F436063

General Info

Members Datasets Scaffolds Average Seq Length
405 192 810 204

Family's Representative Sequence

Representative Sequence 3300049585|Ga0501069_0288810|Ga0501069_0288810_165_851
Length 228
Sequence MAGDSSPTHEPLDDDAKAMKSKSFVRMFVLVILGLVGIGLLTGAYIVTMGVSARPQPSQVEAITARTLRSIAIRARVGGITNPVPASDAVVKEGMEHFADHCAVCHGNDGSGDTEMGRGLYPRAPDMRLAATQDLSDAELFYIIENGVRLTGMPAWSTGTKEGETSSWHLVHFIRHLPKLSEEEVALMESLNPKPPEEVRQEIEAEKFLQGGDPEPPSADTHQHTGAH

Samples

Sample ID Description Type Environment
1 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
142 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
143 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
144 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
145 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
146 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
149 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
150 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
155 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
156 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
157 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
158 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
159 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
160 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
161 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
162 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
163 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
164 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
165 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
166 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
176 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
177 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
178 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
179 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
180 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
183 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
190 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
191 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
192 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 0.99
Rhizosphere 98.77
Stem 0
Stem Tuber 0
Unclassified 30.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501069_0288810 3300049585 Unclassified 961
2 MRS1b_contig_5129809 2162886011 Unclassified 1058
3 MBSR1b_contig_3893122 2162886012 Unclassified 931
4 JGI24746J21847_1004842 3300001977 Unclassified 2112
5 Ga0065704_10076534 3300005289 Bacteria 5084
6 Ga0065712_10090755 3300005290 Bacteria 2404
7 Ga0065715_10055837 3300005293 Bacteria 732
8 Ga0065715_10217733 3300005293 Unclassified 1285
9 Ga0065707_10006354 3300005295 Unclassified 2809
10 Ga0065707_10152188 3300005295 Unclassified 1646
11 Ga0065707_10206849 3300005295 Bacteria 1284
12 Ga0070658_10436489 3300005327 Unclassified 1127
13 Ga0070676_10008142 3300005328 Bacteria 5639
14 Ga0070676_10124781 3300005328 Unclassified 1621
15 Ga0070683_100199886 3300005329 Bacteria 1898
16 Ga0070690_100024985 3300005330 Bacteria 3678
17 Ga0070670_100010375 3300005331 Bacteria 7950
18 Ga0070670_100219391 3300005331 Unclassified 1654
19 Ga0070670_100427086 3300005331 Unclassified 1172
20 Ga0070677_10047948 3300005333 Archaea 1714
21 Ga0070677_10076419 3300005333 Bacteria 1422
22 Ga0070677_10187063 3300005333 Unclassified 990
23 Ga0068869_100501445 3300005334 Unclassified 1013
24 Ga0070666_10058719 3300005335 Bacteria 2602
25 Ga0070680_100106097 3300005336 Bacteria 2336
26 Ga0070680_100330008 3300005336 Unclassified 1296
27 Ga0068868_100283022 3300005338 Unclassified 1404
28 Ga0068868_100420246 3300005338 Bacteria 1157
29 Ga0070689_100002196 3300005340 Bacteria 12653
30 Ga0070689_100047187 3300005340 Bacteria 3321
31 Ga0070689_100087625 3300005340 Bacteria 2449
32 Ga0070689_100405437 3300005340 Bacteria 1153
33 Ga0070691_10019399 3300005341 Bacteria 3138
34 Ga0070691_10112799 3300005341 Bacteria 1362
35 Ga0070687_100007265 3300005343 Bacteria 4605
36 Ga0070661_100110079 3300005344 Bacteria 2056
37 Ga0070661_100457993 3300005344 Unclassified 1016
38 Ga0070692_10020427 3300005345 Bacteria 3212
39 Ga0070669_100004739 3300005353 Bacteria 9807
40 Ga0070669_100064810 3300005353 Bacteria 2691
41 Ga0070669_100124317 3300005353 Unclassified 1972
42 Ga0070675_100000976 3300005354 Bacteria 20455
43 Ga0070675_100007988 3300005354 Bacteria 8199
44 Ga0070675_100013705 3300005354 Bacteria 6380
45 Ga0070675_100117568 3300005354 Bacteria 2256
46 Ga0070675_100128797 3300005354 Bacteria 2155
47 Ga0070675_100129061 3300005354 Bacteria 2153
48 Ga0070675_100245185 3300005354 Unclassified 1566
49 Ga0070671_100062116 3300005355 Bacteria 3111
50 Ga0070671_100177737 3300005355 Bacteria 1801
51 Ga0070671_100213665 3300005355 Bacteria 1636
52 Ga0070671_100289603 3300005355 Unclassified 1394
53 Ga0070673_100070864 3300005364 Archaea 2799
54 Ga0070673_100090045 3300005364 Unclassified 2506
55 Ga0070673_100160344 3300005364 Unclassified 1912
56 Ga0070673_100213882 3300005364 Archaea 1666
57 Ga0070673_100395021 3300005364 Bacteria 1235
58 Ga0070673_100603307 3300005364 Unclassified 1001
59 Ga0070688_100022735 3300005365 Bacteria 3679
60 Ga0070688_100686851 3300005365 Unclassified 791
61 Ga0070659_100121264 3300005366 Bacteria 2118
62 Ga0070659_100772483 3300005366 Unclassified 834
63 Ga0070667_100005800 3300005367 Bacteria 10305
64 Ga0070667_100355071 3300005367 Unclassified 1328
65 Ga0070667_100400861 3300005367 Archaea 1249
66 Ga0070667_100604615 3300005367 Unclassified 1010
67 Ga0070701_10003961 3300005438 Bacteria 5927
68 Ga0070701_10104670 3300005438 Bacteria 1572
69 Ga0070701_10353490 3300005438 Unclassified 918
70 Ga0070705_100001293 3300005440 Bacteria 13425
71 Ga0070705_100007041 3300005440 Bacteria 5528
72 Ga0070705_100149469 3300005440 Bacteria 1548
73 Ga0070700_100021968 3300005441 Bacteria 3715
74 Ga0070700_100307420 3300005441 Bacteria 1160
75 Ga0070694_100000713 3300005444 Bacteria 18507
76 Ga0070694_100031771 3300005444 Unclassified 3463
77 Ga0070694_100056736 3300005444 Bacteria 2661
78 Ga0070708_100050719 3300005445 Bacteria 3675
79 Ga0070708_100636648 3300005445 Unclassified 1005
80 Ga0070678_100675876 3300005456 Bacteria 928
81 Ga0070662_100065655 3300005457 Bacteria 2660
82 Ga0070681_10275141 3300005458 Unclassified 1595
83 Ga0068867_100002931 3300005459 Bacteria 12022
84 Ga0068867_100222573 3300005459 Unclassified 1522
85 Ga0070685_10007602 3300005466 Bacteria 5544
86 Ga0070685_10103180 3300005466 Bacteria 1744
87 Ga0070685_10375956 3300005466 Bacteria 978
88 Ga0070707_100010385 3300005468 Bacteria 8670
89 Ga0070707_100132856 3300005468 Bacteria 2421
90 Ga0070698_100006574 3300005471 Bacteria 12608
91 Ga0070698_100011660 3300005471 Bacteria 9322
92 Ga0070698_100670911 3300005471 Unclassified 978
93 Ga0070699_100000339 3300005518 Bacteria 45340
94 Ga0070699_100047806 3300005518 Unclassified 3702
95 Ga0070679_100306734 3300005530 Bacteria 1538
96 Ga0070684_100442723 3300005535 Bacteria 1200
97 Ga0070697_100189190 3300005536 Bacteria 1747
98 Ga0070697_100302866 3300005536 Unclassified 1374
99 Ga0070672_100110663 3300005543 Bacteria 2238
100 Ga0070672_100584751 3300005543 Unclassified 971
101 Ga0070686_100219367 3300005544 Unclassified 1373
102 Ga0070686_100249587 3300005544 Bacteria 1295
103 Ga0070695_100000105 3300005545 Bacteria 36950
104 Ga0070695_100417799 3300005545 Bacteria 1020
105 Ga0070696_100002528 3300005546 Bacteria 12115
106 Ga0070696_100030310 3300005546 Bacteria 3703
107 Ga0070693_100162912 3300005547 Unclassified 1422
108 Ga0070665_100383183 3300005548 Unclassified 1413
109 Ga0070704_100073755 3300005549 Bacteria 2487
110 Ga0070704_100220872 3300005549 Unclassified 1541
111 Ga0070704_100378708 3300005549 Unclassified 1202
112 Ga0070664_100006824 3300005564 Bacteria 9207
113 Ga0070664_100023139 3300005564 Bacteria 5129
114 Ga0070664_100085656 3300005564 Bacteria 2722
115 Ga0070664_100094263 3300005564 Bacteria 2596
116 Ga0070664_100135370 3300005564 Unclassified 2166
117 Ga0068857_100016947 3300005577 Bacteria 6384
118 Ga0070702_100255856 3300005615 Bacteria 1189
119 Ga0068859_100000728 3300005617 Bacteria 33110
120 Ga0068859_100002063 3300005617 Bacteria 20512
121 Ga0068859_100005931 3300005617 Bacteria 12399
122 Ga0068859_100018812 3300005617 Bacteria 6941
123 Ga0068859_100247712 3300005617 Bacteria 1872
124 Ga0068859_100845362 3300005617 Unclassified 1001
125 Ga0068864_100209401 3300005618 Unclassified 1795
126 Ga0068864_100304095 3300005618 Bacteria 1494
127 Ga0068861_100022739 3300005719 Bacteria 4520
128 Ga0068861_100435357 3300005719 Unclassified 1171
129 Ga0068861_100777482 3300005719 Bacteria 897
130 Ga0068870_10017057 3300005840 Bacteria 3484
131 Ga0068870_10092785 3300005840 Bacteria 1691
132 Ga0068870_10405793 3300005840 Unclassified 888
133 Ga0068863_100035397 3300005841 Bacteria 4756
134 Ga0068863_100324432 3300005841 Unclassified 1496
135 Ga0068863_100328638 3300005841 Bacteria 1486
136 Ga0068858_100153915 3300005842 Bacteria 2163
137 Ga0068858_100214914 3300005842 Bacteria 1820
138 Ga0068858_100441382 3300005842 Bacteria 1253
139 Ga0068860_100005327 3300005843 Bacteria 13059
140 Ga0068860_100013722 3300005843 Bacteria 7943
141 Ga0068860_100026328 3300005843 Bacteria 5607
142 Ga0068860_100351783 3300005843 Bacteria 1450
143 Ga0068860_100504454 3300005843 Bacteria 1208
144 Ga0068860_100761595 3300005843 Bacteria 980
145 Ga0068862_100020172 3300005844 Bacteria 5566
146 Ga0068862_100060923 3300005844 Bacteria 3243
147 Ga0068862_101058917 3300005844 Bacteria 804
148 Ga0075432_10045303 3300006058 Bacteria 1543
149 Ga0097621_100324430 3300006237 Bacteria 1364
150 Ga0097621_100382017 3300006237 Bacteria 1258
151 Ga0097621_100585664 3300006237 Unclassified 1018
152 Ga0068871_100011149 3300006358 Bacteria 6590
153 Ga0068871_100176312 3300006358 Bacteria 1835
154 Ga0068871_100240262 3300006358 Bacteria 1574
155 Ga0075428_100016050 3300006844 Bacteria 8282
156 Ga0075428_100297092 3300006844 Bacteria 1737
157 Ga0075428_100512642 3300006844 Unclassified 1283
158 Ga0075430_100003054 3300006846 Bacteria 13996
159 Ga0075431_100054527 3300006847 Bacteria 4123
160 Ga0075431_100414083 3300006847 Bacteria 1347
161 Ga0075433_10005372 3300006852 Bacteria 10063
162 Ga0075433_10127975 3300006852 Bacteria 2255
163 Ga0075433_10140955 3300006852 Unclassified 2143
164 Ga0075433_10172851 3300006852 Unclassified 1922
165 Ga0075434_100017937 3300006871 Bacteria 6828
166 Ga0075434_100034760 3300006871 Unclassified 4979
167 Ga0075434_100096499 3300006871 Bacteria 2961
168 Ga0075434_100413369 3300006871 Unclassified 1370
169 Ga0075429_100097106 3300006880 Unclassified 2570
170 Ga0075429_100128997 3300006880 Unclassified 2212
171 Ga0068865_100048105 3300006881 Bacteria 2934
172 Ga0068865_100661686 3300006881 Unclassified 889
173 Ga0097620_100000728 3300006931 Bacteria 33110
174 Ga0097620_100002063 3300006931 Bacteria 20512
175 Ga0097620_100005931 3300006931 Bacteria 12399
176 Ga0097620_100018812 3300006931 Bacteria 6941
177 Ga0097620_100247704 3300006931 Bacteria 1872
178 Ga0097620_100845342 3300006931 Unclassified 1001
179 Ga0075435_100012302 3300007076 Bacteria 6330
180 Ga0075435_100278834 3300007076 Bacteria 1427
181 Ga0075435_100591945 3300007076 Unclassified 962
182 Ga0111539_10013073 3300009094 Bacteria 10385
183 Ga0111539_10212723 3300009094 Bacteria 2253
184 Ga0111539_10369846 3300009094 Unclassified 1669
185 Ga0111539_10464731 3300009094 Unclassified 1473
186 Ga0111539_10953875 3300009094 Unclassified 997
187 Ga0105247_10019274 3300009101 Unclassified 4094
188 Ga0105247_10307440 3300009101 Bacteria 1102
189 Ga0114129_10002837 3300009147 Bacteria 24199
190 Ga0114129_10007885 3300009147 Bacteria 15153
191 Ga0114129_10012767 3300009147 Bacteria 11956
192 Ga0114129_10028645 3300009147 Bacteria 7891
193 Ga0114129_10031098 3300009147 Bacteria 7551
194 Ga0114129_10166466 3300009147 Bacteria 3008
195 Ga0114129_10415697 3300009147 Bacteria 1770
196 Ga0114129_10768923 3300009147 Bacteria 1231
197 Ga0105243_10031444 3300009148 Bacteria 4093
198 Ga0105243_10482880 3300009148 Bacteria 1170
199 Ga0105241_10757452 3300009174 Bacteria 891
200 Ga0105242_10511743 3300009176 Bacteria 1144
201 Ga0105242_11796752 3300009176 Bacteria 651
202 Ga0105248_10356175 3300009177 Bacteria 1648
203 Ga0105249_10007615 3300009553 Bacteria 9447
204 Ga0105249_10572300 3300009553 Unclassified 1182
205 Ga0105249_11209567 3300009553 Bacteria 827
206 Ga0105239_10490645 3300010375 Unclassified 1396
207 Ga0105246_10050089 3300011119 Bacteria 2864
208 Ga0105246_11252601 3300011119 Bacteria 685
209 Ga0157315_1001846 3300012508 Unclassified 1247
210 Ga0157373_10395068 3300013100 Unclassified 990
211 Ga0157374_10086931 3300013296 Bacteria 2975
212 Ga0157374_10184902 3300013296 Bacteria 2037
213 Ga0157378_10405662 3300013297 Bacteria 1344
214 Ga0157378_10481407 3300013297 Bacteria 1237
215 Ga0163162_10057269 3300013306 Bacteria 3925
216 Ga0157375_10032786 3300013308 Bacteria 4929
217 Ga0157375_10147383 3300013308 Unclassified 2485
218 Ga0157375_10156957 3300013308 Bacteria 2415
219 Ga0157375_11001306 3300013308 Unclassified 975
220 Ga0163163_10017044 3300014325 Bacteria 6767
221 Ga0157380_10128853 3300014326 Bacteria 2156
222 Ga0157380_10147925 3300014326 Unclassified 2027
223 Ga0157377_10040797 3300014745 Bacteria 2572
224 Ga0157377_10051853 3300014745 Bacteria 2315
225 Ga0157379_10032026 3300014968 Bacteria 4686
226 Ga0157379_10412714 3300014968 Unclassified 1242
227 Ga0157376_10047884 3300014969 Unclassified 3532
228 Ga0157376_10070425 3300014969 Bacteria 2968
229 Ga0157376_10128025 3300014969 Unclassified 2261
230 Ga0207697_10052673 3300025315 Bacteria 1684
231 Ga0207682_10041836 3300025893 Unclassified 1871
232 Ga0207682_10070663 3300025893 Bacteria 1479
233 Ga0207682_10193768 3300025893 Bacteria 932
234 Ga0207710_10296250 3300025900 Bacteria 816
235 Ga0207680_10440510 3300025903 Unclassified 924
236 Ga0207647_10181490 3300025904 Bacteria 1222
237 Ga0207643_10000692 3300025908 Bacteria 21034
238 Ga0207643_10003938 3300025908 Bacteria 7990
239 Ga0207643_10108127 3300025908 Unclassified 1636
240 Ga0207643_10199985 3300025908 Bacteria 1216
241 Ga0207705_10148506 3300025909 Bacteria 1755
242 Ga0207684_10126625 3300025910 Bacteria 2192
243 Ga0207684_10474455 3300025910 Bacteria 1073
244 Ga0207707_10350132 3300025912 Unclassified 1273
245 Ga0207660_10050287 3300025917 Bacteria 2959
246 Ga0207662_10009460 3300025918 Bacteria 5363
247 Ga0207649_10161332 3300025920 Bacteria 1554
248 Ga0207649_10359389 3300025920 Bacteria 1080
249 Ga0207646_10115721 3300025922 Bacteria 2408
250 Ga0207681_10077311 3300025923 Bacteria 2339
251 Ga0207681_10119844 3300025923 Unclassified 1928
252 Ga0207681_10225845 3300025923 Bacteria 1451
253 Ga0207681_10629216 3300025923 Unclassified 889
254 Ga0207650_10019720 3300025925 Unclassified 4743
255 Ga0207650_10314931 3300025925 Bacteria 1280
256 Ga0207659_10004808 3300025926 Bacteria 8193
257 Ga0207659_10005595 3300025926 Bacteria 7630
258 Ga0207659_10269510 3300025926 Bacteria 1388
259 Ga0207644_10057901 3300025931 Bacteria 2799
260 Ga0207644_10246723 3300025931 Bacteria 1423
261 Ga0207706_10007911 3300025933 Bacteria 9810
262 Ga0207709_10038101 3300025935 Bacteria 2860
263 Ga0207670_10007952 3300025936 Bacteria 5956
264 Ga0207704_10226613 3300025938 Bacteria 1387
265 Ga0207691_10023977 3300025940 Bacteria 5740
266 Ga0207691_10079564 3300025940 Bacteria 2950
267 Ga0207691_10903559 3300025940 Bacteria 739
268 Ga0207689_10213171 3300025942 Bacteria 1596
269 Ga0207661_10173616 3300025944 Bacteria 1878
270 Ga0207679_10015290 3300025945 Bacteria 5066
271 Ga0207679_10021299 3300025945 Bacteria 4394
272 Ga0207651_10023629 3300025960 Bacteria 3786
273 Ga0207651_10106230 3300025960 Bacteria 2096
274 Ga0207712_10175737 3300025961 Unclassified 1678
275 Ga0207658_10246870 3300025986 Unclassified 1515
276 Ga0207658_10289317 3300025986 Bacteria 1407
277 Ga0207677_10024548 3300026023 Bacteria 3746
278 Ga0207703_10021324 3300026035 Bacteria 5073
279 Ga0207703_10164033 3300026035 Bacteria 1948
280 Ga0207708_10014879 3300026075 Bacteria 5825
281 Ga0207708_10081219 3300026075 Bacteria 2491
282 Ga0207708_10140828 3300026075 Bacteria 1892
283 Ga0207708_10447783 3300026075 Bacteria 1075
284 Ga0207641_10092659 3300026088 Bacteria 2646
285 Ga0207641_10146418 3300026088 Unclassified 2136
286 Ga0207641_10292336 3300026088 Bacteria 1536
287 Ga0207641_10482866 3300026088 Bacteria 1201
288 Ga0207641_10740976 3300026088 Bacteria 969
289 Ga0207648_10001513 3300026089 Bacteria 25621
290 Ga0207648_10033468 3300026089 Bacteria 4533
291 Ga0207676_10183588 3300026095 Bacteria 1834
292 Ga0207676_10876251 3300026095 Bacteria 879
293 Ga0207676_11434296 3300026095 Bacteria 687
294 Ga0207674_10231853 3300026116 Unclassified 1794
295 Ga0207675_100009789 3300026118 Bacteria 8972
296 Ga0207675_100019854 3300026118 Bacteria 6271
297 Ga0207675_100192076 3300026118 Unclassified 1959
298 Ga0207675_100258854 3300026118 Bacteria 1686
299 Ga0207683_10057151 3300026121 Bacteria 3425
300 Ga0207683_10111532 3300026121 Bacteria 2449
301 Ga0207683_10115960 3300026121 Bacteria 2401
302 Ga0207683_10184779 3300026121 Bacteria 1891
303 Ga0207683_10448027 3300026121 Unclassified 1190
304 Ga0207683_10794404 3300026121 Bacteria 878
305 Ga0210000_1022486 3300027462 Unclassified 968
306 Ga0207428_10003099 3300027907 Bacteria 16345
307 Ga0207428_10029174 3300027907 Bacteria 4576
308 Ga0207428_10134105 3300027907 Unclassified 1894
309 Ga0207428_10567116 3300027907 Bacteria 820
310 Ga0207428_10588753 3300027907 Unclassified 802
311 Ga0268266_10988098 3300028379 Unclassified 814
312 Ga0268265_10001917 3300028380 Bacteria 16534
313 Ga0268265_10033840 3300028380 Bacteria 3719
314 Ga0268265_10137304 3300028380 Bacteria 2041
315 Ga0268264_10092719 3300028381 Unclassified 2607
316 Ga0268264_10203661 3300028381 Unclassified 1812
317 Ga0268264_10333080 3300028381 Bacteria 1439
318 Ga0268264_10576008 3300028381 Bacteria 1107
319 Ga0307414_10393429 3300032004 Bacteria 1202
320 Ga0373938_0014134 3300034957 Unclassified 1527
321 Ga0373949_0100858 3300035090 Bacteria 791
322 Ga0373932_0003317 3300035112 Bacteria 3887
323 Ga0373941_0145085 3300035115 Bacteria 866
324 Ga0373960_0145875 3300035121 Unclassified 805
325 Ga0373955_0274915 3300035172 Unclassified 1013
326 Ga0373937_0926267 3300036401 Unclassified 820
327 Ga0439435_0020222 3300042436 Bacteria 1715
328 Ga0451577_0924211 3300042876 Unclassified 785
329 Ga0453683_0401171 3300044673 Bacteria 884
330 Ga0451576_0011101 3300045051 Bacteria 10274
331 Ga0451576_0033664 3300045051 Bacteria 5446
332 Ga0451576_0042905 3300045051 Unclassified 4775
333 Ga0451576_0142711 3300045051 Unclassified 2497
334 Ga0451576_0272641 3300045051 Bacteria 1769
335 Ga0451576_0693440 3300045051 Unclassified 1070
336 Ga0451576_1057719 3300045051 Bacteria 850
337 Ga0495603_0020005 3300046455 Bacteria 4056
338 Ga0495629_0118131 3300046459 Unclassified 1848
339 Ga0495651_0071716 3300046462 Bacteria 2633
340 Ga0495584_0122444 3300046491 Bacteria 1317
341 Ga0495584_0241270 3300046491 Bacteria 919
342 Ga0495644_0049290 3300046523 Unclassified 1581
343 Ga0495663_0115776 3300046525 Bacteria 894
344 Ga0495642_0093127 3300046528 Bacteria 1277
345 Ga0495598_0003567 3300046537 Unclassified 3317
346 Ga0495598_0031651 3300046537 Bacteria 1490
347 Ga0495621_0018537 3300046539 Bacteria 2261
348 Ga0495621_0025718 3300046539 Unclassified 1980
349 Ga0495621_0198263 3300046539 Bacteria 807
350 Ga0495659_0013774 3300046664 Bacteria 2637
351 Ga0495659_0023610 3300046664 Unclassified 2091
352 Ga0495659_0119884 3300046664 Unclassified 1035
353 Ga0495659_0185370 3300046664 Bacteria 849
354 Ga0495588_0124812 3300046674 Bacteria 1357
355 Ga0495670_0262873 3300046691 Unclassified 921
356 Ga0495670_0347525 3300046691 Bacteria 798
357 Ga0495636_0048218 3300047318 Bacteria 1779
358 Ga0495636_0051275 3300047318 Bacteria 1730
359 Ga0495680_0521337 3300047322 Unclassified 804
360 Ga0495685_069453 3300047447 Bacteria 1181
361 Ga0495684_0166389 3300047471 Bacteria 1642
362 Ga0496105_0277442 3300048908 Bacteria 1352
363 Ga0496108_0798418 3300048911 Unclassified 814
364 Ga0496110_0857939 3300048913 Unclassified 813
365 Ga0496113_0615477 3300048916 Unclassified 869
366 Ga0501038_0473646 3300049574 Unclassified 960
367 Ga0501039_0072891 3300049575 Bacteria 2669
368 Ga0501040_0064855 3300049576 Bacteria 2515
369 Ga0501068_0214118 3300049584 Unclassified 1224
370 Ga0501071_0179359 3300049587 Bacteria 1587
371 Ga0501072_0006899 3300049588 Bacteria 8623
372 Ga0501075_0049843 3300049591 Unclassified 3147
373 Ga0501076_0008227 3300049592 Bacteria 7642
374 Ga0501045_0023121 3300049824 Bacteria 4454
375 nmdc:mga05p37_293566_c1 3300050507 Bacteria 1934
376 nmdc:mga05p37_34893_c1 3300050507 Bacteria 6164
377 nmdc:mga05p37_435434_c1 3300050507 Unclassified 1522
378 nmdc:mga05p37_60064_c1 3300050507 Bacteria 4681
379 nmdc:mga05p37_693929_c1 3300050507 Bacteria 1132
380 nmdc:mga05p37_8412_c1 3300050507 Bacteria 12198
381 nmdc:mga09592_29708_c1 3300050508 Bacteria 4545
382 nmdc:mga09592_324600_c1 3300050508 Bacteria 1333
383 nmdc:mga09592_65289_c1 3300050508 Unclassified 3083
384 nmdc:mga0qj67_238092_c1 3300050509 Unclassified 1477
385 nmdc:mga06r32_425080_c1 3300050510 Bacteria 1310
386 nmdc:mga08y16_236094_c1 3300050511 Bacteria 1891
387 nmdc:mga08y16_9163_c1 3300050511 Bacteria 10389
388 nmdc:mga08y16_926_c1 3300050511 Bacteria 28501
389 nmdc:mga0n895_20274_c1 3300050512 Bacteria 6196
390 nmdc:mga0n895_39625_c1 3300050512 Bacteria 4572
391 nmdc:mga0n895_539672_c1 3300050512 Unclassified 1173
392 nmdc:mga0n895_581371_c1 3300050512 Unclassified 1124
393 nmdc:mga0n895_692166_c1 3300050512 Bacteria 1016
394 nmdc:mga0n895_71040_c1 3300050512 Unclassified 3451
395 nmdc:mga0n895_81746_c1 3300050512 Unclassified 3220
396 nmdc:mga0rr50_168992_c1 3300050513 Unclassified 1780
397 nmdc:mga0rr50_332348_c1 3300050513 Unclassified 1276
398 nmdc:mga0rr50_512095_c1 3300050513 Bacteria 1021
399 nmdc:mga0a205_132092_c1 3300050515 Bacteria 2397
400 nmdc:mga0a205_153434_c1 3300050515 Unclassified 2202
401 nmdc:mga0a205_2629_c1 3300050515 Bacteria 15870
402 Ga0495595_0039265 3300053084 Unclassified 2159
403 Ga0500555_005259 3300053103 Bacteria 3674
404 Ga0501084_0009302 3300054114 Bacteria 8133
405 Ga0590077_068067 3300059426 Bacteria 811
406 Ga0501069_0288810
407 MRS1b_contig_5129809
408 MBSR1b_contig_3893122
409 JGI24746J21847_1004842
410 Ga0065704_10076534
411 Ga0065712_10090755
412 Ga0065715_10055837
413 Ga0065715_10217733
414 Ga0065707_10006354
415 Ga0065707_10152188
416 Ga0065707_10206849
417 Ga0070658_10436489
418 Ga0070676_10008142
419 Ga0070676_10124781
420 Ga0070683_100199886
421 Ga0070690_100024985
422 Ga0070670_100010375
423 Ga0070670_100219391
424 Ga0070670_100427086
425 Ga0070677_10047948
426 Ga0070677_10076419
427 Ga0070677_10187063
428 Ga0068869_100501445
429 Ga0070666_10058719
430 Ga0070680_100106097
431 Ga0070680_100330008
432 Ga0068868_100283022
433 Ga0068868_100420246
434 Ga0070689_100002196
435 Ga0070689_100047187
436 Ga0070689_100087625
437 Ga0070689_100405437
438 Ga0070691_10019399
439 Ga0070691_10112799
440 Ga0070687_100007265
441 Ga0070661_100110079
442 Ga0070661_100457993
443 Ga0070692_10020427
444 Ga0070669_100004739
445 Ga0070669_100064810
446 Ga0070669_100124317
447 Ga0070675_100000976
448 Ga0070675_100007988
449 Ga0070675_100013705
450 Ga0070675_100117568
451 Ga0070675_100128797
452 Ga0070675_100129061
453 Ga0070675_100245185
454 Ga0070671_100062116
455 Ga0070671_100177737
456 Ga0070671_100213665
457 Ga0070671_100289603
458 Ga0070673_100070864
459 Ga0070673_100090045
460 Ga0070673_100160344
461 Ga0070673_100213882
462 Ga0070673_100395021
463 Ga0070673_100603307
464 Ga0070688_100022735
465 Ga0070688_100686851
466 Ga0070659_100121264
467 Ga0070659_100772483
468 Ga0070667_100005800
469 Ga0070667_100355071
470 Ga0070667_100400861
471 Ga0070667_100604615
472 Ga0070701_10003961
473 Ga0070701_10104670
474 Ga0070701_10353490
475 Ga0070705_100001293
476 Ga0070705_100007041
477 Ga0070705_100149469
478 Ga0070700_100021968
479 Ga0070700_100307420
480 Ga0070694_100000713
481 Ga0070694_100031771
482 Ga0070694_100056736
483 Ga0070708_100050719
484 Ga0070708_100636648
485 Ga0070678_100675876
486 Ga0070662_100065655
487 Ga0070681_10275141
488 Ga0068867_100002931
489 Ga0068867_100222573
490 Ga0070685_10007602
491 Ga0070685_10103180
492 Ga0070685_10375956
493 Ga0070707_100010385
494 Ga0070707_100132856
495 Ga0070698_100006574
496 Ga0070698_100011660
497 Ga0070698_100670911
498 Ga0070699_100000339
499 Ga0070699_100047806
500 Ga0070679_100306734
501 Ga0070684_100442723
502 Ga0070697_100189190
503 Ga0070697_100302866
504 Ga0070672_100110663
505 Ga0070672_100584751
506 Ga0070686_100219367
507 Ga0070686_100249587
508 Ga0070695_100000105
509 Ga0070695_100417799
510 Ga0070696_100002528
511 Ga0070696_100030310
512 Ga0070693_100162912
513 Ga0070665_100383183
514 Ga0070704_100073755
515 Ga0070704_100220872
516 Ga0070704_100378708
517 Ga0070664_100006824
518 Ga0070664_100023139
519 Ga0070664_100085656
520 Ga0070664_100094263
521 Ga0070664_100135370
522 Ga0068857_100016947
523 Ga0070702_100255856
524 Ga0068859_100000728
525 Ga0068859_100002063
526 Ga0068859_100005931
527 Ga0068859_100018812
528 Ga0068859_100247712
529 Ga0068859_100845362
530 Ga0068864_100209401
531 Ga0068864_100304095
532 Ga0068861_100022739
533 Ga0068861_100435357
534 Ga0068861_100777482
535 Ga0068870_10017057
536 Ga0068870_10092785
537 Ga0068870_10405793
538 Ga0068863_100035397
539 Ga0068863_100324432
540 Ga0068863_100328638
541 Ga0068858_100153915
542 Ga0068858_100214914
543 Ga0068858_100441382
544 Ga0068860_100005327
545 Ga0068860_100013722
546 Ga0068860_100026328
547 Ga0068860_100351783
548 Ga0068860_100504454
549 Ga0068860_100761595
550 Ga0068862_100020172
551 Ga0068862_100060923
552 Ga0068862_101058917
553 Ga0075432_10045303
554 Ga0097621_100324430
555 Ga0097621_100382017
556 Ga0097621_100585664
557 Ga0068871_100011149
558 Ga0068871_100176312
559 Ga0068871_100240262
560 Ga0075428_100016050
561 Ga0075428_100297092
562 Ga0075428_100512642
563 Ga0075430_100003054
564 Ga0075431_100054527
565 Ga0075431_100414083
566 Ga0075433_10005372
567 Ga0075433_10127975
568 Ga0075433_10140955
569 Ga0075433_10172851
570 Ga0075434_100017937
571 Ga0075434_100034760
572 Ga0075434_100096499
573 Ga0075434_100413369
574 Ga0075429_100097106
575 Ga0075429_100128997
576 Ga0068865_100048105
577 Ga0068865_100661686
578 Ga0097620_100000728
579 Ga0097620_100002063
580 Ga0097620_100005931
581 Ga0097620_100018812
582 Ga0097620_100247704
583 Ga0097620_100845342
584 Ga0075435_100012302
585 Ga0075435_100278834
586 Ga0075435_100591945
587 Ga0111539_10013073
588 Ga0111539_10212723
589 Ga0111539_10369846
590 Ga0111539_10464731
591 Ga0111539_10953875
592 Ga0105247_10019274
593 Ga0105247_10307440
594 Ga0114129_10002837
595 Ga0114129_10007885
596 Ga0114129_10012767
597 Ga0114129_10028645
598 Ga0114129_10031098
599 Ga0114129_10166466
600 Ga0114129_10415697
601 Ga0114129_10768923
602 Ga0105243_10031444
603 Ga0105243_10482880
604 Ga0105241_10757452
605 Ga0105242_10511743
606 Ga0105242_11796752
607 Ga0105248_10356175
608 Ga0105249_10007615
609 Ga0105249_10572300
610 Ga0105249_11209567
611 Ga0105239_10490645
612 Ga0105246_10050089
613 Ga0105246_11252601
614 Ga0157315_1001846
615 Ga0157373_10395068
616 Ga0157374_10086931
617 Ga0157374_10184902
618 Ga0157378_10405662
619 Ga0157378_10481407
620 Ga0163162_10057269
621 Ga0157375_10032786
622 Ga0157375_10147383
623 Ga0157375_10156957
624 Ga0157375_11001306
625 Ga0163163_10017044
626 Ga0157380_10128853
627 Ga0157380_10147925
628 Ga0157377_10040797
629 Ga0157377_10051853
630 Ga0157379_10032026
631 Ga0157379_10412714
632 Ga0157376_10047884
633 Ga0157376_10070425
634 Ga0157376_10128025
635 Ga0207697_10052673
636 Ga0207682_10041836
637 Ga0207682_10070663
638 Ga0207682_10193768
639 Ga0207710_10296250
640 Ga0207680_10440510
641 Ga0207647_10181490
642 Ga0207643_10000692
643 Ga0207643_10003938
644 Ga0207643_10108127
645 Ga0207643_10199985
646 Ga0207705_10148506
647 Ga0207684_10126625
648 Ga0207684_10474455
649 Ga0207707_10350132
650 Ga0207660_10050287
651 Ga0207662_10009460
652 Ga0207649_10161332
653 Ga0207649_10359389
654 Ga0207646_10115721
655 Ga0207681_10077311
656 Ga0207681_10119844
657 Ga0207681_10225845
658 Ga0207681_10629216
659 Ga0207650_10019720
660 Ga0207650_10314931
661 Ga0207659_10004808
662 Ga0207659_10005595
663 Ga0207659_10269510
664 Ga0207644_10057901
665 Ga0207644_10246723
666 Ga0207706_10007911
667 Ga0207709_10038101
668 Ga0207670_10007952
669 Ga0207704_10226613
670 Ga0207691_10023977
671 Ga0207691_10079564
672 Ga0207691_10903559
673 Ga0207689_10213171
674 Ga0207661_10173616
675 Ga0207679_10015290
676 Ga0207679_10021299
677 Ga0207651_10023629
678 Ga0207651_10106230
679 Ga0207712_10175737
680 Ga0207658_10246870
681 Ga0207658_10289317
682 Ga0207677_10024548
683 Ga0207703_10021324
684 Ga0207703_10164033
685 Ga0207708_10014879
686 Ga0207708_10081219
687 Ga0207708_10140828
688 Ga0207708_10447783
689 Ga0207641_10092659
690 Ga0207641_10146418
691 Ga0207641_10292336
692 Ga0207641_10482866
693 Ga0207641_10740976
694 Ga0207648_10001513
695 Ga0207648_10033468
696 Ga0207676_10183588
697 Ga0207676_10876251
698 Ga0207676_11434296
699 Ga0207674_10231853
700 Ga0207675_100009789
701 Ga0207675_100019854
702 Ga0207675_100192076
703 Ga0207675_100258854
704 Ga0207683_10057151
705 Ga0207683_10111532
706 Ga0207683_10115960
707 Ga0207683_10184779
708 Ga0207683_10448027
709 Ga0207683_10794404
710 Ga0210000_1022486
711 Ga0207428_10003099
712 Ga0207428_10029174
713 Ga0207428_10134105
714 Ga0207428_10567116
715 Ga0207428_10588753
716 Ga0268266_10988098
717 Ga0268265_10001917
718 Ga0268265_10033840
719 Ga0268265_10137304
720 Ga0268264_10092719
721 Ga0268264_10203661
722 Ga0268264_10333080
723 Ga0268264_10576008
724 Ga0307414_10393429
725 Ga0373938_0014134
726 Ga0373949_0100858
727 Ga0373932_0003317
728 Ga0373941_0145085
729 Ga0373960_0145875
730 Ga0373955_0274915
731 Ga0373937_0926267
732 Ga0439435_0020222
733 Ga0451577_0924211
734 Ga0453683_0401171
735 Ga0451576_0011101
736 Ga0451576_0033664
737 Ga0451576_0042905
738 Ga0451576_0142711
739 Ga0451576_0272641
740 Ga0451576_0693440
741 Ga0451576_1057719
742 Ga0495603_0020005
743 Ga0495629_0118131
744 Ga0495651_0071716
745 Ga0495584_0122444
746 Ga0495584_0241270
747 Ga0495644_0049290
748 Ga0495663_0115776
749 Ga0495642_0093127
750 Ga0495598_0003567
751 Ga0495598_0031651
752 Ga0495621_0018537
753 Ga0495621_0025718
754 Ga0495621_0198263
755 Ga0495659_0013774
756 Ga0495659_0023610
757 Ga0495659_0119884
758 Ga0495659_0185370
759 Ga0495588_0124812
760 Ga0495670_0262873
761 Ga0495670_0347525
762 Ga0495636_0048218
763 Ga0495636_0051275
764 Ga0495680_0521337
765 Ga0495685_069453
766 Ga0495684_0166389
767 Ga0496105_0277442
768 Ga0496108_0798418
769 Ga0496110_0857939
770 Ga0496113_0615477
771 Ga0501038_0473646
772 Ga0501039_0072891
773 Ga0501040_0064855
774 Ga0501068_0214118
775 Ga0501071_0179359
776 Ga0501072_0006899
777 Ga0501075_0049843
778 Ga0501076_0008227
779 Ga0501045_0023121
780 nmdc:mga05p37_293566_c1
781 nmdc:mga05p37_34893_c1
782 nmdc:mga05p37_435434_c1
783 nmdc:mga05p37_60064_c1
784 nmdc:mga05p37_693929_c1
785 nmdc:mga05p37_8412_c1
786 nmdc:mga09592_29708_c1
787 nmdc:mga09592_324600_c1
788 nmdc:mga09592_65289_c1
789 nmdc:mga0qj67_238092_c1
790 nmdc:mga06r32_425080_c1
791 nmdc:mga08y16_236094_c1
792 nmdc:mga08y16_9163_c1
793 nmdc:mga08y16_926_c1
794 nmdc:mga0n895_20274_c1
795 nmdc:mga0n895_39625_c1
796 nmdc:mga0n895_539672_c1
797 nmdc:mga0n895_581371_c1
798 nmdc:mga0n895_692166_c1
799 nmdc:mga0n895_71040_c1
800 nmdc:mga0n895_81746_c1
801 nmdc:mga0rr50_168992_c1
802 nmdc:mga0rr50_332348_c1
803 nmdc:mga0rr50_512095_c1
804 nmdc:mga0a205_132092_c1
805 nmdc:mga0a205_153434_c1
806 nmdc:mga0a205_2629_c1
807 Ga0495595_0039265
808 Ga0500555_005259
809 Ga0501084_0009302
810 Ga0590077_068067

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00034

Cytochrom_C

Cytochrome c

91

190

0.84

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

89

174

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mxy-assembly1.cif.gz_A kustc0563 c-type cytochrome 0.8866 73 157
6lod-assembly1.cif.gz_E cryo-em structure of the air-oxidized photosynthetic alternative complex iii from roseiflexus castenholzii 0.8741 63 161
6loe-assembly1.cif.gz_E cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.8544 63 161
5mxy-assembly1.cif.gz_A kustc0563 c-type cytochrome 0.8472 73 157
6h5l-assembly1.cif.gz_B kuenenia stuttgartiensis reducing hao-like protein complex kustc0457/kustc0458 0.846 63 157
ID Description Score Start End Superfamily
1hzuA01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7889 59 158 1.10.760.10
1hzuA01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7581 59 158 1.10.760.10
1yiqA02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7089 61 159 1.10.760.10
4eifA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7005 73 159 1.10.760.10
3cu4A00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6918 74 155 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A534TB61-F1-model_v4 C-type cytochrome 0.9695 63 171 GO:0009055
GO:0020037
GO:0046872
AF-A0A1F2QYG0-F1-model_v4 Cytochrome c domain-containing protein 0.9548 41 171 GO:0009055
GO:0020037
GO:0046872
AF-A0A540VJT1-F1-model_v4 Cytochrome c 0.9432 54 157 GO:0009055
GO:0020037
GO:0046872
AF-A0A7C1VA44-F1-model_v4 C-type cytochrome 0.9428 53 157 GO:0005506
GO:0009055
GO:0020037
AF-A0A7V2LLI5-F1-model_v4 C-type cytochrome 0.9398 55 157 GO:0009055
GO:0020037
GO:0046872

Map