211
293 Ga0451797_1118508 3300041453 Bacteria 1304
294 Ga0451795_1506492 3300041456 Bacteria 3393
295 Ga0451798_1067060 3300041458 Bacteria 10178
296 Ga0451800_0848119 3300041459 Bacteria 3627
297 Ga0451849_1039152 3300041505 Bacteria 925
298 Ga0451849_1263844 3300041505 Bacteria 949
299 Ga0451853_1030753 3300041512 Bacteria 1854
300 Ga0451853_2693348 3300041512 Bacteria 1624
301 Ga0439449_0000091 3300042007 Bacteria 29348
302 Ga0439462_0001751 3300042015 Bacteria 4909
303 Ga0450890_010784 3300042127 Bacteria 1177
304 Ga0439446_0032312 3300042156 Bacteria 1517
305 Ga0439434_0029557 3300042435 Bacteria 1661
306 Ga0439464_0025663 3300042439 Bacteria 1632
307 Ga0450893_0034825 3300042532 Bacteria 907
308 Ga0453683_0390977 3300044673 Bacteria 896
309 Ga0466966_0283102 3300044684 Bacteria 997
310 Ga0466961_0115564 3300044693 Bacteria 1687
311 Ga0453684_0000906 3300044712 Bacteria 98768
312 Ga0466970_0305593 3300044765 Bacteria 898
313 Ga0466959_0067268 3300045049 Bacteria 2598
314 Ga0451576_0920862 3300045051 Bacteria 917
315 Ga0451576_0999403 3300045051 Bacteria 877
316 Ga0495580_0681442 3300046472 Bacteria 674
317 Ga0495606_0008109 3300046507 Bacteria 9210
318 Ga0495618_0088064 3300046514 Bacteria 1986
319 Ga0495620_0053718 3300046515 Bacteria 1705
320 Ga0495632_0003721 3300046519 Bacteria 10683
321 Ga0495586_0257632 3300046535 Bacteria 996
322 Ga0495586_0386385 3300046535 Bacteria 805
323 Ga0495587_0283444 3300046536 Bacteria 928
324 Ga0495598_0005609 3300046537 Bacteria 2792
325 Ga0495621_0105409 3300046539 Bacteria 1077
326 Ga0495621_0106588 3300046539 Bacteria 1071
327 Ga0495645_0045798 3300046543 Bacteria 3191
328 Ga0495645_0298890 3300046543 Bacteria 1052
329 Ga0495634_0400845 3300046642 Bacteria 815
330 Ga0495635_0063270 3300046663 Bacteria 2541
331 Ga0495658_0064233 3300046683 Bacteria 2114
332 Ga0495658_0107078 3300046683 Bacteria 1676
333 Ga0495600_0165096 3300046809 Bacteria 1430
334 Ga0495675_0019083 3300047444 Bacteria 4356
335 Ga0495684_0098398 3300047471 Bacteria 2212
336 Ga0495686_0234345 3300047472 Bacteria 1038
337 Ga0495593_0182126 3300047673 Bacteria 1058
338 Ga0495602_0628079 3300048088 Bacteria 736
339 Ga0496102_0620684 3300048905 Bacteria 1004
340 Ga0496105_0237446 3300048908 Bacteria 1480
341 Ga0496108_0012270 3300048911 Bacteria 6969
342 Ga0496109_0044963 3300048912 Bacteria 4007
343 Ga0496109_0120444 3300048912 Bacteria 2444
344 Ga0496109_0972859 3300048912 Bacteria 786
345 Ga0496110_0838796 3300048913 Bacteria 824
346 Ga0496111_0822992 3300048914 Bacteria 671
347 Ga0496114_0063509 3300048917 Bacteria 3092
348 Ga0496121_0083477 3300048924 Bacteria 2522
349 Ga0496125_0011388 3300048928 Bacteria 8900
350 Ga0501031_0312801 3300049568 Bacteria 1017
351 Ga0501034_0050665 3300049571 Bacteria 4187
352 Ga0501036_0268426 3300049572 Bacteria 1429
353 Ga0501037_0064117 3300049573 Bacteria 2678
354 Ga0501039_0804035 3300049575 Bacteria 733
355 Ga0501043_0062972 3300049579 Bacteria 2913
356 Ga0501072_0030966 3300049588 Bacteria 4186
357 Ga0501259_117024 3300049688 Bacteria 630
358 Ga0501044_0725072 3300049823 Bacteria 878
359 nmdc:mga03683_16407_c1 3300050489 Bacteria 2782
360 nmdc:mga03683_324478_c1 3300050489 Bacteria 725
361 nmdc:mga03n38_87504_c1 3300050490 Bacteria 1477
362 nmdc:mga00v17_72957_c1 3300050491 Bacteria 2131
363 nmdc:mga0yw44_39183_c1 3300050492 Bacteria 2808
364 nmdc:mga0yw44_7652_c1 3300050492 Bacteria 5329
365 nmdc:mga0yw44_80754_c1 3300050492 Bacteria 2038
366 nmdc:mga0k408_153216_c1 3300050493 Bacteria 1373
367 nmdc:mga0k408_19795_c1 3300050493 Bacteria 3765
368 nmdc:mga0k408_39442_c1 3300050493 Bacteria 2713
369 nmdc:mga0k408_67642_c1 3300050493 Bacteria 2082
370 nmdc:mga06z11_554606_c1 3300050494 Bacteria 698
371 nmdc:mga04h51_41468_c1 3300050495 Bacteria 1505
372 nmdc:mga07m45_5034_c1 3300050496 Bacteria 6530
373 nmdc:mga07m45_61018_c1 3300050496 Bacteria 1139
374 nmdc:mga07m45_6292_c1 3300050496 Bacteria 5995
375 nmdc:mga0qj67_253090_c1 3300050509 Bacteria 1429
376 nmdc:mga08y16_1279257_c1 3300050511 Bacteria 701
377 nmdc:mga0rr50_768073_c1 3300050513 Bacteria 822
378 Ga0495601_0171559 3300053077 Bacteria 1418
379 Ga0495601_0259220 3300053077 Bacteria 1135
380 Ga0495619_0118984 3300053085 Bacteria 1810
381 Ga0500583_0238840 3300053092 Bacteria 899
382 Ga0500651_0006781 3300053093 Bacteria 6631
383 Ga0500650_0183574 3300053098 Bacteria 958
384 Ga0500607_209647 3300053121 Bacteria 826
385 Ga0500623_116174 3300053127 Bacteria 1184
386 Ga0500642_0000908 3300053130 Bacteria 8587
387 Ga0500652_003229 3300053131 Bacteria 4928
388 Ga0500658_0088895 3300053134 Bacteria 1333
389 Ga0500579_187336 3300053143 Bacteria 798
390 Ga0500622_0001110 3300053156 Bacteria 22450
391 Ga0500570_111189 3300053724 Bacteria 1111
392 Ga0590071_012085 3300059421 Bacteria 2024
393 Ga0590075_008298 3300059424 Bacteria 2479
394 Ga0590077_006366 3300059426 Bacteria 2420
395 Ga0501082_0620950 3300060353 Bacteria 946

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031730 Ga0307516_10000705 Ga0307516_1000070524 153
2 3300042439 Ga0439464_0025663 Ga0439464_0025663_220_732 159
3 3300048914 Ga0496111_0822992 Ga0496111_0822992_21_548 160
4 3300037471 Ga0395905_0559878 Ga0395905_0559878_14_580 164
5 3300025297 Ga0209758_1032551 Ga0209758_10325512 165
6 3300060353 Ga0501082_0620950 Ga0501082_0620950_317_817 166
7 iso_pu_bacteria 2643221603 2644026402 166
8 iso_pu_bacteria 2828305725 2828310007 166
9 3300006038 Ga0075365_10005634 Ga0075365_100056343 167
10 3300009101 Ga0105247_10053536 Ga0105247_100535363 167
11 3300009148 Ga0105243_10192546 Ga0105243_101925462 167
12 3300009177 Ga0105248_10006219 Ga0105248_1000621910 167
13 3300009545 Ga0105237_10168192 Ga0105237_101681922 167
14 3300009553 Ga0105249_10180690 Ga0105249_101806902 167
15 3300013297 Ga0157378_10010746 Ga0157378_100107465 167
16 3300013306 Ga0163162_10074309 Ga0163162_100743094 167
17 3300014325 Ga0163163_10003078 Ga0163163_100030782 167
18 3300014968 Ga0157379_10021652 Ga0157379_100216523 167
19 3300014968 Ga0157379_11051693 Ga0157379_110516932 167
20 3300014969 Ga0157376_10399391 Ga0157376_103993912 167
21 3300048912 Ga0496109_0120444 Ga0496109_0120444_762_1310 167
22 3300048913 Ga0496110_0838796 Ga0496110_0838796_152_700 167
23 3300049575 Ga0501039_0804035 Ga0501039_0804035_78_581 167
24 3300049588 Ga0501072_0030966 Ga0501072_0030966_3505_4008 167
25 iso_pu_bacteria 2547132374 2548497661 167
26 iso_pu_bacteria 2643221717 2644649596 167
27 3300005327 Ga0070658_10548060 Ga0070658_105480601 168
28 3300005330 Ga0070690_100005316 Ga0070690_1000053163 168
29 3300005331 Ga0070670_100234960 Ga0070670_1002349603 168
30 3300005334 Ga0068869_100004452 Ga0068869_1000044525 168
31 3300005335 Ga0070666_10015525 Ga0070666_100155254 168
32 3300005338 Ga0068868_100001845 Ga0068868_10000184510 168
33 3300005340 Ga0070689_100083075 Ga0070689_1000830752 168
34 3300005354 Ga0070675_100001536 Ga0070675_10000153612 168
35 3300005355 Ga0070671_100018132 Ga0070671_1000181322 168
36 3300005364 Ga0070673_100126047 Ga0070673_1001260472 168
37 3300005456 Ga0070678_100002045 Ga0070678_10000204512 168
38 3300005539 Ga0068853_101322113 Ga0068853_1013221131 168
39 3300005548 Ga0070665_100292020 Ga0070665_1002920202 168
40 3300005578 Ga0068854_100225143 Ga0068854_1002251432 168
41 3300005617 Ga0068859_100002482 Ga0068859_1000024824 168
42 3300005618 Ga0068864_100002261 Ga0068864_10000226114 168
43 3300005719 Ga0068861_100051481 Ga0068861_1000514814 168
44 3300005841 Ga0068863_100006103 Ga0068863_1000061032 168
45 3300005842 Ga0068858_100006727 Ga0068858_1000067278 168
46 3300005843 Ga0068860_100064627 Ga0068860_1000646272 168
47 3300006237 Ga0097621_100086102 Ga0097621_1000861024 168
48 3300006358 Ga0068871_100068926 Ga0068871_1000689264 168
49 3300006881 Ga0068865_100095930 Ga0068865_1000959302 168
50 3300006931 Ga0097620_100002482 Ga0097620_1000024824 168
51 3300009148 Ga0105243_10131582 Ga0105243_101315823 168
52 3300009148 Ga0105243_10455062 Ga0105243_104550621 168
53 3300009176 Ga0105242_11142530 Ga0105242_111425302 168
54 3300009177 Ga0105248_10004752 Ga0105248_100047522 168
55 3300009551 Ga0105238_10802328 Ga0105238_108023282 168
56 3300009553 Ga0105249_10285219 Ga0105249_102852193 168
57 3300013296 Ga0157374_10180500 Ga0157374_101805003 168
58 3300013297 Ga0157378_10115565 Ga0157378_101155654 168
59 3300013306 Ga0163162_10023139 Ga0163162_100231398 168
60 3300014325 Ga0163163_10008006 Ga0163163_100080069 168
61 3300014968 Ga0157379_10005874 Ga0157379_100058749 168
62 3300025893 Ga0207682_10003755 Ga0207682_100037558 168
63 3300025899 Ga0207642_10081262 Ga0207642_100812622 168
64 3300025903 Ga0207680_10018907 Ga0207680_100189073 168
65 3300025907 Ga0207645_10045526 Ga0207645_100455262 168
66 3300025923 Ga0207681_10290358 Ga0207681_102903582 168
67 3300025925 Ga0207650_10286796 Ga0207650_102867963 168
68 3300025926 Ga0207659_10134475 Ga0207659_101344752 168
69 3300025931 Ga0207644_10007613 Ga0207644_100076132 168
70 3300025934 Ga0207686_10697365 Ga0207686_106973652 168
71 3300025935 Ga0207709_10456792 Ga0207709_104567921 168
72 3300025936 Ga0207670_10081587 Ga0207670_100815873 168
73 3300025938 Ga0207704_10207013 Ga0207704_102070132 168
74 3300025940 Ga0207691_10020243 Ga0207691_100202438 168
75 3300025942 Ga0207689_10012467 Ga0207689_100124677 168
76 3300025960 Ga0207651_10094589 Ga0207651_100945893 168
77 3300025961 Ga0207712_10145567 Ga0207712_101455673 168
78 3300025972 Ga0207668_10042985 Ga0207668_100429852 168
79 3300025981 Ga0207640_10421889 Ga0207640_104218892 168
80 3300026023 Ga0207677_10002314 Ga0207677_100023148 168
81 3300026035 Ga0207703_10017445 Ga0207703_100174452 168
82 3300026041 Ga0207639_10798250 Ga0207639_107982502 168
83 3300026088 Ga0207641_10002775 Ga0207641_1000277514 168
84 3300026089 Ga0207648_10183764 Ga0207648_101837643 168
85 3300026089 Ga0207648_10253908 Ga0207648_102539083 168
86 3300026095 Ga0207676_10002749 Ga0207676_100027493 168
87 3300026095 Ga0207676_10627761 Ga0207676_106277612 168
88 3300026118 Ga0207675_100023489 Ga0207675_1000234892 168
89 3300026121 Ga0207683_10004205 Ga0207683_100042059 168
90 3300028380 Ga0268265_10048182 Ga0268265_100481822 168
91 3300031730 Ga0307516_10199113 Ga0307516_101991131 168
92 3300032002 Ga0307416_101019553 Ga0307416_1010195532 168
93 3300035089 Ga0373944_0162409 Ga0373944_0162409_208_714 168
94 3300035171 Ga0373946_0021296 Ga0373946_0021296_1306_1812 168
95 3300035691 Ga0373931_0110449 Ga0373931_0110449_968_1495 168
96 3300037471 Ga0395905_0097307 Ga0395905_0097307_2018_2530 168
97 3300037471 Ga0395905_0924297 Ga0395905_0924297_170_679 168
98 3300041512 Ga0451853_1030753 Ga0451853_1030753_621_1151 168
99 3300046472 Ga0495580_0681442 Ga0495580_0681442_75_581 168
100 3300046537 Ga0495598_0005609 Ga0495598_0005609_204_710 168
101 3300046539 Ga0495621_0106588 Ga0495621_0106588_86_592 168
102 3300046683 Ga0495658_0064233 Ga0495658_0064233_1451_1957 168
103 3300048908 Ga0496105_0237446 Ga0496105_0237446_691_1197 168
104 3300048911 Ga0496108_0012270 Ga0496108_0012270_2452_2958 168
105 3300048912 Ga0496109_0044963 Ga0496109_0044963_2588_3094 168
106 3300048917 Ga0496114_0063509 Ga0496114_0063509_252_758 168
107 3300050492 nmdc:mga0yw44_39183_c1 nmdc:mga0yw44_39183_c1_1134_1718 168
108 3300005327 Ga0070658_10424417 Ga0070658_104244172 169
109 3300005354 Ga0070675_100083660 Ga0070675_1000836602 169
110 3300005617 Ga0068859_101599315 Ga0068859_1015993152 169
111 3300006038 Ga0075365_10025877 Ga0075365_100258773 169
112 3300006177 Ga0075362_10348433 Ga0075362_103484331 169
113 3300006195 Ga0075366_10027807 Ga0075366_100278075 169
114 3300006195 Ga0075366_10536979 Ga0075366_105369791 169
115 3300006353 Ga0075370_10009589 Ga0075370_100095894 169
116 3300006353 Ga0075370_10254597 Ga0075370_102545972 169
117 3300006931 Ga0097620_101599132 Ga0097620_1015991322 169
118 3300025918 Ga0207662_10054895 Ga0207662_100548952 169
119 3300025925 Ga0207650_10422935 Ga0207650_104229352 169
120 3300025926 Ga0207659_10027172 Ga0207659_100271725 169
121 3300025932 Ga0207690_10230103 Ga0207690_102301032 169
122 3300025937 Ga0207669_10430345 Ga0207669_104303452 169
123 3300025942 Ga0207689_10824880 Ga0207689_108248802 169
124 3300031242 Ga0265329_10021615 Ga0265329_100216153 169
125 3300031344 Ga0265316_10261127 Ga0265316_102611272 169
126 3300031711 Ga0265314_10093951 Ga0265314_100939513 169
127 3300031731 Ga0307405_10004807 Ga0307405_100048073 169
128 3300031901 Ga0307406_10072805 Ga0307406_100728052 169
129 3300031911 Ga0307412_10204469 Ga0307412_102044692 169
130 3300031911 Ga0307412_10582376 Ga0307412_105823762 169
131 3300032004 Ga0307414_10455421 Ga0307414_104554212 169
132 3300032126 Ga0307415_100003110 Ga0307415_1000031105 169
133 3300033180 Ga0307510_10262188 Ga0307510_102621882 169
134 3300036401 Ga0373937_0120766 Ga0373937_0120766_1613_2143 169
135 3300037418 Ga0395900_0179925 Ga0395900_0179925_1462_1992 169
136 3300037418 Ga0395900_1027789 Ga0395900_1027789_102_683 169
137 3300037466 Ga0395898_0162952 Ga0395898_0162952_412_993 169
138 3300038443 Ga0395901_0206749 Ga0395901_0206749_795_1325 169
139 3300041505 Ga0451849_1263844 Ga0451849_1263844_144_662 169
140 3300042007 Ga0439449_0000091 Ga0439449_0000091_9149_9697 169
141 3300042015 Ga0439462_0001751 Ga0439462_0001751_2784_3332 169
142 3300042127 Ga0450890_010784 Ga0450890_010784_40_579 169
143 3300044712 Ga0453684_0000906 Ga0453684_0000906_51287_51820 169
144 3300048088 Ga0495602_0628079 Ga0495602_0628079_67_597 169
145 3300048928 Ga0496125_0011388 Ga0496125_0011388_703_1251 169
146 3300049568 Ga0501031_0312801 Ga0501031_0312801_418_927 169
147 3300049571 Ga0501034_0050665 Ga0501034_0050665_2522_3031 169
148 3300049572 Ga0501036_0268426 Ga0501036_0268426_452_961 169
149 3300049573 Ga0501037_0064117 Ga0501037_0064117_1562_2071 169
150 3300049579 Ga0501043_0062972 Ga0501043_0062972_1587_2096 169
151 3300050492 nmdc:mga0yw44_7652_c1 nmdc:mga0yw44_7652_c1_817_1350 169
152 3300050493 nmdc:mga0k408_19795_c1 nmdc:mga0k408_19795_c1_196_711 169
153 3300050494 nmdc:mga06z11_554606_c1 nmdc:mga06z11_554606_c1_149_664 169
154 3300050496 nmdc:mga07m45_5034_c1 nmdc:mga07m45_5034_c1_2828_3343 169
155 3300050496 nmdc:mga07m45_61018_c1 nmdc:mga07m45_61018_c1_206_736 169
156 3300050509 nmdc:mga0qj67_253090_c1 nmdc:mga0qj67_253090_c1_331_876 169
157 3300053077 Ga0495601_0171559 Ga0495601_0171559_277_807 169
158 3300003794 Ga0055531_10000281 Ga0055531_1000028144 170
159 3300005334 Ga0068869_100252864 Ga0068869_1002528642 170
160 3300005335 Ga0070666_10637476 Ga0070666_106374761 170
161 3300005353 Ga0070669_100022170 Ga0070669_1000221705 170
162 3300005365 Ga0070688_100365456 Ga0070688_1003654561 170
163 3300005367 Ga0070667_100158996 Ga0070667_1001589962 170
164 3300005441 Ga0070700_100037542 Ga0070700_1000375424 170
165 3300005543 Ga0070672_100093084 Ga0070672_1000930842 170
166 3300005578 Ga0068854_100595818 Ga0068854_1005958182 170
167 3300005617 Ga0068859_100216410 Ga0068859_1002164102 170
168 3300005718 Ga0068866_10137040 Ga0068866_101370402 170
169 3300005719 Ga0068861_100037832 Ga0068861_1000378324 170
170 3300006042 Ga0075368_10002604 Ga0075368_100026046 170
171 3300006048 Ga0075363_100006903 Ga0075363_1000069035 170
172 3300006051 Ga0075364_10164132 Ga0075364_101641321 170
173 3300006177 Ga0075362_10011910 Ga0075362_100119102 170
174 3300006178 Ga0075367_10010157 Ga0075367_100101571 170
175 3300006195 Ga0075366_10008595 Ga0075366_100085953 170
176 3300006195 Ga0075366_10044263 Ga0075366_100442633 170
177 3300006195 Ga0075366_10077925 Ga0075366_100779252 170
178 3300006237 Ga0097621_100695020 Ga0097621_1006950202 170
179 3300006353 Ga0075370_10541087 Ga0075370_105410871 170
180 3300006881 Ga0068865_100003419 Ga0068865_1000034193 170
181 3300006931 Ga0097620_100216430 Ga0097620_1002164302 170
182 3300013297 Ga0157378_10998885 Ga0157378_109988852 170
183 3300025273 Ga0209673_1005024 Ga0209673_10050246 170
184 3300025303 Ga0209051_1000172 Ga0209051_100017298 170
185 3300025304 Ga0209257_1000015 Ga0209257_1000015489 170
186 3300025304 Ga0209257_1000108 Ga0209257_1000108221 170
187 3300025925 Ga0207650_10050224 Ga0207650_100502243 170
188 3300025935 Ga0207709_10014788 Ga0207709_100147884 170
189 3300025940 Ga0207691_10014458 Ga0207691_100144585 170
190 3300025942 Ga0207689_10199578 Ga0207689_101995782 170
191 3300025986 Ga0207658_10052033 Ga0207658_100520332 170
192 3300026075 Ga0207708_10034069 Ga0207708_100340692 170
193 3300026118 Ga0207675_100093216 Ga0207675_1000932162 170
194 3300027614 Ga0209970_1001359 Ga0209970_10013595 170
195 3300028381 Ga0268264_10034183 Ga0268264_100341832 170
196 3300031456 Ga0307513_10046191 Ga0307513_100461913 170
197 3300031649 Ga0307514_10001361 Ga0307514_1000136119 170
198 3300035117 Ga0373953_0194424 Ga0373953_0194424_299_844 170
199 3300035118 Ga0373954_0314011 Ga0373954_0314011_56_601 170
200 3300035170 Ga0373943_0076828 Ga0373943_0076828_58_603 170
201 3300035172 Ga0373955_0015462 Ga0373955_0015462_2553_3098 170
202 3300035410 Ga0373924_0059664 Ga0373924_0059664_84_629 170
203 3300035692 Ga0373935_0030421 Ga0373935_0030421_1394_1939 170
204 3300035725 Ga0373947_0070660 Ga0373947_0070660_1473_2018 170
205 3300037068 Ga0373925_0082032 Ga0373925_0082032_1521_2066 170
206 3300037418 Ga0395900_0843695 Ga0395900_0843695_172_756 170
207 3300037471 Ga0395905_0007854 Ga0395905_0007854_9746_10330 170
208 3300037471 Ga0395905_0553168 Ga0395905_0553168_142_711 170
209 3300042156 Ga0439446_0032312 Ga0439446_0032312_583_1128 170
210 3300042435 Ga0439434_0029557 Ga0439434_0029557_230_775 170
211 3300042532 Ga0450893_0034825 Ga0450893_0034825_219_764 170
212 3300044684 Ga0466966_0283102 Ga0466966_0283102_255_806 170
213 3300044693 Ga0466961_0115564 Ga0466961_0115564_823_1368 170
214 3300044765 Ga0466970_0305593 Ga0466970_0305593_282_833 170
215 3300045049 Ga0466959_0067268 Ga0466959_0067268_1113_1664 170
216 3300045051 Ga0451576_0920862 Ga0451576_0920862_281_832 170
217 3300046514 Ga0495618_0088064 Ga0495618_0088064_707_1252 170
218 3300046535 Ga0495586_0257632 Ga0495586_0257632_333_878 170
219 3300046535 Ga0495586_0386385 Ga0495586_0386385_148_732 170
220 3300046536 Ga0495587_0283444 Ga0495587_0283444_49_594 170
221 3300046543 Ga0495645_0045798 Ga0495645_0045798_2455_3000 170
222 3300046543 Ga0495645_0298890 Ga0495645_0298890_35_580 170
223 3300046663 Ga0495635_0063270 Ga0495635_0063270_1124_1669 170
224 3300046683 Ga0495658_0107078 Ga0495658_0107078_400_945 170
225 3300046809 Ga0495600_0165096 Ga0495600_0165096_193_738 170
226 3300047444 Ga0495675_0019083 Ga0495675_0019083_406_951 170
227 3300047471 Ga0495684_0098398 Ga0495684_0098398_176_721 170
228 3300047472 Ga0495686_0234345 Ga0495686_0234345_94_630 170
229 3300047673 Ga0495593_0182126 Ga0495593_0182126_226_771 170
230 3300049823 Ga0501044_0725072 Ga0501044_0725072_93_644 170
231 3300050489 nmdc:mga03683_16407_c1 nmdc:mga03683_16407_c1_1738_2325 170
232 3300050490 nmdc:mga03n38_87504_c1 nmdc:mga03n38_87504_c1_567_1154 170
233 3300050491 nmdc:mga00v17_72957_c1 nmdc:mga00v17_72957_c1_969_1556 170
234 3300050492 nmdc:mga0yw44_80754_c1 nmdc:mga0yw44_80754_c1_1013_1600 170
235 3300050493 nmdc:mga0k408_153216_c1 nmdc:mga0k408_153216_c1_292_876 170
236 3300050493 nmdc:mga0k408_67642_c1 nmdc:mga0k408_67642_c1_1042_1632 170
237 3300050495 nmdc:mga04h51_41468_c1 nmdc:mga04h51_41468_c1_761_1348 170
238 3300050496 nmdc:mga07m45_6292_c1 nmdc:mga07m45_6292_c1_4241_4828 170
239 3300050513 nmdc:mga0rr50_768073_c1 nmdc:mga0rr50_768073_c1_292_804 170
240 3300053077 Ga0495601_0259220 Ga0495601_0259220_289_834 170
241 3300053085 Ga0495619_0118984 Ga0495619_0118984_116_661 170
242 3300053121 Ga0500607_209647 Ga0500607_209647_53_577 170
243 iso_pu_bacteria 2643221609 2644058236 170
244 iso_pu_bacteria 2643221611 2644073289 170
245 iso_pu_bacteria 2643221717 2644647015 170
246 iso_pu_bacteria 2738543012 2739244423 170
247 iso_pu_bacteria 2816332133 2816469854 170
248 iso_pu_bacteria 2990710928 2990715123 170
249 3300003771 Ga0055526_1000223 Ga0055526_100022343 171
250 3300003784 Ga0055534_1000530 Ga0055534_10005309 171
251 3300003794 Ga0055531_10036086 Ga0055531_100360862 171
252 3300005262 Ga0065165_1027648 Ga0065165_10276483 171
253 3300005330 Ga0070690_100005945 Ga0070690_1000059452 171
254 3300005331 Ga0070670_100114694 Ga0070670_1001146942 171
255 3300005333 Ga0070677_10003525 Ga0070677_100035257 171
256 3300005334 Ga0068869_100020317 Ga0068869_1000203172 171
257 3300005335 Ga0070666_10003673 Ga0070666_100036737 171
258 3300005339 Ga0070660_100520178 Ga0070660_1005201782 171
259 3300005343 Ga0070687_100044388 Ga0070687_1000443882 171
260 3300005347 Ga0070668_100002035 Ga0070668_10000203511 171
261 3300005353 Ga0070669_100000367 Ga0070669_10000036723 171
262 3300005354 Ga0070675_100018070 Ga0070675_1000180708 171
263 3300005355 Ga0070671_100012515 Ga0070671_1000125157 171
264 3300005356 Ga0070674_100000914 Ga0070674_1000009145 171
265 3300005364 Ga0070673_100109086 Ga0070673_1001090862 171
266 3300005364 Ga0070673_101160419 Ga0070673_1011604191 171
267 3300005367 Ga0070667_100001366 Ga0070667_10000136615 171
268 3300005438 Ga0070701_10083819 Ga0070701_100838192 171
269 3300005456 Ga0070678_100006589 Ga0070678_1000065892 171
270 3300005457 Ga0070662_100004024 Ga0070662_10000402411 171
271 3300005457 Ga0070662_100893163 Ga0070662_1008931631 171
272 3300005459 Ga0068867_100001126 Ga0068867_1000011269 171
273 3300005543 Ga0070672_100064753 Ga0070672_1000647532 171
274 3300005544 Ga0070686_100257213 Ga0070686_1002572132 171
275 3300005564 Ga0070664_100290525 Ga0070664_1002905252 171
276 3300005616 Ga0068852_100220495 Ga0068852_1002204952 171
277 3300005617 Ga0068859_100029448 Ga0068859_1000294485 171
278 3300005618 Ga0068864_100057316 Ga0068864_1000573162 171
279 3300005718 Ga0068866_10002754 Ga0068866_100027542 171
280 3300005719 Ga0068861_100001059 Ga0068861_1000010599 171
281 3300005834 Ga0068851_10131764 Ga0068851_101317642 171
282 3300005841 Ga0068863_100000556 Ga0068863_10000055622 171
283 3300005841 Ga0068863_100289525 Ga0068863_1002895252 171
284 3300005842 Ga0068858_100005250 Ga0068858_1000052507 171
285 3300005843 Ga0068860_100018085 Ga0068860_1000180857 171
286 3300005843 Ga0068860_101689737 Ga0068860_1016897371 171
287 3300005844 Ga0068862_100006583 Ga0068862_10000658312 171
288 3300006358 Ga0068871_100404808 Ga0068871_1004048083 171
289 3300006881 Ga0068865_100003603 Ga0068865_10000360312 171
290 3300006931 Ga0097620_100029448 Ga0097620_1000294485 171
291 3300009094 Ga0111539_10474776 Ga0111539_104747762 171
292 3300009098 Ga0105245_10023471 Ga0105245_100234716 171
293 3300009148 Ga0105243_10001350 Ga0105243_100013508 171
294 3300009177 Ga0105248_10016122 Ga0105248_100161228 171
295 3300009177 Ga0105248_10121723 Ga0105248_101217233 171
296 3300009177 Ga0105248_10359640 Ga0105248_103596404 171
297 3300009553 Ga0105249_10001023 Ga0105249_1000102315 171
298 3300011119 Ga0105246_11834605 Ga0105246_118346051 171
299 3300013105 Ga0157369_10022086 Ga0157369_100220867 171
300 3300013297 Ga0157378_10001679 Ga0157378_100016795 171
301 3300013297 Ga0157378_10856488 Ga0157378_108564882 171
302 3300013306 Ga0163162_10000847 Ga0163162_1000084717 171
303 3300013306 Ga0163162_10001712 Ga0163162_1000171212 171
304 3300013308 Ga0157375_10002808 Ga0157375_100028086 171
305 3300013308 Ga0157375_10109007 Ga0157375_101090073 171
306 3300014325 Ga0163163_10413539 Ga0163163_104135392 171
307 3300014326 Ga0157380_10002813 Ga0157380_1000281311 171
308 3300014326 Ga0157380_10058691 Ga0157380_100586912 171
309 3300014968 Ga0157379_10119072 Ga0157379_101190724 171
310 3300014968 Ga0157379_10138734 Ga0157379_101387342 171
311 3300014968 Ga0157379_10213375 Ga0157379_102133752 171
312 3300014969 Ga0157376_10546920 Ga0157376_105469202 171
313 3300014969 Ga0157376_11270519 Ga0157376_112705192 171
314 3300017792 Ga0163161_10001420 Ga0163161_1000142010 171
315 3300025273 Ga0209673_1013143 Ga0209673_10131431 171
316 3300025273 Ga0209673_1049117 Ga0209673_10491172 171
317 3300025284 Ga0209130_1001418 Ga0209130_10014185 171
318 3300025291 Ga0209675_1000811 Ga0209675_100081111 171
319 3300025292 Ga0209676_1002690 Ga0209676_10026906 171
320 3300025294 Ga0209025_1045913 Ga0209025_10459132 171
321 3300025295 Ga0209564_1000694 Ga0209564_100069444 171
322 3300025298 Ga0209050_1018355 Ga0209050_10183552 171
323 3300025303 Ga0209051_1000301 Ga0209051_100030151 171
324 3300025303 Ga0209051_1006266 Ga0209051_10062666 171
325 3300025304 Ga0209257_1000022 Ga0209257_1000022556 171
326 3300025304 Ga0209257_1004206 Ga0209257_100420612 171
327 3300025321 Ga0207656_10216344 Ga0207656_102163442 171
328 3300025899 Ga0207642_10001859 Ga0207642_100018592 171
329 3300025903 Ga0207680_10054795 Ga0207680_100547952 171
330 3300025907 Ga0207645_10002177 Ga0207645_100021775 171
331 3300025918 Ga0207662_10009715 Ga0207662_100097152 171
332 3300025919 Ga0207657_10451902 Ga0207657_104519022 171
333 3300025923 Ga0207681_10001841 Ga0207681_100018414 171
334 3300025925 Ga0207650_10076178 Ga0207650_100761782 171
335 3300025925 Ga0207650_10487644 Ga0207650_104876442 171
336 3300025926 Ga0207659_10008547 Ga0207659_100085477 171
337 3300025931 Ga0207644_10010666 Ga0207644_100106663 171
338 3300025933 Ga0207706_10001403 Ga0207706_1000140312 171
339 3300025935 Ga0207709_10035320 Ga0207709_100353202 171
340 3300025937 Ga0207669_10113673 Ga0207669_101136732 171
341 3300025938 Ga0207704_10001013 Ga0207704_1000101310 171
342 3300025938 Ga0207704_10265733 Ga0207704_102657331 171
343 3300025940 Ga0207691_10002981 Ga0207691_1000298110 171
344 3300025941 Ga0207711_10011478 Ga0207711_100114788 171
345 3300025941 Ga0207711_10041473 Ga0207711_100414733 171
346 3300025942 Ga0207689_10006793 Ga0207689_100067932 171
347 3300025945 Ga0207679_10258169 Ga0207679_102581692 171
348 3300025960 Ga0207651_10042474 Ga0207651_100424742 171
349 3300025961 Ga0207712_10001809 Ga0207712_100018093 171
350 3300025972 Ga0207668_10021037 Ga0207668_100210372 171
351 3300025986 Ga0207658_10002800 Ga0207658_1000280010 171
352 3300026023 Ga0207677_10431468 Ga0207677_104314682 171
353 3300026035 Ga0207703_10007787 Ga0207703_100077872 171
354 3300026067 Ga0207678_10165419 Ga0207678_101654192 171
355 3300026075 Ga0207708_10049066 Ga0207708_100490662 171
356 3300026088 Ga0207641_10000726 Ga0207641_1000072628 171
357 3300026089 Ga0207648_10004174 Ga0207648_100041748 171
358 3300026095 Ga0207676_10057145 Ga0207676_100571452 171
359 3300026118 Ga0207675_100002646 Ga0207675_10000264611 171
360 3300026142 Ga0207698_10047208 Ga0207698_100472082 171
361 3300028380 Ga0268265_10002862 Ga0268265_100028627 171
362 3300028381 Ga0268264_10001098 Ga0268264_1000109817 171
363 3300028794 Ga0307515_10076790 Ga0307515_100767904 171
364 3300031901 Ga0307406_10000278 Ga0307406_1000027822 171
365 3300031911 Ga0307412_10149785 Ga0307412_101497852 171
366 3300031995 Ga0307409_100000391 Ga0307409_1000003917 171
367 3300032002 Ga0307416_100013186 Ga0307416_1000131864 171
368 3300032005 Ga0307411_10069851 Ga0307411_100698512 171
369 3300032126 Ga0307415_100000694 Ga0307415_1000006948 171
370 3300039437 Ga0436365_0842267 Ga0436365_0842267_253_798 171
371 3300041443 Ga0451789_0663994 Ga0451789_0663994_7578_8183 171
372 3300041452 Ga0451793_1260512 Ga0451793_1260512_472_1077 171
373 3300041453 Ga0451797_1118508 Ga0451797_1118508_24_629 171
374 3300041456 Ga0451795_1506492 Ga0451795_1506492_30_635 171
375 3300041458 Ga0451798_1067060 Ga0451798_1067060_5242_5847 171
376 3300041459 Ga0451800_0848119 Ga0451800_0848119_2389_2994 171
377 3300041505 Ga0451849_1039152 Ga0451849_1039152_80_685 171
378 3300041512 Ga0451853_2693348 Ga0451853_2693348_110_724 171
379 3300044673 Ga0453683_0390977 Ga0453683_0390977_139_678 171
380 3300045051 Ga0451576_0999403 Ga0451576_0999403_170_709 171
381 3300046507 Ga0495606_0008109 Ga0495606_0008109_1748_2263 171
382 3300046515 Ga0495620_0053718 Ga0495620_0053718_561_1166 171
383 3300046519 Ga0495632_0003721 Ga0495632_0003721_9678_10283 171
384 3300046539 Ga0495621_0105409 Ga0495621_0105409_206_733 171
385 3300046642 Ga0495634_0400845 Ga0495634_0400845_154_702 171
386 3300048905 Ga0496102_0620684 Ga0496102_0620684_99_644 171
387 3300048912 Ga0496109_0972859 Ga0496109_0972859_208_759 171
388 3300048924 Ga0496121_0083477 Ga0496121_0083477_1221_1742 171
389 3300049688 Ga0501259_117024 Ga0501259_117024_18_563 171
390 3300050489 nmdc:mga03683_324478_c1 nmdc:mga03683_324478_c1_123_662 171
391 3300050493 nmdc:mga0k408_39442_c1 nmdc:mga0k408_39442_c1_1818_2426 171
392 3300050511 nmdc:mga08y16_1279257_c1 nmdc:mga08y16_1279257_c1_120_665 171
393 3300053092 Ga0500583_0238840 Ga0500583_0238840_128_733 171
394 3300053093 Ga0500651_0006781 Ga0500651_0006781_3840_4445 171
395 3300053098 Ga0500650_0183574 Ga0500650_0183574_106_711 171
396 3300053127 Ga0500623_116174 Ga0500623_116174_410_1015 171
397 3300053130 Ga0500642_0000908 Ga0500642_0000908_146_751 171
398 3300053131 Ga0500652_003229 Ga0500652_003229_288_893 171
399 3300053134 Ga0500658_0088895 Ga0500658_0088895_572_1177 171
400 3300053143 Ga0500579_187336 Ga0500579_187336_30_635 171
401 3300053156 Ga0500622_0001110 Ga0500622_0001110_17816_18421 171
402 3300053724 Ga0500570_111189 Ga0500570_111189_98_703 171
403 3300059421 Ga0590071_012085 Ga0590071_012085_957_1574 171
404 3300059424 Ga0590075_008298 Ga0590075_008298_1586_2203 171
405 3300059426 Ga0590077_006366 Ga0590077_006366_1474_2043 171

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04290

DctQ

Tripartite ATP-independent periplasmic transporters, DctQ component

40

170

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qha-assembly1.cif.gz_A cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.8965 1 154
7qha-assembly1.cif.gz_A cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.8802 1 154
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.7918 11 168
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.732 11 168
3jcf-assembly1.cif.gz_A cryo-em structure of the magnesium channel cora in the closed symmetric magnesium-bound state 0.4893 35 168
ID Description Score Start End Superfamily
af_P37674_16_146_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.9572 27 153 1.20.120.550
af_P37674_16_146_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.9222 27 153 1.20.120.550
af_A0A2R8S075_1_113_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.6441 54 171 1.20.1070.10
1ow7A02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.6308 63 154 1.20.120.330
af_A0A2R8S075_1_113_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.6235 54 171 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A7T6YGE6-F1-model_v4 deleted 0.9867 2 148
AF-A0A0P7CW95-F1-model_v4 TRAP transporter small permease protein 0.9859 3 148 GO:0005886
GO:0015740
GO:0022857
AF-A0A3T0K5X0-F1-model_v4 deleted 0.9855 2 148
AF-A0A558HQK4-F1-model_v4 TRAP transporter small permease protein 0.9847 4 148 GO:0005886
GO:0015740
GO:0022857
AF-A0A8A7CUE7-F1-model_v4 deleted 0.9807 7 154

Feature Viewer

pLDDT pTM Quality
84.53 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map