F436082
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 405 | 255 | 395 | 180 |
Family's Representative Sequence
| Representative Sequence | 3300059421|Ga0590071_012085|Ga0590071_012085_957_1574 |
| Length | 205 |
| Sequence | LRLLKEAAWVAGEQETEMTRWIDRYCRLLDAISASCLALMVVLVFGNVVLRYAFSSGITVSEELSRWLFVWMTFLGAIVALKEHSHLGTDMLVAHLPLWGKKACLVVGQLAMLYVTWLLFQGSLEQARINWDVQAPVSGASMGIFYGSGVVFAVSAALLLVRELLRTLSGRAAESELVMVQESEDLAQVQALHLTEAAPSPGPKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 2 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 3 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 4 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 5 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 6 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 7 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 8 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 9 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 10 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 47 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 48 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 54 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 55 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 56 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 57 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 58 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 59 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 86 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 88 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 91 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 137 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 138 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 139 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 140 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 141 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 142 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 143 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 144 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 145 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 146 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 147 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 148 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 149 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 150 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 151 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 152 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 153 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 154 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 155 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 156 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 157 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 158 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 159 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 160 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 161 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 162 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 163 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 164 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 165 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 166 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 167 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 168 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 169 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 170 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 171 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 172 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 173 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 174 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 175 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 176 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 177 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 178 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 179 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 180 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 181 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 182 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 183 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 184 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 185 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 186 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 187 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 188 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 189 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 190 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 191 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 211 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 212 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 215 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 216 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 217 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 218 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 219 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 227 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 229 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 230 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 231 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 232 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 233 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 234 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 235 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 236 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 242 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 243 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 244 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 245 | 3300053127 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere | Metagenome | Endosphere |
| 246 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 247 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 248 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 249 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 250 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 251 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 252 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 253 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 254 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 255 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.53 |
| Metatranscriptomes | 0 |
| Isolates | 2.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.05 |
| Nodule | 0 |
| Rhizoplane | 3.7 |
| Rhizosphere | 74.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055526_1000223 | 3300003771 | Bacteria | 49048 |
| 2 | Ga0055534_1000530 | 3300003784 | Bacteria | 20526 |
| 3 | Ga0055531_10000281 | 3300003794 | Bacteria | 51971 |
| 4 | Ga0055531_10036086 | 3300003794 | Bacteria | 1533 |
| 5 | Ga0065165_1027648 | 3300005262 | Bacteria | 1844 |
| 6 | Ga0070658_10424417 | 3300005327 | Bacteria | 1144 |
| 7 | Ga0070658_10548060 | 3300005327 | Bacteria | 1001 |
| 8 | Ga0070690_100005316 | 3300005330 | Bacteria | 7224 |
| 9 | Ga0070690_100005945 | 3300005330 | Bacteria | 6890 |
| 10 | Ga0070670_100114694 | 3300005331 | Bacteria | 2323 |
| 11 | Ga0070670_100234960 | 3300005331 | Bacteria | 1596 |
| 12 | Ga0070677_10003525 | 3300005333 | Bacteria | 5049 |
| 13 | Ga0068869_100004452 | 3300005334 | Bacteria | 8711 |
| 14 | Ga0068869_100020317 | 3300005334 | Bacteria | 4553 |
| 15 | Ga0068869_100252864 | 3300005334 | Bacteria | 1408 |
| 16 | Ga0070666_10003673 | 3300005335 | Bacteria | 9298 |
| 17 | Ga0070666_10015525 | 3300005335 | Bacteria | 4859 |
| 18 | Ga0070666_10637476 | 3300005335 | Bacteria | 779 |
| 19 | Ga0068868_100001845 | 3300005338 | Bacteria | 14549 |
| 20 | Ga0070660_100520178 | 3300005339 | Bacteria | 991 |
| 21 | Ga0070689_100083075 | 3300005340 | Bacteria | 2517 |
| 22 | Ga0070687_100044388 | 3300005343 | Bacteria | 2264 |
| 23 | Ga0070668_100002035 | 3300005347 | Bacteria | 14789 |
| 24 | Ga0070669_100000367 | 3300005353 | Bacteria | 34943 |
| 25 | Ga0070669_100022170 | 3300005353 | Bacteria | 4542 |
| 26 | Ga0070675_100001536 | 3300005354 | Bacteria | 17075 |
| 27 | Ga0070675_100018070 | 3300005354 | Bacteria | 5612 |
| 28 | Ga0070675_100083660 | 3300005354 | Bacteria | 2664 |
| 29 | Ga0070671_100012515 | 3300005355 | Bacteria | 6833 |
| 30 | Ga0070671_100018132 | 3300005355 | Bacteria | 5715 |
| 31 | Ga0070674_100000914 | 3300005356 | Bacteria | 15401 |
| 32 | Ga0070673_100109086 | 3300005364 | Bacteria | 2293 |
| 33 | Ga0070673_100126047 | 3300005364 | Bacteria | 2143 |
| 34 | Ga0070673_101160419 | 3300005364 | Bacteria | 723 |
| 35 | Ga0070688_100365456 | 3300005365 | Bacteria | 1060 |
| 36 | Ga0070667_100001366 | 3300005367 | Bacteria | 21894 |
| 37 | Ga0070667_100158996 | 3300005367 | Bacteria | 1989 |
| 38 | Ga0070701_10083819 | 3300005438 | Bacteria | 1732 |
| 39 | Ga0070700_100037542 | 3300005441 | Bacteria | 2947 |
| 40 | Ga0070678_100002045 | 3300005456 | Bacteria | 10919 |
| 41 | Ga0070678_100006589 | 3300005456 | Bacteria | 6826 |
| 42 | Ga0070662_100004024 | 3300005457 | Bacteria | 9224 |
| 43 | Ga0070662_100893163 | 3300005457 | Bacteria | 758 |
| 44 | Ga0068867_100001126 | 3300005459 | Bacteria | 18309 |
| 45 | Ga0068853_101322113 | 3300005539 | Bacteria | 697 |
| 46 | Ga0070672_100064753 | 3300005543 | Bacteria | 2889 |
| 47 | Ga0070672_100093084 | 3300005543 | Bacteria | 2434 |
| 48 | Ga0070686_100257213 | 3300005544 | Bacteria | 1278 |
| 49 | Ga0070665_100292020 | 3300005548 | Bacteria | 1633 |
| 50 | Ga0070664_100290525 | 3300005564 | Bacteria | 1476 |
| 51 | Ga0068854_100225143 | 3300005578 | Bacteria | 1486 |
| 52 | Ga0068854_100595818 | 3300005578 | Bacteria | 943 |
| 53 | Ga0068852_100220495 | 3300005616 | Bacteria | 1803 |
| 54 | Ga0068859_100002482 | 3300005617 | Bacteria | 18764 |
| 55 | Ga0068859_100029448 | 3300005617 | Bacteria | 5508 |
| 56 | Ga0068859_100216410 | 3300005617 | Bacteria | 2003 |
| 57 | Ga0068859_101599315 | 3300005617 | Bacteria | 720 |
| 58 | Ga0068864_100002261 | 3300005618 | Bacteria | 15918 |
| 59 | Ga0068864_100057316 | 3300005618 | Bacteria | 3366 |
| 60 | Ga0068866_10002754 | 3300005718 | Bacteria | 7252 |
| 61 | Ga0068866_10137040 | 3300005718 | Bacteria | 1400 |
| 62 | Ga0068861_100001059 | 3300005719 | Bacteria | 16923 |
| 63 | Ga0068861_100037832 | 3300005719 | Bacteria | 3588 |
| 64 | Ga0068861_100051481 | 3300005719 | Bacteria | 3126 |
| 65 | Ga0068851_10131764 | 3300005834 | Bacteria | 1353 |
| 66 | Ga0068863_100000556 | 3300005841 | Bacteria | 37892 |
| 67 | Ga0068863_100006103 | 3300005841 | Bacteria | 11819 |
| 68 | Ga0068863_100289525 | 3300005841 | Bacteria | 1588 |
| 69 | Ga0068858_100005250 | 3300005842 | Bacteria | 12693 |
| 70 | Ga0068858_100006727 | 3300005842 | Bacteria | 11188 |
| 71 | Ga0068860_100018085 | 3300005843 | Bacteria | 6864 |
| 72 | Ga0068860_100064627 | 3300005843 | Bacteria | 3475 |
| 73 | Ga0068860_101689737 | 3300005843 | Bacteria | 655 |
| 74 | Ga0068862_100006583 | 3300005844 | Bacteria | 9632 |
| 75 | Ga0075365_10005634 | 3300006038 | Bacteria | 6779 |
| 76 | Ga0075365_10025877 | 3300006038 | Bacteria | 3718 |
| 77 | Ga0075368_10002604 | 3300006042 | Bacteria | 5915 |
| 78 | Ga0075363_100006903 | 3300006048 | Bacteria | 5192 |
| 79 | Ga0075364_10164132 | 3300006051 | Bacteria | 1500 |
| 80 | Ga0075362_10011910 | 3300006177 | Bacteria | 3437 |
| 81 | Ga0075362_10348433 | 3300006177 | Bacteria | 741 |
| 82 | Ga0075367_10010157 | 3300006178 | Bacteria | 4938 |
| 83 | Ga0075366_10008595 | 3300006195 | Bacteria | 5685 |
| 84 | Ga0075366_10027807 | 3300006195 | Bacteria | 3319 |
| 85 | Ga0075366_10044263 | 3300006195 | Bacteria | 2638 |
| 86 | Ga0075366_10077925 | 3300006195 | Bacteria | 1978 |
| 87 | Ga0075366_10536979 | 3300006195 | Bacteria | 724 |
| 88 | Ga0097621_100086102 | 3300006237 | Bacteria | 2622 |
| 89 | Ga0097621_100695020 | 3300006237 | Bacteria | 936 |
| 90 | Ga0075370_10009589 | 3300006353 | Bacteria | 5034 |
| 91 | Ga0075370_10254597 | 3300006353 | Bacteria | 1041 |
| 92 | Ga0075370_10541087 | 3300006353 | Bacteria | 704 |
| 93 | Ga0068871_100068926 | 3300006358 | Bacteria | 2904 |
| 94 | Ga0068871_100404808 | 3300006358 | Bacteria | 1216 |
| 95 | Ga0068865_100003419 | 3300006881 | Bacteria | 9497 |
| 96 | Ga0068865_100003603 | 3300006881 | Bacteria | 9309 |
| 97 | Ga0068865_100095930 | 3300006881 | Bacteria | 2161 |
| 98 | Ga0097620_100002482 | 3300006931 | Bacteria | 18764 |
| 99 | Ga0097620_100029448 | 3300006931 | Bacteria | 5508 |
| 100 | Ga0097620_100216430 | 3300006931 | Bacteria | 2003 |
| 101 | Ga0097620_101599132 | 3300006931 | Bacteria | 720 |
| 102 | Ga0111539_10474776 | 3300009094 | Bacteria | 1456 |
| 103 | Ga0105245_10023471 | 3300009098 | Bacteria | 5415 |
| 104 | Ga0105247_10053536 | 3300009101 | Bacteria | 2490 |
| 105 | Ga0105243_10001350 | 3300009148 | Bacteria | 21852 |
| 106 | Ga0105243_10131582 | 3300009148 | Bacteria | 2123 |
| 107 | Ga0105243_10192546 | 3300009148 | Bacteria | 1782 |
| 108 | Ga0105243_10455062 | 3300009148 | Bacteria | 1202 |
| 109 | Ga0105242_11142530 | 3300009176 | Bacteria | 795 |
| 110 | Ga0105248_10004752 | 3300009177 | Bacteria | 15032 |
| 111 | Ga0105248_10006219 | 3300009177 | Bacteria | 13091 |
| 112 | Ga0105248_10016122 | 3300009177 | Bacteria | 8223 |
| 113 | Ga0105248_10121723 | 3300009177 | Bacteria | 2944 |
| 114 | Ga0105248_10359640 | 3300009177 | Bacteria | 1639 |
| 115 | Ga0105237_10168192 | 3300009545 | Bacteria | 2192 |
| 116 | Ga0105238_10802328 | 3300009551 | Bacteria | 957 |
| 117 | Ga0105249_10001023 | 3300009553 | Bacteria | 24728 |
| 118 | Ga0105249_10180690 | 3300009553 | Bacteria | 2052 |
| 119 | Ga0105249_10285219 | 3300009553 | Bacteria | 1651 |
| 120 | Ga0105246_11834605 | 3300011119 | Bacteria | 580 |
| 121 | Ga0157369_10022086 | 3300013105 | Bacteria | 7109 |
| 122 | Ga0157374_10180500 | 3300013296 | Bacteria | 2062 |
| 123 | Ga0157378_10001679 | 3300013297 | Bacteria | 19946 |
| 124 | Ga0157378_10010746 | 3300013297 | Bacteria | 8001 |
| 125 | Ga0157378_10115565 | 3300013297 | Bacteria | 2466 |
| 126 | Ga0157378_10856488 | 3300013297 | Bacteria | 937 |
| 127 | Ga0157378_10998885 | 3300013297 | Bacteria | 871 |
| 128 | Ga0163162_10000847 | 3300013306 | Bacteria | 28426 |
| 129 | Ga0163162_10001712 | 3300013306 | Bacteria | 20568 |
| 130 | Ga0163162_10023139 | 3300013306 | Bacteria | 6129 |
| 131 | Ga0163162_10074309 | 3300013306 | Bacteria | 3458 |
| 132 | Ga0157375_10002808 | 3300013308 | Bacteria | 15075 |
| 133 | Ga0157375_10109007 | 3300013308 | Bacteria | 2864 |
| 134 | Ga0163163_10003078 | 3300014325 | Bacteria | 14125 |
| 135 | Ga0163163_10008006 | 3300014325 | Bacteria | 9353 |
| 136 | Ga0163163_10413539 | 3300014325 | Bacteria | 1407 |
| 137 | Ga0157380_10002813 | 3300014326 | Bacteria | 11827 |
| 138 | Ga0157380_10058691 | 3300014326 | Bacteria | 3068 |
| 139 | Ga0157379_10005874 | 3300014968 | Bacteria | 10560 |
| 140 | Ga0157379_10021652 | 3300014968 | Bacteria | 5693 |
| 141 | Ga0157379_10119072 | 3300014968 | Bacteria | 2375 |
| 142 | Ga0157379_10138734 | 3300014968 | Bacteria | 2191 |
| 143 | Ga0157379_10213375 | 3300014968 | Bacteria | 1748 |
| 144 | Ga0157379_11051693 | 3300014968 | Bacteria | 778 |
| 145 | Ga0157376_10399391 | 3300014969 | Bacteria | 1329 |
| 146 | Ga0157376_10546920 | 3300014969 | Bacteria | 1145 |
| 147 | Ga0157376_11270519 | 3300014969 | Bacteria | 766 |
| 148 | Ga0163161_10001420 | 3300017792 | Bacteria | 17665 |
| 149 | Ga0209673_1005024 | 3300025273 | Bacteria | 6831 |
| 150 | Ga0209673_1013143 | 3300025273 | Bacteria | 3288 |
| 151 | Ga0209673_1049117 | 3300025273 | Bacteria | 1130 |
| 152 | Ga0209130_1001418 | 3300025284 | Bacteria | 15969 |
| 153 | Ga0209675_1000811 | 3300025291 | Bacteria | 20589 |
| 154 | Ga0209676_1002690 | 3300025292 | Bacteria | 12026 |
| 155 | Ga0209025_1045913 | 3300025294 | Bacteria | 1805 |
| 156 | Ga0209564_1000694 | 3300025295 | Bacteria | 49312 |
| 157 | Ga0209758_1032551 | 3300025297 | Bacteria | 2113 |
| 158 | Ga0209050_1018355 | 3300025298 | Bacteria | 2722 |
| 159 | Ga0209051_1000172 | 3300025303 | Bacteria | 117180 |
| 160 | Ga0209051_1000301 | 3300025303 | Bacteria | 77933 |
| 161 | Ga0209051_1006266 | 3300025303 | Bacteria | 6742 |
| 162 | Ga0209257_1000015 | 3300025304 | Bacteria | 908141 |
| 163 | Ga0209257_1000022 | 3300025304 | Bacteria | 765258 |
| 164 | Ga0209257_1000108 | 3300025304 | Bacteria | 240229 |
| 165 | Ga0209257_1004206 | 3300025304 | Bacteria | 11418 |
| 166 | Ga0207656_10216344 | 3300025321 | Bacteria | 930 |
| 167 | Ga0207682_10003755 | 3300025893 | Bacteria | 6523 |
| 168 | Ga0207642_10001859 | 3300025899 | Bacteria | 6510 |
| 169 | Ga0207642_10081262 | 3300025899 | Bacteria | 1574 |
| 170 | Ga0207680_10018907 | 3300025903 | Bacteria | 3675 |
| 171 | Ga0207680_10054795 | 3300025903 | Bacteria | 2401 |
| 172 | Ga0207645_10002177 | 3300025907 | Bacteria | 15651 |
| 173 | Ga0207645_10045526 | 3300025907 | Bacteria | 2804 |
| 174 | Ga0207662_10009715 | 3300025918 | Bacteria | 5304 |
| 175 | Ga0207662_10054895 | 3300025918 | Bacteria | 2376 |
| 176 | Ga0207657_10451902 | 3300025919 | Bacteria | 1008 |
| 177 | Ga0207681_10001841 | 3300025923 | Bacteria | 13588 |
| 178 | Ga0207681_10290358 | 3300025923 | Bacteria | 1290 |
| 179 | Ga0207650_10050224 | 3300025925 | Bacteria | 3083 |
| 180 | Ga0207650_10076178 | 3300025925 | Bacteria | 2534 |
| 181 | Ga0207650_10286796 | 3300025925 | Bacteria | 1342 |
| 182 | Ga0207650_10422935 | 3300025925 | Bacteria | 1106 |
| 183 | Ga0207650_10487644 | 3300025925 | Bacteria | 1029 |
| 184 | Ga0207659_10008547 | 3300025926 | Bacteria | 6363 |
| 185 | Ga0207659_10027172 | 3300025926 | Bacteria | 3870 |
| 186 | Ga0207659_10134475 | 3300025926 | Bacteria | 1913 |
| 187 | Ga0207644_10007613 | 3300025931 | Bacteria | 7061 |
| 188 | Ga0207644_10010666 | 3300025931 | Bacteria | 6056 |
| 189 | Ga0207690_10230103 | 3300025932 | Bacteria | 1423 |
| 190 | Ga0207706_10001403 | 3300025933 | Bacteria | 24089 |
| 191 | Ga0207686_10697365 | 3300025934 | Bacteria | 807 |
| 192 | Ga0207709_10014788 | 3300025935 | Bacteria | 4315 |
| 193 | Ga0207709_10035320 | 3300025935 | Bacteria | 2954 |
| 194 | Ga0207709_10456792 | 3300025935 | Bacteria | 988 |
| 195 | Ga0207670_10081587 | 3300025936 | Bacteria | 2264 |
| 196 | Ga0207669_10113673 | 3300025937 | Bacteria | 1820 |
| 197 | Ga0207669_10430345 | 3300025937 | Bacteria | 1041 |
| 198 | Ga0207704_10001013 | 3300025938 | Bacteria | 12463 |
| 199 | Ga0207704_10207013 | 3300025938 | Bacteria | 1441 |
| 200 | Ga0207704_10265733 | 3300025938 | Bacteria | 1296 |
| 201 | Ga0207691_10002981 | 3300025940 | Bacteria | 16524 |
| 202 | Ga0207691_10014458 | 3300025940 | Bacteria | 7525 |
| 203 | Ga0207691_10020243 | 3300025940 | Bacteria | 6292 |
| 204 | Ga0207711_10011478 | 3300025941 | Bacteria | 7363 |
| 205 | Ga0207711_10041473 | 3300025941 | Bacteria | 3920 |
| 206 | Ga0207689_10006793 | 3300025942 | Bacteria | 10070 |
| 207 | Ga0207689_10012467 | 3300025942 | Bacteria | 7262 |
| 208 | Ga0207689_10199578 | 3300025942 | Bacteria | 1651 |
| 209 | Ga0207689_10824880 | 3300025942 | Bacteria | 783 |
| 210 | Ga0207679_10258169 | 3300025945 | Bacteria | 1485 |
| 211 | Ga0207651_10042474 | 3300025960 | Bacteria | 3026 |
| 212 | Ga0207651_10094589 | 3300025960 | Bacteria | 2197 |
| 213 | Ga0207712_10001809 | 3300025961 | Bacteria | 14129 |
| 214 | Ga0207712_10145567 | 3300025961 | Bacteria | 1824 |
| 215 | Ga0207668_10021037 | 3300025972 | Bacteria | 4155 |
| 216 | Ga0207668_10042985 | 3300025972 | Bacteria | 3063 |
| 217 | Ga0207640_10421889 | 3300025981 | Bacteria | 1092 |
| 218 | Ga0207658_10002800 | 3300025986 | Bacteria | 12544 |
| 219 | Ga0207658_10052033 | 3300025986 | Bacteria | 3021 |
| 220 | Ga0207677_10002314 | 3300026023 | Bacteria | 10013 |
| 221 | Ga0207677_10431468 | 3300026023 | Bacteria | 1125 |
| 222 | Ga0207703_10007787 | 3300026035 | Bacteria | 8478 |
| 223 | Ga0207703_10017445 | 3300026035 | Bacteria | 5603 |
| 224 | Ga0207639_10798250 | 3300026041 | Bacteria | 879 |
| 225 | Ga0207678_10165419 | 3300026067 | Bacteria | 1889 |
| 226 | Ga0207708_10034069 | 3300026075 | Bacteria | 3872 |
| 227 | Ga0207708_10049066 | 3300026075 | Bacteria | 3214 |
| 228 | Ga0207641_10000726 | 3300026088 | Bacteria | 35364 |
| 229 | Ga0207641_10002775 | 3300026088 | Bacteria | 15958 |
| 230 | Ga0207648_10004174 | 3300026089 | Bacteria | 14931 |
| 231 | Ga0207648_10183764 | 3300026089 | Bacteria | 1851 |
| 232 | Ga0207648_10253908 | 3300026089 | Bacteria | 1568 |
| 233 | Ga0207676_10002749 | 3300026095 | Bacteria | 12513 |
| 234 | Ga0207676_10057145 | 3300026095 | Bacteria | 3071 |
| 235 | Ga0207676_10627761 | 3300026095 | Bacteria | 1035 |
| 236 | Ga0207675_100002646 | 3300026118 | Bacteria | 17684 |
| 237 | Ga0207675_100023489 | 3300026118 | Bacteria | 5735 |
| 238 | Ga0207675_100093216 | 3300026118 | Bacteria | 2833 |
| 239 | Ga0207683_10004205 | 3300026121 | Bacteria | 12444 |
| 240 | Ga0207698_10047208 | 3300026142 | Bacteria | 3260 |
| 241 | Ga0209970_1001359 | 3300027614 | Bacteria | 4269 |
| 242 | Ga0268265_10002862 | 3300028380 | Bacteria | 12685 |
| 243 | Ga0268265_10048182 | 3300028380 | Bacteria | 3197 |
| 244 | Ga0268264_10001098 | 3300028381 | Bacteria | 26710 |
| 245 | Ga0268264_10034183 | 3300028381 | Bacteria | 4180 |
| 246 | Ga0307515_10076790 | 3300028794 | Bacteria | 4423 |
| 247 | Ga0265329_10021615 | 3300031242 | Bacteria | 2160 |
| 248 | Ga0265316_10261127 | 3300031344 | Bacteria | 1270 |
| 249 | Ga0307513_10046191 | 3300031456 | Bacteria | 4752 |
| 250 | Ga0307514_10001361 | 3300031649 | Bacteria | 30951 |
| 251 | Ga0265314_10093951 | 3300031711 | Bacteria | 1945 |
| 252 | Ga0307516_10000705 | 3300031730 | Bacteria | 45448 |
| 253 | Ga0307516_10199113 | 3300031730 | Bacteria | 1723 |
| 254 | Ga0307405_10004807 | 3300031731 | Bacteria | 6443 |
| 255 | Ga0307406_10000278 | 3300031901 | Bacteria | 30154 |
| 256 | Ga0307406_10072805 | 3300031901 | Bacteria | 2257 |
| 257 | Ga0307412_10149785 | 3300031911 | Bacteria | 1720 |
| 258 | Ga0307412_10204469 | 3300031911 | Bacteria | 1502 |
| 259 | Ga0307412_10582376 | 3300031911 | Bacteria | 945 |
| 260 | Ga0307409_100000391 | 3300031995 | Bacteria | 18590 |
| 261 | Ga0307416_100013186 | 3300032002 | Bacteria | 5608 |
| 262 | Ga0307416_101019553 | 3300032002 | Bacteria | 931 |
| 263 | Ga0307414_10455421 | 3300032004 | Bacteria | 1123 |
| 264 | Ga0307411_10069851 | 3300032005 | Bacteria | 2374 |
| 265 | Ga0307415_100000694 | 3300032126 | Bacteria | 14977 |
| 266 | Ga0307415_100003110 | 3300032126 | Bacteria | 8397 |
| 267 | Ga0307510_10262188 | 3300033180 | Bacteria | 1209 |
| 268 | Ga0373944_0162409 | 3300035089 | Bacteria | 793 |
| 269 | Ga0373953_0194424 | 3300035117 | Bacteria | 877 |
| 270 | Ga0373954_0314011 | 3300035118 | Bacteria | 773 |
| 271 | Ga0373943_0076828 | 3300035170 | Bacteria | 1704 |
| 272 | Ga0373946_0021296 | 3300035171 | Bacteria | 2513 |
| 273 | Ga0373955_0015462 | 3300035172 | Bacteria | 3738 |
| 274 | Ga0373924_0059664 | 3300035410 | Bacteria | 1594 |
| 275 | Ga0373931_0110449 | 3300035691 | Bacteria | 1559 |
| 276 | Ga0373935_0030421 | 3300035692 | Bacteria | 3347 |
| 277 | Ga0373947_0070660 | 3300035725 | Bacteria | 2140 |
| 278 | Ga0373937_0120766 | 3300036401 | Bacteria | 2442 |
| 279 | Ga0373925_0082032 | 3300037068 | Bacteria | 2453 |
| 280 | Ga0395900_0179925 | 3300037418 | Bacteria | 2149 |
| 281 | Ga0395900_0843695 | 3300037418 | Bacteria | 842 |
| 282 | Ga0395900_1027789 | 3300037418 | Bacteria | 743 |
| 283 | Ga0395898_0162952 | 3300037466 | Bacteria | 2133 |
| 284 | Ga0395905_0007854 | 3300037471 | Bacteria | 10567 |
| 285 | Ga0395905_0097307 | 3300037471 | Bacteria | 2763 |
| 286 | Ga0395905_0553168 | 3300037471 | Bacteria | 1052 |
| 287 | Ga0395905_0559878 | 3300037471 | Bacteria | 1044 |
| 288 | Ga0395905_0924297 | 3300037471 | Bacteria | 775 |
| 289 | Ga0395901_0206749 | 3300038443 | Bacteria | 2056 |
| 290 | Ga0436365_0842267 | 3300039437 | Bacteria | 1101 |
| 291 | Ga0451789_0663994 | 3300041443 | Bacteria | 13519 |
| 292 | Ga0451793_1260512 | 3300041452 | Bacteria | 1211 |
| 293 | Ga0451797_1118508 | 3300041453 | Bacteria | 1304 |
| 294 | Ga0451795_1506492 | 3300041456 | Bacteria | 3393 |
| 295 | Ga0451798_1067060 | 3300041458 | Bacteria | 10178 |
| 296 | Ga0451800_0848119 | 3300041459 | Bacteria | 3627 |
| 297 | Ga0451849_1039152 | 3300041505 | Bacteria | 925 |
| 298 | Ga0451849_1263844 | 3300041505 | Bacteria | 949 |
| 299 | Ga0451853_1030753 | 3300041512 | Bacteria | 1854 |
| 300 | Ga0451853_2693348 | 3300041512 | Bacteria | 1624 |
| 301 | Ga0439449_0000091 | 3300042007 | Bacteria | 29348 |
| 302 | Ga0439462_0001751 | 3300042015 | Bacteria | 4909 |
| 303 | Ga0450890_010784 | 3300042127 | Bacteria | 1177 |
| 304 | Ga0439446_0032312 | 3300042156 | Bacteria | 1517 |
| 305 | Ga0439434_0029557 | 3300042435 | Bacteria | 1661 |
| 306 | Ga0439464_0025663 | 3300042439 | Bacteria | 1632 |
| 307 | Ga0450893_0034825 | 3300042532 | Bacteria | 907 |
| 308 | Ga0453683_0390977 | 3300044673 | Bacteria | 896 |
| 309 | Ga0466966_0283102 | 3300044684 | Bacteria | 997 |
| 310 | Ga0466961_0115564 | 3300044693 | Bacteria | 1687 |
| 311 | Ga0453684_0000906 | 3300044712 | Bacteria | 98768 |
| 312 | Ga0466970_0305593 | 3300044765 | Bacteria | 898 |
| 313 | Ga0466959_0067268 | 3300045049 | Bacteria | 2598 |
| 314 | Ga0451576_0920862 | 3300045051 | Bacteria | 917 |
| 315 | Ga0451576_0999403 | 3300045051 | Bacteria | 877 |
| 316 | Ga0495580_0681442 | 3300046472 | Bacteria | 674 |
| 317 | Ga0495606_0008109 | 3300046507 | Bacteria | 9210 |
| 318 | Ga0495618_0088064 | 3300046514 | Bacteria | 1986 |
| 319 | Ga0495620_0053718 | 3300046515 | Bacteria | 1705 |
| 320 | Ga0495632_0003721 | 3300046519 | Bacteria | 10683 |
| 321 | Ga0495586_0257632 | 3300046535 | Bacteria | 996 |
| 322 | Ga0495586_0386385 | 3300046535 | Bacteria | 805 |
| 323 | Ga0495587_0283444 | 3300046536 | Bacteria | 928 |
| 324 | Ga0495598_0005609 | 3300046537 | Bacteria | 2792 |
| 325 | Ga0495621_0105409 | 3300046539 | Bacteria | 1077 |
| 326 | Ga0495621_0106588 | 3300046539 | Bacteria | 1071 |
| 327 | Ga0495645_0045798 | 3300046543 | Bacteria | 3191 |
| 328 | Ga0495645_0298890 | 3300046543 | Bacteria | 1052 |
| 329 | Ga0495634_0400845 | 3300046642 | Bacteria | 815 |
| 330 | Ga0495635_0063270 | 3300046663 | Bacteria | 2541 |
| 331 | Ga0495658_0064233 | 3300046683 | Bacteria | 2114 |
| 332 | Ga0495658_0107078 | 3300046683 | Bacteria | 1676 |
| 333 | Ga0495600_0165096 | 3300046809 | Bacteria | 1430 |
| 334 | Ga0495675_0019083 | 3300047444 | Bacteria | 4356 |
| 335 | Ga0495684_0098398 | 3300047471 | Bacteria | 2212 |
| 336 | Ga0495686_0234345 | 3300047472 | Bacteria | 1038 |
| 337 | Ga0495593_0182126 | 3300047673 | Bacteria | 1058 |
| 338 | Ga0495602_0628079 | 3300048088 | Bacteria | 736 |
| 339 | Ga0496102_0620684 | 3300048905 | Bacteria | 1004 |
| 340 | Ga0496105_0237446 | 3300048908 | Bacteria | 1480 |
| 341 | Ga0496108_0012270 | 3300048911 | Bacteria | 6969 |
| 342 | Ga0496109_0044963 | 3300048912 | Bacteria | 4007 |
| 343 | Ga0496109_0120444 | 3300048912 | Bacteria | 2444 |
| 344 | Ga0496109_0972859 | 3300048912 | Bacteria | 786 |
| 345 | Ga0496110_0838796 | 3300048913 | Bacteria | 824 |
| 346 | Ga0496111_0822992 | 3300048914 | Bacteria | 671 |
| 347 | Ga0496114_0063509 | 3300048917 | Bacteria | 3092 |
| 348 | Ga0496121_0083477 | 3300048924 | Bacteria | 2522 |
| 349 | Ga0496125_0011388 | 3300048928 | Bacteria | 8900 |
| 350 | Ga0501031_0312801 | 3300049568 | Bacteria | 1017 |
| 351 | Ga0501034_0050665 | 3300049571 | Bacteria | 4187 |
| 352 | Ga0501036_0268426 | 3300049572 | Bacteria | 1429 |
| 353 | Ga0501037_0064117 | 3300049573 | Bacteria | 2678 |
| 354 | Ga0501039_0804035 | 3300049575 | Bacteria | 733 |
| 355 | Ga0501043_0062972 | 3300049579 | Bacteria | 2913 |
| 356 | Ga0501072_0030966 | 3300049588 | Bacteria | 4186 |
| 357 | Ga0501259_117024 | 3300049688 | Bacteria | 630 |
| 358 | Ga0501044_0725072 | 3300049823 | Bacteria | 878 |
| 359 | nmdc:mga03683_16407_c1 | 3300050489 | Bacteria | 2782 |
| 360 | nmdc:mga03683_324478_c1 | 3300050489 | Bacteria | 725 |
| 361 | nmdc:mga03n38_87504_c1 | 3300050490 | Bacteria | 1477 |
| 362 | nmdc:mga00v17_72957_c1 | 3300050491 | Bacteria | 2131 |
| 363 | nmdc:mga0yw44_39183_c1 | 3300050492 | Bacteria | 2808 |
| 364 | nmdc:mga0yw44_7652_c1 | 3300050492 | Bacteria | 5329 |
| 365 | nmdc:mga0yw44_80754_c1 | 3300050492 | Bacteria | 2038 |
| 366 | nmdc:mga0k408_153216_c1 | 3300050493 | Bacteria | 1373 |
| 367 | nmdc:mga0k408_19795_c1 | 3300050493 | Bacteria | 3765 |
| 368 | nmdc:mga0k408_39442_c1 | 3300050493 | Bacteria | 2713 |
| 369 | nmdc:mga0k408_67642_c1 | 3300050493 | Bacteria | 2082 |
| 370 | nmdc:mga06z11_554606_c1 | 3300050494 | Bacteria | 698 |
| 371 | nmdc:mga04h51_41468_c1 | 3300050495 | Bacteria | 1505 |
| 372 | nmdc:mga07m45_5034_c1 | 3300050496 | Bacteria | 6530 |
| 373 | nmdc:mga07m45_61018_c1 | 3300050496 | Bacteria | 1139 |
| 374 | nmdc:mga07m45_6292_c1 | 3300050496 | Bacteria | 5995 |
| 375 | nmdc:mga0qj67_253090_c1 | 3300050509 | Bacteria | 1429 |
| 376 | nmdc:mga08y16_1279257_c1 | 3300050511 | Bacteria | 701 |
| 377 | nmdc:mga0rr50_768073_c1 | 3300050513 | Bacteria | 822 |
| 378 | Ga0495601_0171559 | 3300053077 | Bacteria | 1418 |
| 379 | Ga0495601_0259220 | 3300053077 | Bacteria | 1135 |
| 380 | Ga0495619_0118984 | 3300053085 | Bacteria | 1810 |
| 381 | Ga0500583_0238840 | 3300053092 | Bacteria | 899 |
| 382 | Ga0500651_0006781 | 3300053093 | Bacteria | 6631 |
| 383 | Ga0500650_0183574 | 3300053098 | Bacteria | 958 |
| 384 | Ga0500607_209647 | 3300053121 | Bacteria | 826 |
| 385 | Ga0500623_116174 | 3300053127 | Bacteria | 1184 |
| 386 | Ga0500642_0000908 | 3300053130 | Bacteria | 8587 |
| 387 | Ga0500652_003229 | 3300053131 | Bacteria | 4928 |
| 388 | Ga0500658_0088895 | 3300053134 | Bacteria | 1333 |
| 389 | Ga0500579_187336 | 3300053143 | Bacteria | 798 |
| 390 | Ga0500622_0001110 | 3300053156 | Bacteria | 22450 |
| 391 | Ga0500570_111189 | 3300053724 | Bacteria | 1111 |
| 392 | Ga0590071_012085 | 3300059421 | Bacteria | 2024 |
| 393 | Ga0590075_008298 | 3300059424 | Bacteria | 2479 |
| 394 | Ga0590077_006366 | 3300059426 | Bacteria | 2420 |
| 395 | Ga0501082_0620950 | 3300060353 | Bacteria | 946 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031730 | Ga0307516_10000705 | Ga0307516_1000070524 | 153 |
| 2 | 3300042439 | Ga0439464_0025663 | Ga0439464_0025663_220_732 | 159 |
| 3 | 3300048914 | Ga0496111_0822992 | Ga0496111_0822992_21_548 | 160 |
| 4 | 3300037471 | Ga0395905_0559878 | Ga0395905_0559878_14_580 | 164 |
| 5 | 3300025297 | Ga0209758_1032551 | Ga0209758_10325512 | 165 |
| 6 | 3300060353 | Ga0501082_0620950 | Ga0501082_0620950_317_817 | 166 |
| 7 | iso_pu_bacteria | 2643221603 | 2644026402 | 166 |
| 8 | iso_pu_bacteria | 2828305725 | 2828310007 | 166 |
| 9 | 3300006038 | Ga0075365_10005634 | Ga0075365_100056343 | 167 |
| 10 | 3300009101 | Ga0105247_10053536 | Ga0105247_100535363 | 167 |
| 11 | 3300009148 | Ga0105243_10192546 | Ga0105243_101925462 | 167 |
| 12 | 3300009177 | Ga0105248_10006219 | Ga0105248_1000621910 | 167 |
| 13 | 3300009545 | Ga0105237_10168192 | Ga0105237_101681922 | 167 |
| 14 | 3300009553 | Ga0105249_10180690 | Ga0105249_101806902 | 167 |
| 15 | 3300013297 | Ga0157378_10010746 | Ga0157378_100107465 | 167 |
| 16 | 3300013306 | Ga0163162_10074309 | Ga0163162_100743094 | 167 |
| 17 | 3300014325 | Ga0163163_10003078 | Ga0163163_100030782 | 167 |
| 18 | 3300014968 | Ga0157379_10021652 | Ga0157379_100216523 | 167 |
| 19 | 3300014968 | Ga0157379_11051693 | Ga0157379_110516932 | 167 |
| 20 | 3300014969 | Ga0157376_10399391 | Ga0157376_103993912 | 167 |
| 21 | 3300048912 | Ga0496109_0120444 | Ga0496109_0120444_762_1310 | 167 |
| 22 | 3300048913 | Ga0496110_0838796 | Ga0496110_0838796_152_700 | 167 |
| 23 | 3300049575 | Ga0501039_0804035 | Ga0501039_0804035_78_581 | 167 |
| 24 | 3300049588 | Ga0501072_0030966 | Ga0501072_0030966_3505_4008 | 167 |
| 25 | iso_pu_bacteria | 2547132374 | 2548497661 | 167 |
| 26 | iso_pu_bacteria | 2643221717 | 2644649596 | 167 |
| 27 | 3300005327 | Ga0070658_10548060 | Ga0070658_105480601 | 168 |
| 28 | 3300005330 | Ga0070690_100005316 | Ga0070690_1000053163 | 168 |
| 29 | 3300005331 | Ga0070670_100234960 | Ga0070670_1002349603 | 168 |
| 30 | 3300005334 | Ga0068869_100004452 | Ga0068869_1000044525 | 168 |
| 31 | 3300005335 | Ga0070666_10015525 | Ga0070666_100155254 | 168 |
| 32 | 3300005338 | Ga0068868_100001845 | Ga0068868_10000184510 | 168 |
| 33 | 3300005340 | Ga0070689_100083075 | Ga0070689_1000830752 | 168 |
| 34 | 3300005354 | Ga0070675_100001536 | Ga0070675_10000153612 | 168 |
| 35 | 3300005355 | Ga0070671_100018132 | Ga0070671_1000181322 | 168 |
| 36 | 3300005364 | Ga0070673_100126047 | Ga0070673_1001260472 | 168 |
| 37 | 3300005456 | Ga0070678_100002045 | Ga0070678_10000204512 | 168 |
| 38 | 3300005539 | Ga0068853_101322113 | Ga0068853_1013221131 | 168 |
| 39 | 3300005548 | Ga0070665_100292020 | Ga0070665_1002920202 | 168 |
| 40 | 3300005578 | Ga0068854_100225143 | Ga0068854_1002251432 | 168 |
| 41 | 3300005617 | Ga0068859_100002482 | Ga0068859_1000024824 | 168 |
| 42 | 3300005618 | Ga0068864_100002261 | Ga0068864_10000226114 | 168 |
| 43 | 3300005719 | Ga0068861_100051481 | Ga0068861_1000514814 | 168 |
| 44 | 3300005841 | Ga0068863_100006103 | Ga0068863_1000061032 | 168 |
| 45 | 3300005842 | Ga0068858_100006727 | Ga0068858_1000067278 | 168 |
| 46 | 3300005843 | Ga0068860_100064627 | Ga0068860_1000646272 | 168 |
| 47 | 3300006237 | Ga0097621_100086102 | Ga0097621_1000861024 | 168 |
| 48 | 3300006358 | Ga0068871_100068926 | Ga0068871_1000689264 | 168 |
| 49 | 3300006881 | Ga0068865_100095930 | Ga0068865_1000959302 | 168 |
| 50 | 3300006931 | Ga0097620_100002482 | Ga0097620_1000024824 | 168 |
| 51 | 3300009148 | Ga0105243_10131582 | Ga0105243_101315823 | 168 |
| 52 | 3300009148 | Ga0105243_10455062 | Ga0105243_104550621 | 168 |
| 53 | 3300009176 | Ga0105242_11142530 | Ga0105242_111425302 | 168 |
| 54 | 3300009177 | Ga0105248_10004752 | Ga0105248_100047522 | 168 |
| 55 | 3300009551 | Ga0105238_10802328 | Ga0105238_108023282 | 168 |
| 56 | 3300009553 | Ga0105249_10285219 | Ga0105249_102852193 | 168 |
| 57 | 3300013296 | Ga0157374_10180500 | Ga0157374_101805003 | 168 |
| 58 | 3300013297 | Ga0157378_10115565 | Ga0157378_101155654 | 168 |
| 59 | 3300013306 | Ga0163162_10023139 | Ga0163162_100231398 | 168 |
| 60 | 3300014325 | Ga0163163_10008006 | Ga0163163_100080069 | 168 |
| 61 | 3300014968 | Ga0157379_10005874 | Ga0157379_100058749 | 168 |
| 62 | 3300025893 | Ga0207682_10003755 | Ga0207682_100037558 | 168 |
| 63 | 3300025899 | Ga0207642_10081262 | Ga0207642_100812622 | 168 |
| 64 | 3300025903 | Ga0207680_10018907 | Ga0207680_100189073 | 168 |
| 65 | 3300025907 | Ga0207645_10045526 | Ga0207645_100455262 | 168 |
| 66 | 3300025923 | Ga0207681_10290358 | Ga0207681_102903582 | 168 |
| 67 | 3300025925 | Ga0207650_10286796 | Ga0207650_102867963 | 168 |
| 68 | 3300025926 | Ga0207659_10134475 | Ga0207659_101344752 | 168 |
| 69 | 3300025931 | Ga0207644_10007613 | Ga0207644_100076132 | 168 |
| 70 | 3300025934 | Ga0207686_10697365 | Ga0207686_106973652 | 168 |
| 71 | 3300025935 | Ga0207709_10456792 | Ga0207709_104567921 | 168 |
| 72 | 3300025936 | Ga0207670_10081587 | Ga0207670_100815873 | 168 |
| 73 | 3300025938 | Ga0207704_10207013 | Ga0207704_102070132 | 168 |
| 74 | 3300025940 | Ga0207691_10020243 | Ga0207691_100202438 | 168 |
| 75 | 3300025942 | Ga0207689_10012467 | Ga0207689_100124677 | 168 |
| 76 | 3300025960 | Ga0207651_10094589 | Ga0207651_100945893 | 168 |
| 77 | 3300025961 | Ga0207712_10145567 | Ga0207712_101455673 | 168 |
| 78 | 3300025972 | Ga0207668_10042985 | Ga0207668_100429852 | 168 |
| 79 | 3300025981 | Ga0207640_10421889 | Ga0207640_104218892 | 168 |
| 80 | 3300026023 | Ga0207677_10002314 | Ga0207677_100023148 | 168 |
| 81 | 3300026035 | Ga0207703_10017445 | Ga0207703_100174452 | 168 |
| 82 | 3300026041 | Ga0207639_10798250 | Ga0207639_107982502 | 168 |
| 83 | 3300026088 | Ga0207641_10002775 | Ga0207641_1000277514 | 168 |
| 84 | 3300026089 | Ga0207648_10183764 | Ga0207648_101837643 | 168 |
| 85 | 3300026089 | Ga0207648_10253908 | Ga0207648_102539083 | 168 |
| 86 | 3300026095 | Ga0207676_10002749 | Ga0207676_100027493 | 168 |
| 87 | 3300026095 | Ga0207676_10627761 | Ga0207676_106277612 | 168 |
| 88 | 3300026118 | Ga0207675_100023489 | Ga0207675_1000234892 | 168 |
| 89 | 3300026121 | Ga0207683_10004205 | Ga0207683_100042059 | 168 |
| 90 | 3300028380 | Ga0268265_10048182 | Ga0268265_100481822 | 168 |
| 91 | 3300031730 | Ga0307516_10199113 | Ga0307516_101991131 | 168 |
| 92 | 3300032002 | Ga0307416_101019553 | Ga0307416_1010195532 | 168 |
| 93 | 3300035089 | Ga0373944_0162409 | Ga0373944_0162409_208_714 | 168 |
| 94 | 3300035171 | Ga0373946_0021296 | Ga0373946_0021296_1306_1812 | 168 |
| 95 | 3300035691 | Ga0373931_0110449 | Ga0373931_0110449_968_1495 | 168 |
| 96 | 3300037471 | Ga0395905_0097307 | Ga0395905_0097307_2018_2530 | 168 |
| 97 | 3300037471 | Ga0395905_0924297 | Ga0395905_0924297_170_679 | 168 |
| 98 | 3300041512 | Ga0451853_1030753 | Ga0451853_1030753_621_1151 | 168 |
| 99 | 3300046472 | Ga0495580_0681442 | Ga0495580_0681442_75_581 | 168 |
| 100 | 3300046537 | Ga0495598_0005609 | Ga0495598_0005609_204_710 | 168 |
| 101 | 3300046539 | Ga0495621_0106588 | Ga0495621_0106588_86_592 | 168 |
| 102 | 3300046683 | Ga0495658_0064233 | Ga0495658_0064233_1451_1957 | 168 |
| 103 | 3300048908 | Ga0496105_0237446 | Ga0496105_0237446_691_1197 | 168 |
| 104 | 3300048911 | Ga0496108_0012270 | Ga0496108_0012270_2452_2958 | 168 |
| 105 | 3300048912 | Ga0496109_0044963 | Ga0496109_0044963_2588_3094 | 168 |
| 106 | 3300048917 | Ga0496114_0063509 | Ga0496114_0063509_252_758 | 168 |
| 107 | 3300050492 | nmdc:mga0yw44_39183_c1 | nmdc:mga0yw44_39183_c1_1134_1718 | 168 |
| 108 | 3300005327 | Ga0070658_10424417 | Ga0070658_104244172 | 169 |
| 109 | 3300005354 | Ga0070675_100083660 | Ga0070675_1000836602 | 169 |
| 110 | 3300005617 | Ga0068859_101599315 | Ga0068859_1015993152 | 169 |
| 111 | 3300006038 | Ga0075365_10025877 | Ga0075365_100258773 | 169 |
| 112 | 3300006177 | Ga0075362_10348433 | Ga0075362_103484331 | 169 |
| 113 | 3300006195 | Ga0075366_10027807 | Ga0075366_100278075 | 169 |
| 114 | 3300006195 | Ga0075366_10536979 | Ga0075366_105369791 | 169 |
| 115 | 3300006353 | Ga0075370_10009589 | Ga0075370_100095894 | 169 |
| 116 | 3300006353 | Ga0075370_10254597 | Ga0075370_102545972 | 169 |
| 117 | 3300006931 | Ga0097620_101599132 | Ga0097620_1015991322 | 169 |
| 118 | 3300025918 | Ga0207662_10054895 | Ga0207662_100548952 | 169 |
| 119 | 3300025925 | Ga0207650_10422935 | Ga0207650_104229352 | 169 |
| 120 | 3300025926 | Ga0207659_10027172 | Ga0207659_100271725 | 169 |
| 121 | 3300025932 | Ga0207690_10230103 | Ga0207690_102301032 | 169 |
| 122 | 3300025937 | Ga0207669_10430345 | Ga0207669_104303452 | 169 |
| 123 | 3300025942 | Ga0207689_10824880 | Ga0207689_108248802 | 169 |
| 124 | 3300031242 | Ga0265329_10021615 | Ga0265329_100216153 | 169 |
| 125 | 3300031344 | Ga0265316_10261127 | Ga0265316_102611272 | 169 |
| 126 | 3300031711 | Ga0265314_10093951 | Ga0265314_100939513 | 169 |
| 127 | 3300031731 | Ga0307405_10004807 | Ga0307405_100048073 | 169 |
| 128 | 3300031901 | Ga0307406_10072805 | Ga0307406_100728052 | 169 |
| 129 | 3300031911 | Ga0307412_10204469 | Ga0307412_102044692 | 169 |
| 130 | 3300031911 | Ga0307412_10582376 | Ga0307412_105823762 | 169 |
| 131 | 3300032004 | Ga0307414_10455421 | Ga0307414_104554212 | 169 |
| 132 | 3300032126 | Ga0307415_100003110 | Ga0307415_1000031105 | 169 |
| 133 | 3300033180 | Ga0307510_10262188 | Ga0307510_102621882 | 169 |
| 134 | 3300036401 | Ga0373937_0120766 | Ga0373937_0120766_1613_2143 | 169 |
| 135 | 3300037418 | Ga0395900_0179925 | Ga0395900_0179925_1462_1992 | 169 |
| 136 | 3300037418 | Ga0395900_1027789 | Ga0395900_1027789_102_683 | 169 |
| 137 | 3300037466 | Ga0395898_0162952 | Ga0395898_0162952_412_993 | 169 |
| 138 | 3300038443 | Ga0395901_0206749 | Ga0395901_0206749_795_1325 | 169 |
| 139 | 3300041505 | Ga0451849_1263844 | Ga0451849_1263844_144_662 | 169 |
| 140 | 3300042007 | Ga0439449_0000091 | Ga0439449_0000091_9149_9697 | 169 |
| 141 | 3300042015 | Ga0439462_0001751 | Ga0439462_0001751_2784_3332 | 169 |
| 142 | 3300042127 | Ga0450890_010784 | Ga0450890_010784_40_579 | 169 |
| 143 | 3300044712 | Ga0453684_0000906 | Ga0453684_0000906_51287_51820 | 169 |
| 144 | 3300048088 | Ga0495602_0628079 | Ga0495602_0628079_67_597 | 169 |
| 145 | 3300048928 | Ga0496125_0011388 | Ga0496125_0011388_703_1251 | 169 |
| 146 | 3300049568 | Ga0501031_0312801 | Ga0501031_0312801_418_927 | 169 |
| 147 | 3300049571 | Ga0501034_0050665 | Ga0501034_0050665_2522_3031 | 169 |
| 148 | 3300049572 | Ga0501036_0268426 | Ga0501036_0268426_452_961 | 169 |
| 149 | 3300049573 | Ga0501037_0064117 | Ga0501037_0064117_1562_2071 | 169 |
| 150 | 3300049579 | Ga0501043_0062972 | Ga0501043_0062972_1587_2096 | 169 |
| 151 | 3300050492 | nmdc:mga0yw44_7652_c1 | nmdc:mga0yw44_7652_c1_817_1350 | 169 |
| 152 | 3300050493 | nmdc:mga0k408_19795_c1 | nmdc:mga0k408_19795_c1_196_711 | 169 |
| 153 | 3300050494 | nmdc:mga06z11_554606_c1 | nmdc:mga06z11_554606_c1_149_664 | 169 |
| 154 | 3300050496 | nmdc:mga07m45_5034_c1 | nmdc:mga07m45_5034_c1_2828_3343 | 169 |
| 155 | 3300050496 | nmdc:mga07m45_61018_c1 | nmdc:mga07m45_61018_c1_206_736 | 169 |
| 156 | 3300050509 | nmdc:mga0qj67_253090_c1 | nmdc:mga0qj67_253090_c1_331_876 | 169 |
| 157 | 3300053077 | Ga0495601_0171559 | Ga0495601_0171559_277_807 | 169 |
| 158 | 3300003794 | Ga0055531_10000281 | Ga0055531_1000028144 | 170 |
| 159 | 3300005334 | Ga0068869_100252864 | Ga0068869_1002528642 | 170 |
| 160 | 3300005335 | Ga0070666_10637476 | Ga0070666_106374761 | 170 |
| 161 | 3300005353 | Ga0070669_100022170 | Ga0070669_1000221705 | 170 |
| 162 | 3300005365 | Ga0070688_100365456 | Ga0070688_1003654561 | 170 |
| 163 | 3300005367 | Ga0070667_100158996 | Ga0070667_1001589962 | 170 |
| 164 | 3300005441 | Ga0070700_100037542 | Ga0070700_1000375424 | 170 |
| 165 | 3300005543 | Ga0070672_100093084 | Ga0070672_1000930842 | 170 |
| 166 | 3300005578 | Ga0068854_100595818 | Ga0068854_1005958182 | 170 |
| 167 | 3300005617 | Ga0068859_100216410 | Ga0068859_1002164102 | 170 |
| 168 | 3300005718 | Ga0068866_10137040 | Ga0068866_101370402 | 170 |
| 169 | 3300005719 | Ga0068861_100037832 | Ga0068861_1000378324 | 170 |
| 170 | 3300006042 | Ga0075368_10002604 | Ga0075368_100026046 | 170 |
| 171 | 3300006048 | Ga0075363_100006903 | Ga0075363_1000069035 | 170 |
| 172 | 3300006051 | Ga0075364_10164132 | Ga0075364_101641321 | 170 |
| 173 | 3300006177 | Ga0075362_10011910 | Ga0075362_100119102 | 170 |
| 174 | 3300006178 | Ga0075367_10010157 | Ga0075367_100101571 | 170 |
| 175 | 3300006195 | Ga0075366_10008595 | Ga0075366_100085953 | 170 |
| 176 | 3300006195 | Ga0075366_10044263 | Ga0075366_100442633 | 170 |
| 177 | 3300006195 | Ga0075366_10077925 | Ga0075366_100779252 | 170 |
| 178 | 3300006237 | Ga0097621_100695020 | Ga0097621_1006950202 | 170 |
| 179 | 3300006353 | Ga0075370_10541087 | Ga0075370_105410871 | 170 |
| 180 | 3300006881 | Ga0068865_100003419 | Ga0068865_1000034193 | 170 |
| 181 | 3300006931 | Ga0097620_100216430 | Ga0097620_1002164302 | 170 |
| 182 | 3300013297 | Ga0157378_10998885 | Ga0157378_109988852 | 170 |
| 183 | 3300025273 | Ga0209673_1005024 | Ga0209673_10050246 | 170 |
| 184 | 3300025303 | Ga0209051_1000172 | Ga0209051_100017298 | 170 |
| 185 | 3300025304 | Ga0209257_1000015 | Ga0209257_1000015489 | 170 |
| 186 | 3300025304 | Ga0209257_1000108 | Ga0209257_1000108221 | 170 |
| 187 | 3300025925 | Ga0207650_10050224 | Ga0207650_100502243 | 170 |
| 188 | 3300025935 | Ga0207709_10014788 | Ga0207709_100147884 | 170 |
| 189 | 3300025940 | Ga0207691_10014458 | Ga0207691_100144585 | 170 |
| 190 | 3300025942 | Ga0207689_10199578 | Ga0207689_101995782 | 170 |
| 191 | 3300025986 | Ga0207658_10052033 | Ga0207658_100520332 | 170 |
| 192 | 3300026075 | Ga0207708_10034069 | Ga0207708_100340692 | 170 |
| 193 | 3300026118 | Ga0207675_100093216 | Ga0207675_1000932162 | 170 |
| 194 | 3300027614 | Ga0209970_1001359 | Ga0209970_10013595 | 170 |
| 195 | 3300028381 | Ga0268264_10034183 | Ga0268264_100341832 | 170 |
| 196 | 3300031456 | Ga0307513_10046191 | Ga0307513_100461913 | 170 |
| 197 | 3300031649 | Ga0307514_10001361 | Ga0307514_1000136119 | 170 |
| 198 | 3300035117 | Ga0373953_0194424 | Ga0373953_0194424_299_844 | 170 |
| 199 | 3300035118 | Ga0373954_0314011 | Ga0373954_0314011_56_601 | 170 |
| 200 | 3300035170 | Ga0373943_0076828 | Ga0373943_0076828_58_603 | 170 |
| 201 | 3300035172 | Ga0373955_0015462 | Ga0373955_0015462_2553_3098 | 170 |
| 202 | 3300035410 | Ga0373924_0059664 | Ga0373924_0059664_84_629 | 170 |
| 203 | 3300035692 | Ga0373935_0030421 | Ga0373935_0030421_1394_1939 | 170 |
| 204 | 3300035725 | Ga0373947_0070660 | Ga0373947_0070660_1473_2018 | 170 |
| 205 | 3300037068 | Ga0373925_0082032 | Ga0373925_0082032_1521_2066 | 170 |
| 206 | 3300037418 | Ga0395900_0843695 | Ga0395900_0843695_172_756 | 170 |
| 207 | 3300037471 | Ga0395905_0007854 | Ga0395905_0007854_9746_10330 | 170 |
| 208 | 3300037471 | Ga0395905_0553168 | Ga0395905_0553168_142_711 | 170 |
| 209 | 3300042156 | Ga0439446_0032312 | Ga0439446_0032312_583_1128 | 170 |
| 210 | 3300042435 | Ga0439434_0029557 | Ga0439434_0029557_230_775 | 170 |
| 211 | 3300042532 | Ga0450893_0034825 | Ga0450893_0034825_219_764 | 170 |
| 212 | 3300044684 | Ga0466966_0283102 | Ga0466966_0283102_255_806 | 170 |
| 213 | 3300044693 | Ga0466961_0115564 | Ga0466961_0115564_823_1368 | 170 |
| 214 | 3300044765 | Ga0466970_0305593 | Ga0466970_0305593_282_833 | 170 |
| 215 | 3300045049 | Ga0466959_0067268 | Ga0466959_0067268_1113_1664 | 170 |
| 216 | 3300045051 | Ga0451576_0920862 | Ga0451576_0920862_281_832 | 170 |
| 217 | 3300046514 | Ga0495618_0088064 | Ga0495618_0088064_707_1252 | 170 |
| 218 | 3300046535 | Ga0495586_0257632 | Ga0495586_0257632_333_878 | 170 |
| 219 | 3300046535 | Ga0495586_0386385 | Ga0495586_0386385_148_732 | 170 |
| 220 | 3300046536 | Ga0495587_0283444 | Ga0495587_0283444_49_594 | 170 |
| 221 | 3300046543 | Ga0495645_0045798 | Ga0495645_0045798_2455_3000 | 170 |
| 222 | 3300046543 | Ga0495645_0298890 | Ga0495645_0298890_35_580 | 170 |
| 223 | 3300046663 | Ga0495635_0063270 | Ga0495635_0063270_1124_1669 | 170 |
| 224 | 3300046683 | Ga0495658_0107078 | Ga0495658_0107078_400_945 | 170 |
| 225 | 3300046809 | Ga0495600_0165096 | Ga0495600_0165096_193_738 | 170 |
| 226 | 3300047444 | Ga0495675_0019083 | Ga0495675_0019083_406_951 | 170 |
| 227 | 3300047471 | Ga0495684_0098398 | Ga0495684_0098398_176_721 | 170 |
| 228 | 3300047472 | Ga0495686_0234345 | Ga0495686_0234345_94_630 | 170 |
| 229 | 3300047673 | Ga0495593_0182126 | Ga0495593_0182126_226_771 | 170 |
| 230 | 3300049823 | Ga0501044_0725072 | Ga0501044_0725072_93_644 | 170 |
| 231 | 3300050489 | nmdc:mga03683_16407_c1 | nmdc:mga03683_16407_c1_1738_2325 | 170 |
| 232 | 3300050490 | nmdc:mga03n38_87504_c1 | nmdc:mga03n38_87504_c1_567_1154 | 170 |
| 233 | 3300050491 | nmdc:mga00v17_72957_c1 | nmdc:mga00v17_72957_c1_969_1556 | 170 |
| 234 | 3300050492 | nmdc:mga0yw44_80754_c1 | nmdc:mga0yw44_80754_c1_1013_1600 | 170 |
| 235 | 3300050493 | nmdc:mga0k408_153216_c1 | nmdc:mga0k408_153216_c1_292_876 | 170 |
| 236 | 3300050493 | nmdc:mga0k408_67642_c1 | nmdc:mga0k408_67642_c1_1042_1632 | 170 |
| 237 | 3300050495 | nmdc:mga04h51_41468_c1 | nmdc:mga04h51_41468_c1_761_1348 | 170 |
| 238 | 3300050496 | nmdc:mga07m45_6292_c1 | nmdc:mga07m45_6292_c1_4241_4828 | 170 |
| 239 | 3300050513 | nmdc:mga0rr50_768073_c1 | nmdc:mga0rr50_768073_c1_292_804 | 170 |
| 240 | 3300053077 | Ga0495601_0259220 | Ga0495601_0259220_289_834 | 170 |
| 241 | 3300053085 | Ga0495619_0118984 | Ga0495619_0118984_116_661 | 170 |
| 242 | 3300053121 | Ga0500607_209647 | Ga0500607_209647_53_577 | 170 |
| 243 | iso_pu_bacteria | 2643221609 | 2644058236 | 170 |
| 244 | iso_pu_bacteria | 2643221611 | 2644073289 | 170 |
| 245 | iso_pu_bacteria | 2643221717 | 2644647015 | 170 |
| 246 | iso_pu_bacteria | 2738543012 | 2739244423 | 170 |
| 247 | iso_pu_bacteria | 2816332133 | 2816469854 | 170 |
| 248 | iso_pu_bacteria | 2990710928 | 2990715123 | 170 |
| 249 | 3300003771 | Ga0055526_1000223 | Ga0055526_100022343 | 171 |
| 250 | 3300003784 | Ga0055534_1000530 | Ga0055534_10005309 | 171 |
| 251 | 3300003794 | Ga0055531_10036086 | Ga0055531_100360862 | 171 |
| 252 | 3300005262 | Ga0065165_1027648 | Ga0065165_10276483 | 171 |
| 253 | 3300005330 | Ga0070690_100005945 | Ga0070690_1000059452 | 171 |
| 254 | 3300005331 | Ga0070670_100114694 | Ga0070670_1001146942 | 171 |
| 255 | 3300005333 | Ga0070677_10003525 | Ga0070677_100035257 | 171 |
| 256 | 3300005334 | Ga0068869_100020317 | Ga0068869_1000203172 | 171 |
| 257 | 3300005335 | Ga0070666_10003673 | Ga0070666_100036737 | 171 |
| 258 | 3300005339 | Ga0070660_100520178 | Ga0070660_1005201782 | 171 |
| 259 | 3300005343 | Ga0070687_100044388 | Ga0070687_1000443882 | 171 |
| 260 | 3300005347 | Ga0070668_100002035 | Ga0070668_10000203511 | 171 |
| 261 | 3300005353 | Ga0070669_100000367 | Ga0070669_10000036723 | 171 |
| 262 | 3300005354 | Ga0070675_100018070 | Ga0070675_1000180708 | 171 |
| 263 | 3300005355 | Ga0070671_100012515 | Ga0070671_1000125157 | 171 |
| 264 | 3300005356 | Ga0070674_100000914 | Ga0070674_1000009145 | 171 |
| 265 | 3300005364 | Ga0070673_100109086 | Ga0070673_1001090862 | 171 |
| 266 | 3300005364 | Ga0070673_101160419 | Ga0070673_1011604191 | 171 |
| 267 | 3300005367 | Ga0070667_100001366 | Ga0070667_10000136615 | 171 |
| 268 | 3300005438 | Ga0070701_10083819 | Ga0070701_100838192 | 171 |
| 269 | 3300005456 | Ga0070678_100006589 | Ga0070678_1000065892 | 171 |
| 270 | 3300005457 | Ga0070662_100004024 | Ga0070662_10000402411 | 171 |
| 271 | 3300005457 | Ga0070662_100893163 | Ga0070662_1008931631 | 171 |
| 272 | 3300005459 | Ga0068867_100001126 | Ga0068867_1000011269 | 171 |
| 273 | 3300005543 | Ga0070672_100064753 | Ga0070672_1000647532 | 171 |
| 274 | 3300005544 | Ga0070686_100257213 | Ga0070686_1002572132 | 171 |
| 275 | 3300005564 | Ga0070664_100290525 | Ga0070664_1002905252 | 171 |
| 276 | 3300005616 | Ga0068852_100220495 | Ga0068852_1002204952 | 171 |
| 277 | 3300005617 | Ga0068859_100029448 | Ga0068859_1000294485 | 171 |
| 278 | 3300005618 | Ga0068864_100057316 | Ga0068864_1000573162 | 171 |
| 279 | 3300005718 | Ga0068866_10002754 | Ga0068866_100027542 | 171 |
| 280 | 3300005719 | Ga0068861_100001059 | Ga0068861_1000010599 | 171 |
| 281 | 3300005834 | Ga0068851_10131764 | Ga0068851_101317642 | 171 |
| 282 | 3300005841 | Ga0068863_100000556 | Ga0068863_10000055622 | 171 |
| 283 | 3300005841 | Ga0068863_100289525 | Ga0068863_1002895252 | 171 |
| 284 | 3300005842 | Ga0068858_100005250 | Ga0068858_1000052507 | 171 |
| 285 | 3300005843 | Ga0068860_100018085 | Ga0068860_1000180857 | 171 |
| 286 | 3300005843 | Ga0068860_101689737 | Ga0068860_1016897371 | 171 |
| 287 | 3300005844 | Ga0068862_100006583 | Ga0068862_10000658312 | 171 |
| 288 | 3300006358 | Ga0068871_100404808 | Ga0068871_1004048083 | 171 |
| 289 | 3300006881 | Ga0068865_100003603 | Ga0068865_10000360312 | 171 |
| 290 | 3300006931 | Ga0097620_100029448 | Ga0097620_1000294485 | 171 |
| 291 | 3300009094 | Ga0111539_10474776 | Ga0111539_104747762 | 171 |
| 292 | 3300009098 | Ga0105245_10023471 | Ga0105245_100234716 | 171 |
| 293 | 3300009148 | Ga0105243_10001350 | Ga0105243_100013508 | 171 |
| 294 | 3300009177 | Ga0105248_10016122 | Ga0105248_100161228 | 171 |
| 295 | 3300009177 | Ga0105248_10121723 | Ga0105248_101217233 | 171 |
| 296 | 3300009177 | Ga0105248_10359640 | Ga0105248_103596404 | 171 |
| 297 | 3300009553 | Ga0105249_10001023 | Ga0105249_1000102315 | 171 |
| 298 | 3300011119 | Ga0105246_11834605 | Ga0105246_118346051 | 171 |
| 299 | 3300013105 | Ga0157369_10022086 | Ga0157369_100220867 | 171 |
| 300 | 3300013297 | Ga0157378_10001679 | Ga0157378_100016795 | 171 |
| 301 | 3300013297 | Ga0157378_10856488 | Ga0157378_108564882 | 171 |
| 302 | 3300013306 | Ga0163162_10000847 | Ga0163162_1000084717 | 171 |
| 303 | 3300013306 | Ga0163162_10001712 | Ga0163162_1000171212 | 171 |
| 304 | 3300013308 | Ga0157375_10002808 | Ga0157375_100028086 | 171 |
| 305 | 3300013308 | Ga0157375_10109007 | Ga0157375_101090073 | 171 |
| 306 | 3300014325 | Ga0163163_10413539 | Ga0163163_104135392 | 171 |
| 307 | 3300014326 | Ga0157380_10002813 | Ga0157380_1000281311 | 171 |
| 308 | 3300014326 | Ga0157380_10058691 | Ga0157380_100586912 | 171 |
| 309 | 3300014968 | Ga0157379_10119072 | Ga0157379_101190724 | 171 |
| 310 | 3300014968 | Ga0157379_10138734 | Ga0157379_101387342 | 171 |
| 311 | 3300014968 | Ga0157379_10213375 | Ga0157379_102133752 | 171 |
| 312 | 3300014969 | Ga0157376_10546920 | Ga0157376_105469202 | 171 |
| 313 | 3300014969 | Ga0157376_11270519 | Ga0157376_112705192 | 171 |
| 314 | 3300017792 | Ga0163161_10001420 | Ga0163161_1000142010 | 171 |
| 315 | 3300025273 | Ga0209673_1013143 | Ga0209673_10131431 | 171 |
| 316 | 3300025273 | Ga0209673_1049117 | Ga0209673_10491172 | 171 |
| 317 | 3300025284 | Ga0209130_1001418 | Ga0209130_10014185 | 171 |
| 318 | 3300025291 | Ga0209675_1000811 | Ga0209675_100081111 | 171 |
| 319 | 3300025292 | Ga0209676_1002690 | Ga0209676_10026906 | 171 |
| 320 | 3300025294 | Ga0209025_1045913 | Ga0209025_10459132 | 171 |
| 321 | 3300025295 | Ga0209564_1000694 | Ga0209564_100069444 | 171 |
| 322 | 3300025298 | Ga0209050_1018355 | Ga0209050_10183552 | 171 |
| 323 | 3300025303 | Ga0209051_1000301 | Ga0209051_100030151 | 171 |
| 324 | 3300025303 | Ga0209051_1006266 | Ga0209051_10062666 | 171 |
| 325 | 3300025304 | Ga0209257_1000022 | Ga0209257_1000022556 | 171 |
| 326 | 3300025304 | Ga0209257_1004206 | Ga0209257_100420612 | 171 |
| 327 | 3300025321 | Ga0207656_10216344 | Ga0207656_102163442 | 171 |
| 328 | 3300025899 | Ga0207642_10001859 | Ga0207642_100018592 | 171 |
| 329 | 3300025903 | Ga0207680_10054795 | Ga0207680_100547952 | 171 |
| 330 | 3300025907 | Ga0207645_10002177 | Ga0207645_100021775 | 171 |
| 331 | 3300025918 | Ga0207662_10009715 | Ga0207662_100097152 | 171 |
| 332 | 3300025919 | Ga0207657_10451902 | Ga0207657_104519022 | 171 |
| 333 | 3300025923 | Ga0207681_10001841 | Ga0207681_100018414 | 171 |
| 334 | 3300025925 | Ga0207650_10076178 | Ga0207650_100761782 | 171 |
| 335 | 3300025925 | Ga0207650_10487644 | Ga0207650_104876442 | 171 |
| 336 | 3300025926 | Ga0207659_10008547 | Ga0207659_100085477 | 171 |
| 337 | 3300025931 | Ga0207644_10010666 | Ga0207644_100106663 | 171 |
| 338 | 3300025933 | Ga0207706_10001403 | Ga0207706_1000140312 | 171 |
| 339 | 3300025935 | Ga0207709_10035320 | Ga0207709_100353202 | 171 |
| 340 | 3300025937 | Ga0207669_10113673 | Ga0207669_101136732 | 171 |
| 341 | 3300025938 | Ga0207704_10001013 | Ga0207704_1000101310 | 171 |
| 342 | 3300025938 | Ga0207704_10265733 | Ga0207704_102657331 | 171 |
| 343 | 3300025940 | Ga0207691_10002981 | Ga0207691_1000298110 | 171 |
| 344 | 3300025941 | Ga0207711_10011478 | Ga0207711_100114788 | 171 |
| 345 | 3300025941 | Ga0207711_10041473 | Ga0207711_100414733 | 171 |
| 346 | 3300025942 | Ga0207689_10006793 | Ga0207689_100067932 | 171 |
| 347 | 3300025945 | Ga0207679_10258169 | Ga0207679_102581692 | 171 |
| 348 | 3300025960 | Ga0207651_10042474 | Ga0207651_100424742 | 171 |
| 349 | 3300025961 | Ga0207712_10001809 | Ga0207712_100018093 | 171 |
| 350 | 3300025972 | Ga0207668_10021037 | Ga0207668_100210372 | 171 |
| 351 | 3300025986 | Ga0207658_10002800 | Ga0207658_1000280010 | 171 |
| 352 | 3300026023 | Ga0207677_10431468 | Ga0207677_104314682 | 171 |
| 353 | 3300026035 | Ga0207703_10007787 | Ga0207703_100077872 | 171 |
| 354 | 3300026067 | Ga0207678_10165419 | Ga0207678_101654192 | 171 |
| 355 | 3300026075 | Ga0207708_10049066 | Ga0207708_100490662 | 171 |
| 356 | 3300026088 | Ga0207641_10000726 | Ga0207641_1000072628 | 171 |
| 357 | 3300026089 | Ga0207648_10004174 | Ga0207648_100041748 | 171 |
| 358 | 3300026095 | Ga0207676_10057145 | Ga0207676_100571452 | 171 |
| 359 | 3300026118 | Ga0207675_100002646 | Ga0207675_10000264611 | 171 |
| 360 | 3300026142 | Ga0207698_10047208 | Ga0207698_100472082 | 171 |
| 361 | 3300028380 | Ga0268265_10002862 | Ga0268265_100028627 | 171 |
| 362 | 3300028381 | Ga0268264_10001098 | Ga0268264_1000109817 | 171 |
| 363 | 3300028794 | Ga0307515_10076790 | Ga0307515_100767904 | 171 |
| 364 | 3300031901 | Ga0307406_10000278 | Ga0307406_1000027822 | 171 |
| 365 | 3300031911 | Ga0307412_10149785 | Ga0307412_101497852 | 171 |
| 366 | 3300031995 | Ga0307409_100000391 | Ga0307409_1000003917 | 171 |
| 367 | 3300032002 | Ga0307416_100013186 | Ga0307416_1000131864 | 171 |
| 368 | 3300032005 | Ga0307411_10069851 | Ga0307411_100698512 | 171 |
| 369 | 3300032126 | Ga0307415_100000694 | Ga0307415_1000006948 | 171 |
| 370 | 3300039437 | Ga0436365_0842267 | Ga0436365_0842267_253_798 | 171 |
| 371 | 3300041443 | Ga0451789_0663994 | Ga0451789_0663994_7578_8183 | 171 |
| 372 | 3300041452 | Ga0451793_1260512 | Ga0451793_1260512_472_1077 | 171 |
| 373 | 3300041453 | Ga0451797_1118508 | Ga0451797_1118508_24_629 | 171 |
| 374 | 3300041456 | Ga0451795_1506492 | Ga0451795_1506492_30_635 | 171 |
| 375 | 3300041458 | Ga0451798_1067060 | Ga0451798_1067060_5242_5847 | 171 |
| 376 | 3300041459 | Ga0451800_0848119 | Ga0451800_0848119_2389_2994 | 171 |
| 377 | 3300041505 | Ga0451849_1039152 | Ga0451849_1039152_80_685 | 171 |
| 378 | 3300041512 | Ga0451853_2693348 | Ga0451853_2693348_110_724 | 171 |
| 379 | 3300044673 | Ga0453683_0390977 | Ga0453683_0390977_139_678 | 171 |
| 380 | 3300045051 | Ga0451576_0999403 | Ga0451576_0999403_170_709 | 171 |
| 381 | 3300046507 | Ga0495606_0008109 | Ga0495606_0008109_1748_2263 | 171 |
| 382 | 3300046515 | Ga0495620_0053718 | Ga0495620_0053718_561_1166 | 171 |
| 383 | 3300046519 | Ga0495632_0003721 | Ga0495632_0003721_9678_10283 | 171 |
| 384 | 3300046539 | Ga0495621_0105409 | Ga0495621_0105409_206_733 | 171 |
| 385 | 3300046642 | Ga0495634_0400845 | Ga0495634_0400845_154_702 | 171 |
| 386 | 3300048905 | Ga0496102_0620684 | Ga0496102_0620684_99_644 | 171 |
| 387 | 3300048912 | Ga0496109_0972859 | Ga0496109_0972859_208_759 | 171 |
| 388 | 3300048924 | Ga0496121_0083477 | Ga0496121_0083477_1221_1742 | 171 |
| 389 | 3300049688 | Ga0501259_117024 | Ga0501259_117024_18_563 | 171 |
| 390 | 3300050489 | nmdc:mga03683_324478_c1 | nmdc:mga03683_324478_c1_123_662 | 171 |
| 391 | 3300050493 | nmdc:mga0k408_39442_c1 | nmdc:mga0k408_39442_c1_1818_2426 | 171 |
| 392 | 3300050511 | nmdc:mga08y16_1279257_c1 | nmdc:mga08y16_1279257_c1_120_665 | 171 |
| 393 | 3300053092 | Ga0500583_0238840 | Ga0500583_0238840_128_733 | 171 |
| 394 | 3300053093 | Ga0500651_0006781 | Ga0500651_0006781_3840_4445 | 171 |
| 395 | 3300053098 | Ga0500650_0183574 | Ga0500650_0183574_106_711 | 171 |
| 396 | 3300053127 | Ga0500623_116174 | Ga0500623_116174_410_1015 | 171 |
| 397 | 3300053130 | Ga0500642_0000908 | Ga0500642_0000908_146_751 | 171 |
| 398 | 3300053131 | Ga0500652_003229 | Ga0500652_003229_288_893 | 171 |
| 399 | 3300053134 | Ga0500658_0088895 | Ga0500658_0088895_572_1177 | 171 |
| 400 | 3300053143 | Ga0500579_187336 | Ga0500579_187336_30_635 | 171 |
| 401 | 3300053156 | Ga0500622_0001110 | Ga0500622_0001110_17816_18421 | 171 |
| 402 | 3300053724 | Ga0500570_111189 | Ga0500570_111189_98_703 | 171 |
| 403 | 3300059421 | Ga0590071_012085 | Ga0590071_012085_957_1574 | 171 |
| 404 | 3300059424 | Ga0590075_008298 | Ga0590075_008298_1586_2203 | 171 |
| 405 | 3300059426 | Ga0590077_006366 | Ga0590077_006366_1474_2043 | 171 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7qha-assembly1.cif.gz_A | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol | 0.8965 | 1 | 154 |
| 7qha-assembly1.cif.gz_A | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol | 0.8802 | 1 | 154 |
| 8thj-assembly1.cif.gz_B | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) | 0.7918 | 11 | 168 |
| 8thj-assembly1.cif.gz_B | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) | 0.732 | 11 | 168 |
| 3jcf-assembly1.cif.gz_A | cryo-em structure of the magnesium channel cora in the closed symmetric magnesium-bound state | 0.4893 | 35 | 168 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P37674_16_146_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.9572 | 27 | 153 | 1.20.120.550 |
| af_P37674_16_146_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.9222 | 27 | 153 | 1.20.120.550 |
| af_A0A2R8S075_1_113_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.6441 | 54 | 171 | 1.20.1070.10 |
| 1ow7A02 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases | 0.6308 | 63 | 154 | 1.20.120.330 |
| af_A0A2R8S075_1_113_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.6235 | 54 | 171 | 1.20.1070.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7T6YGE6-F1-model_v4 | deleted | 0.9867 | 2 | 148 |
|
| AF-A0A0P7CW95-F1-model_v4 | TRAP transporter small permease protein | 0.9859 | 3 | 148 |
GO:0005886
GO:0015740 GO:0022857 |
| AF-A0A3T0K5X0-F1-model_v4 | deleted | 0.9855 | 2 | 148 |
|
| AF-A0A558HQK4-F1-model_v4 | TRAP transporter small permease protein | 0.9847 | 4 | 148 |
GO:0005886
GO:0015740 GO:0022857 |
| AF-A0A8A7CUE7-F1-model_v4 | deleted | 0.9807 | 7 | 154 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar