F436061
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 405 | 240 | 810 | 301 |
Family's Representative Sequence
| Representative Sequence | 3300049582|Ga0501048_0281826|Ga0501048_0281826_37_1035 |
| Length | 332 |
| Sequence | MTTPRNRETGALRAEARASAGTPEKTSDKRIEADVLAAALPWLKAYNGKIVVIKYGGNAMTDDALKRAFAEDVAFLRFAGFKPVVVHGGGPQISQMLDRLGIESEFRGGLRVTTPEAMDVVRMVLVGQVQRELVGLINEHGPLAVGLSGEDAGLFTAKQTNTVVDGEEVDLGLVGEVVDVRPEAVLDIIEAGRIPVVSSVAPDVQGTVHNVNADSAAAXLAVALEAEKLLVLTDVEGLFLDWPTSQDVIGEISPEALAKILPTLESGMVPKMKACLDAVQSGVSRATVVDGREPHAVLLELFTQEGVGTQVLPDVETKTRRARAASEAEATS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 20 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 24 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 29 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 30 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 31 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 32 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 33 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 34 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 35 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 36 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 37 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 38 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 39 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 40 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 55 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 82 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 83 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 84 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 85 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 86 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 87 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 88 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 89 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 90 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 91 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 92 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 93 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 94 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 95 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 96 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 97 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 98 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 99 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 100 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 101 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 102 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 103 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 104 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 105 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 106 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 107 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 108 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 109 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 110 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 111 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 112 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 113 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 114 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 115 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 116 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 117 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 118 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 158 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 160 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 161 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 162 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 163 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 165 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 166 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 167 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 168 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 169 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 170 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 171 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 200 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 204 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 205 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 206 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 207 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 208 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 209 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 211 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 212 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 213 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 214 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 217 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 218 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 219 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 220 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 221 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 222 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 223 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 224 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 225 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 226 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 227 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 228 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 229 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 230 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 231 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 232 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 233 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 234 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 235 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 236 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 237 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 238 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 239 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
| 240 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.58 |
| Metatranscriptomes | 0.74 |
| Isolates | 5.68 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.84 |
| Nodule | 0.25 |
| Rhizoplane | 5.93 |
| Rhizosphere | 75.06 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501048_0281826 | 3300049582 | Bacteria | 1182 |
| 2 | LJQas_1003142 | 3300000549 | Bacteria | 2228 |
| 3 | JGI24735J21928_10009738 | 3300002067 | Bacteria | 3078 |
| 4 | Ga0006562J51391_1140841 | 3300003578 | Bacteria | 2800 |
| 5 | Ga0070658_10059254 | 3300005327 | Bacteria | 3118 |
| 6 | Ga0070683_100018336 | 3300005329 | Bacteria | 6196 |
| 7 | Ga0070683_100107640 | 3300005329 | Bacteria | 2629 |
| 8 | Ga0070683_100331120 | 3300005329 | Bacteria | 1450 |
| 9 | Ga0070682_100018037 | 3300005337 | Bacteria | 4119 |
| 10 | Ga0070682_100128811 | 3300005337 | Bacteria | 1710 |
| 11 | Ga0070660_100003305 | 3300005339 | Bacteria | 11084 |
| 12 | Ga0070660_100103860 | 3300005339 | Bacteria | 2254 |
| 13 | Ga0070660_100164393 | 3300005339 | Bacteria | 1790 |
| 14 | Ga0070691_10142255 | 3300005341 | Bacteria | 1223 |
| 15 | Ga0070687_100031177 | 3300005343 | Bacteria | 2614 |
| 16 | Ga0070675_100133067 | 3300005354 | Bacteria | 2121 |
| 17 | Ga0070671_100368999 | 3300005355 | Bacteria | 1226 |
| 18 | Ga0070674_100010033 | 3300005356 | Bacteria | 5703 |
| 19 | Ga0070674_100286963 | 3300005356 | Bacteria | 1307 |
| 20 | Ga0070659_100089242 | 3300005366 | Bacteria | 2469 |
| 21 | Ga0070667_100037890 | 3300005367 | Bacteria | 4043 |
| 22 | Ga0070701_10031580 | 3300005438 | Bacteria | 2628 |
| 23 | Ga0070663_100053475 | 3300005455 | Bacteria | 2883 |
| 24 | Ga0070678_100040251 | 3300005456 | Bacteria | 3306 |
| 25 | Ga0068867_100036032 | 3300005459 | Bacteria | 3590 |
| 26 | Ga0070698_100001494 | 3300005471 | Bacteria | 25962 |
| 27 | Ga0070679_100031880 | 3300005530 | Bacteria | 5210 |
| 28 | Ga0070684_100008524 | 3300005535 | Bacteria | 8021 |
| 29 | Ga0070684_100126153 | 3300005535 | Bacteria | 2305 |
| 30 | Ga0068853_100064489 | 3300005539 | Bacteria | 3177 |
| 31 | Ga0070672_100035086 | 3300005543 | Bacteria | 3810 |
| 32 | Ga0070665_100009827 | 3300005548 | Bacteria | 9671 |
| 33 | Ga0068855_100241764 | 3300005563 | Bacteria | 2017 |
| 34 | Ga0070702_100038906 | 3300005615 | Bacteria | 2652 |
| 35 | Ga0070702_100107373 | 3300005615 | Bacteria | 1724 |
| 36 | Ga0068852_100140735 | 3300005616 | Bacteria | 2232 |
| 37 | Ga0068863_100004293 | 3300005841 | Bacteria | 14035 |
| 38 | Ga0068860_100001541 | 3300005843 | Bacteria | 24832 |
| 39 | Ga0075365_10000618 | 3300006038 | Bacteria | 14004 |
| 40 | Ga0075365_10020373 | 3300006038 | Bacteria | 4111 |
| 41 | Ga0075365_10022500 | 3300006038 | Bacteria | 3950 |
| 42 | Ga0075365_10041332 | 3300006038 | Bacteria | 3011 |
| 43 | Ga0075365_10053452 | 3300006038 | Bacteria | 2675 |
| 44 | Ga0075365_10119653 | 3300006038 | Bacteria | 1816 |
| 45 | Ga0075365_10213943 | 3300006038 | Bacteria | 1352 |
| 46 | Ga0075365_10293197 | 3300006038 | Bacteria | 1145 |
| 47 | Ga0075365_10350021 | 3300006038 | Bacteria | 1041 |
| 48 | Ga0075368_10001765 | 3300006042 | Bacteria | 6960 |
| 49 | Ga0075368_10012837 | 3300006042 | Bacteria | 3068 |
| 50 | Ga0075368_10089166 | 3300006042 | Bacteria | 1261 |
| 51 | Ga0075363_100062618 | 3300006048 | Bacteria | 2006 |
| 52 | Ga0075363_100153282 | 3300006048 | Bacteria | 1302 |
| 53 | Ga0075363_100210891 | 3300006048 | Bacteria | 1112 |
| 54 | Ga0075364_10030417 | 3300006051 | Bacteria | 3465 |
| 55 | Ga0075364_10034785 | 3300006051 | Bacteria | 3253 |
| 56 | Ga0075364_10059239 | 3300006051 | Bacteria | 2510 |
| 57 | Ga0075364_10073540 | 3300006051 | Bacteria | 2253 |
| 58 | Ga0075364_10125732 | 3300006051 | Bacteria | 1719 |
| 59 | Ga0075362_10111755 | 3300006177 | Bacteria | 1286 |
| 60 | Ga0075367_10031633 | 3300006178 | Bacteria | 3039 |
| 61 | Ga0075367_10042584 | 3300006178 | Bacteria | 2657 |
| 62 | Ga0075367_10130885 | 3300006178 | Bacteria | 1551 |
| 63 | Ga0075367_10164668 | 3300006178 | Bacteria | 1379 |
| 64 | Ga0075370_10010424 | 3300006353 | Bacteria | 4860 |
| 65 | Ga0075370_10024533 | 3300006353 | Bacteria | 3332 |
| 66 | Ga0075428_100104226 | 3300006844 | Bacteria | 3093 |
| 67 | Ga0068865_100017374 | 3300006881 | Bacteria | 4627 |
| 68 | Ga0111539_10046733 | 3300009094 | Bacteria | 5177 |
| 69 | Ga0111539_10164849 | 3300009094 | Bacteria | 2591 |
| 70 | Ga0105245_10006602 | 3300009098 | Bacteria | 10185 |
| 71 | Ga0105245_10024490 | 3300009098 | Bacteria | 5300 |
| 72 | Ga0105243_10062066 | 3300009148 | Bacteria | 2991 |
| 73 | Ga0105243_10099417 | 3300009148 | Bacteria | 2411 |
| 74 | Ga0105248_10819034 | 3300009177 | Bacteria | 1051 |
| 75 | Ga0105237_10265455 | 3300009545 | Bacteria | 1720 |
| 76 | Ga0105238_10266091 | 3300009551 | Bacteria | 1694 |
| 77 | Ga0105249_10075993 | 3300009553 | Bacteria | 3112 |
| 78 | Ga0105249_10108709 | 3300009553 | Bacteria | 2618 |
| 79 | Ga0105249_10152018 | 3300009553 | Bacteria | 2229 |
| 80 | Ga0105239_10096396 | 3300010375 | Bacteria | 3268 |
| 81 | Ga0105239_10379940 | 3300010375 | Bacteria | 1597 |
| 82 | Ga0105239_10613417 | 3300010375 | Bacteria | 1241 |
| 83 | Ga0105239_10916155 | 3300010375 | Bacteria | 1006 |
| 84 | Ga0105246_10010188 | 3300011119 | Bacteria | 5806 |
| 85 | Ga0105246_10245517 | 3300011119 | Bacteria | 1418 |
| 86 | Ga0157372_10044921 | 3300013307 | Bacteria | 4897 |
| 87 | Ga0157375_10098214 | 3300013308 | Bacteria | 3004 |
| 88 | Ga0157375_10223570 | 3300013308 | Bacteria | 2041 |
| 89 | Ga0163163_10723589 | 3300014325 | Bacteria | 1059 |
| 90 | Ga0157380_10037943 | 3300014326 | Bacteria | 3738 |
| 91 | Ga0163161_10069206 | 3300017792 | Bacteria | 2580 |
| 92 | Ga0206353_10363779 | 3300020082 | Bacteria | 1978 |
| 93 | Ga0206353_10973789 | 3300020082 | Bacteria | 1726 |
| 94 | Ga0207647_10031477 | 3300025904 | Bacteria | 3414 |
| 95 | Ga0207643_10002264 | 3300025908 | Bacteria | 10488 |
| 96 | Ga0207705_10203037 | 3300025909 | Bacteria | 1502 |
| 97 | Ga0207662_10067863 | 3300025918 | Bacteria | 2152 |
| 98 | Ga0207662_10077355 | 3300025918 | Bacteria | 2024 |
| 99 | Ga0207657_10007406 | 3300025919 | Bacteria | 11252 |
| 100 | Ga0207657_10049700 | 3300025919 | Bacteria | 3652 |
| 101 | Ga0207659_10097769 | 3300025926 | Bacteria | 2206 |
| 102 | Ga0207659_10168806 | 3300025926 | Bacteria | 1725 |
| 103 | Ga0207690_10005350 | 3300025932 | Bacteria | 7566 |
| 104 | Ga0207706_10172915 | 3300025933 | Bacteria | 1898 |
| 105 | Ga0207709_10119322 | 3300025935 | Bacteria | 1778 |
| 106 | Ga0207709_10261197 | 3300025935 | Bacteria | 1270 |
| 107 | Ga0207704_10044232 | 3300025938 | Bacteria | 2636 |
| 108 | Ga0207704_10216205 | 3300025938 | Bacteria | 1414 |
| 109 | Ga0207691_10001201 | 3300025940 | Bacteria | 25783 |
| 110 | Ga0207661_10107326 | 3300025944 | Bacteria | 2355 |
| 111 | Ga0207661_10381770 | 3300025944 | Bacteria | 1275 |
| 112 | Ga0207661_10499955 | 3300025944 | Bacteria | 1111 |
| 113 | Ga0207679_10030572 | 3300025945 | Bacteria | 3762 |
| 114 | Ga0207679_10099338 | 3300025945 | Bacteria | 2272 |
| 115 | Ga0207679_10158822 | 3300025945 | Bacteria | 1849 |
| 116 | Ga0207651_10396685 | 3300025960 | Bacteria | 1173 |
| 117 | Ga0207712_10084081 | 3300025961 | Bacteria | 2324 |
| 118 | Ga0207712_10127680 | 3300025961 | Bacteria | 1933 |
| 119 | Ga0207658_10222709 | 3300025986 | Bacteria | 1588 |
| 120 | Ga0207639_10167140 | 3300026041 | Bacteria | 1859 |
| 121 | Ga0207678_10332984 | 3300026067 | Bacteria | 1307 |
| 122 | Ga0207708_10000513 | 3300026075 | Bacteria | 29912 |
| 123 | Ga0207648_10153184 | 3300026089 | Bacteria | 2034 |
| 124 | Ga0207675_100004561 | 3300026118 | Bacteria | 13362 |
| 125 | Ga0207675_100354918 | 3300026118 | Bacteria | 1438 |
| 126 | Ga0207698_10446288 | 3300026142 | Bacteria | 1248 |
| 127 | Ga0209813_10000804 | 3300027866 | Bacteria | 7117 |
| 128 | Ga0268266_10019422 | 3300028379 | Bacteria | 5787 |
| 129 | Ga0268266_10281386 | 3300028379 | Bacteria | 1547 |
| 130 | Ga0268265_10058996 | 3300028380 | Bacteria | 2934 |
| 131 | Ga0268264_10001453 | 3300028381 | Bacteria | 22147 |
| 132 | Ga0316579_10121431 | 3300031691 | Bacteria | 1256 |
| 133 | Ga0316576_10032091 | 3300031727 | Bacteria | 3731 |
| 134 | Ga0307405_10082756 | 3300031731 | Bacteria | 2102 |
| 135 | Ga0307413_10410243 | 3300031824 | Bacteria | 1064 |
| 136 | Ga0307410_10057184 | 3300031852 | Bacteria | 2655 |
| 137 | Ga0307410_10337832 | 3300031852 | Bacteria | 1200 |
| 138 | Ga0307407_10066484 | 3300031903 | Bacteria | 2126 |
| 139 | Ga0307407_10296101 | 3300031903 | Bacteria | 1126 |
| 140 | Ga0307412_10438520 | 3300031911 | Bacteria | 1073 |
| 141 | Ga0307409_100041121 | 3300031995 | Bacteria | 3449 |
| 142 | Ga0307409_100466939 | 3300031995 | Bacteria | 1221 |
| 143 | Ga0307416_100015342 | 3300032002 | Bacteria | 5290 |
| 144 | Ga0307416_100107302 | 3300032002 | Bacteria | 2450 |
| 145 | Ga0307416_100327783 | 3300032002 | Bacteria | 1537 |
| 146 | Ga0307414_10057169 | 3300032004 | Bacteria | 2741 |
| 147 | Ga0307411_10152914 | 3300032005 | Bacteria | 1717 |
| 148 | Ga0307411_10157820 | 3300032005 | Bacteria | 1695 |
| 149 | Ga0307411_10180755 | 3300032005 | Bacteria | 1601 |
| 150 | Ga0307415_100096140 | 3300032126 | Bacteria | 2158 |
| 151 | Ga0307507_10070140 | 3300033179 | Bacteria | 3182 |
| 152 | Ga0395900_0071170 | 3300037418 | Bacteria | 3575 |
| 153 | Ga0395898_0053418 | 3300037466 | Bacteria | 3946 |
| 154 | Ga0395905_0600995 | 3300037471 | Bacteria | 1002 |
| 155 | Ga0436364_1428798 | 3300037853 | Bacteria | 3501 |
| 156 | Ga0395901_0015285 | 3300038443 | Bacteria | 7810 |
| 157 | Ga0395901_0050200 | 3300038443 | Bacteria | 4335 |
| 158 | Ga0395901_0467533 | 3300038443 | Bacteria | 1288 |
| 159 | Ga0451853_2348089 | 3300041512 | Bacteria | 1741 |
| 160 | Ga0439431_0005543 | 3300041997 | Bacteria | 2785 |
| 161 | Ga0439442_015281 | 3300042002 | Bacteria | 1581 |
| 162 | Ga0439434_0014142 | 3300042435 | Bacteria | 2373 |
| 163 | Ga0466969_0049392 | 3300044656 | Bacteria | 2076 |
| 164 | Ga0466972_0036176 | 3300044658 | Bacteria | 2416 |
| 165 | Ga0466972_0036916 | 3300044658 | Bacteria | 2389 |
| 166 | Ga0466965_0013765 | 3300044683 | Bacteria | 3822 |
| 167 | Ga0466965_0034176 | 3300044683 | Bacteria | 2487 |
| 168 | Ga0466965_0126713 | 3300044683 | Bacteria | 1321 |
| 169 | Ga0466965_0136585 | 3300044683 | Bacteria | 1274 |
| 170 | Ga0466966_0020095 | 3300044684 | Bacteria | 4394 |
| 171 | Ga0466966_0033565 | 3300044684 | Bacteria | 3323 |
| 172 | Ga0466966_0118735 | 3300044684 | Bacteria | 1626 |
| 173 | Ga0466966_0121123 | 3300044684 | Bacteria | 1607 |
| 174 | Ga0466961_0106346 | 3300044693 | Bacteria | 1766 |
| 175 | Ga0466961_0112230 | 3300044693 | Bacteria | 1714 |
| 176 | Ga0466961_0150829 | 3300044693 | Bacteria | 1451 |
| 177 | Ga0466963_0017220 | 3300044694 | Bacteria | 4502 |
| 178 | Ga0466963_0064132 | 3300044694 | Bacteria | 2460 |
| 179 | Ga0466963_0069832 | 3300044694 | Bacteria | 2362 |
| 180 | Ga0466963_0157111 | 3300044694 | Bacteria | 1581 |
| 181 | Ga0466964_0008241 | 3300044706 | Bacteria | 3910 |
| 182 | Ga0466964_0039872 | 3300044706 | Bacteria | 1894 |
| 183 | Ga0466964_0104948 | 3300044706 | Bacteria | 1252 |
| 184 | Ga0466971_0051316 | 3300044719 | Bacteria | 1856 |
| 185 | Ga0466970_0014971 | 3300044765 | Bacteria | 3988 |
| 186 | Ga0466970_0015537 | 3300044765 | Bacteria | 3918 |
| 187 | Ga0466970_0119122 | 3300044765 | Bacteria | 1445 |
| 188 | Ga0466970_0194535 | 3300044765 | Bacteria | 1127 |
| 189 | Ga0466957_0041611 | 3300044842 | Bacteria | 2778 |
| 190 | Ga0466957_0064864 | 3300044842 | Bacteria | 2247 |
| 191 | Ga0466957_0068722 | 3300044842 | Bacteria | 2187 |
| 192 | Ga0466957_0104489 | 3300044842 | Bacteria | 1789 |
| 193 | Ga0466957_0121776 | 3300044842 | Bacteria | 1664 |
| 194 | Ga0466960_0004403 | 3300044901 | Bacteria | 5502 |
| 195 | Ga0466960_0038267 | 3300044901 | Bacteria | 2254 |
| 196 | Ga0466960_0044400 | 3300044901 | Bacteria | 2118 |
| 197 | Ga0466959_0098902 | 3300045049 | Bacteria | 2089 |
| 198 | Ga0466959_0104214 | 3300045049 | Bacteria | 2029 |
| 199 | Ga0451576_0540584 | 3300045051 | Bacteria | 1224 |
| 200 | Ga0466958_0028588 | 3300045836 | Bacteria | 3306 |
| 201 | Ga0466958_0108322 | 3300045836 | Bacteria | 1733 |
| 202 | Ga0466958_0196985 | 3300045836 | Bacteria | 1281 |
| 203 | Ga0466967_0088026 | 3300045976 | Bacteria | 2817 |
| 204 | Ga0466967_0089200 | 3300045976 | Bacteria | 2800 |
| 205 | Ga0466967_0093945 | 3300045976 | Bacteria | 2730 |
| 206 | Ga0466967_0127074 | 3300045976 | Bacteria | 2362 |
| 207 | Ga0466967_0133285 | 3300045976 | Bacteria | 2308 |
| 208 | Ga0466967_0224635 | 3300045976 | Bacteria | 1786 |
| 209 | Ga0495617_005675 | 3300046452 | Bacteria | 4412 |
| 210 | Ga0495627_064869 | 3300046453 | Bacteria | 1074 |
| 211 | Ga0495603_0002079 | 3300046455 | Bacteria | 11775 |
| 212 | Ga0495629_0001051 | 3300046459 | Bacteria | 22078 |
| 213 | Ga0495638_0043764 | 3300046460 | Bacteria | 2823 |
| 214 | Ga0495641_0028066 | 3300046461 | Bacteria | 2728 |
| 215 | Ga0495582_0014766 | 3300046473 | Bacteria | 4291 |
| 216 | Ga0495605_0028985 | 3300046474 | Bacteria | 2853 |
| 217 | Ga0495585_0027161 | 3300046492 | Bacteria | 3267 |
| 218 | Ga0495594_0002713 | 3300046499 | Bacteria | 9181 |
| 219 | Ga0495607_0005592 | 3300046501 | Bacteria | 8964 |
| 220 | Ga0495583_0016739 | 3300046506 | Bacteria | 3926 |
| 221 | Ga0495606_0019645 | 3300046507 | Bacteria | 5015 |
| 222 | Ga0495610_0007197 | 3300046512 | Bacteria | 7479 |
| 223 | Ga0495616_0012172 | 3300046513 | Bacteria | 4895 |
| 224 | Ga0495620_0009600 | 3300046515 | Bacteria | 5135 |
| 225 | Ga0495631_0012841 | 3300046518 | Bacteria | 4078 |
| 226 | Ga0495632_0132116 | 3300046519 | Bacteria | 1161 |
| 227 | Ga0495648_0043498 | 3300046524 | Bacteria | 2814 |
| 228 | Ga0495654_0077567 | 3300046530 | Bacteria | 1563 |
| 229 | Ga0495640_0171218 | 3300046533 | Bacteria | 1387 |
| 230 | Ga0495597_0003885 | 3300046542 | Bacteria | 8451 |
| 231 | Ga0495645_0107369 | 3300046543 | Bacteria | 1979 |
| 232 | Ga0495622_0019085 | 3300046557 | Bacteria | 3193 |
| 233 | Ga0495668_0017421 | 3300046616 | Bacteria | 4166 |
| 234 | Ga0495625_0029840 | 3300046660 | Bacteria | 4073 |
| 235 | Ga0495661_0066985 | 3300046665 | Bacteria | 2111 |
| 236 | Ga0495613_0053253 | 3300046689 | Bacteria | 2978 |
| 237 | Ga0495624_0006712 | 3300046690 | Bacteria | 8129 |
| 238 | Ga0495649_0003554 | 3300046694 | Bacteria | 10468 |
| 239 | Ga0495589_0002467 | 3300046794 | Bacteria | 10371 |
| 240 | Ga0495660_0062205 | 3300046810 | Bacteria | 2001 |
| 241 | Ga0495581_0037703 | 3300047315 | Bacteria | 2798 |
| 242 | Ga0495676_0008690 | 3300047321 | Bacteria | 9296 |
| 243 | Ga0495683_0024690 | 3300047323 | Bacteria | 3083 |
| 244 | Ga0495685_004349 | 3300047447 | Bacteria | 4570 |
| 245 | Ga0495686_0009414 | 3300047472 | Bacteria | 7038 |
| 246 | Ga0495614_0002372 | 3300048089 | Bacteria | 8383 |
| 247 | Ga0495626_0004843 | 3300048091 | Bacteria | 8108 |
| 248 | Ga0496100_0015111 | 3300048903 | Bacteria | 4503 |
| 249 | Ga0496101_0053853 | 3300048904 | Bacteria | 2904 |
| 250 | Ga0496103_0165029 | 3300048906 | Bacteria | 1421 |
| 251 | Ga0496105_0004428 | 3300048908 | Bacteria | 10575 |
| 252 | Ga0496106_0072088 | 3300048909 | Bacteria | 2641 |
| 253 | Ga0496107_0022866 | 3300048910 | Bacteria | 4419 |
| 254 | Ga0496107_0107573 | 3300048910 | Bacteria | 2048 |
| 255 | Ga0496108_0070759 | 3300048911 | Bacteria | 2944 |
| 256 | Ga0496108_0302517 | 3300048911 | Bacteria | 1393 |
| 257 | Ga0496109_0005602 | 3300048912 | Bacteria | 10510 |
| 258 | Ga0496109_0055797 | 3300048912 | Bacteria | 3604 |
| 259 | Ga0496109_0088441 | 3300048912 | Bacteria | 2863 |
| 260 | Ga0496109_0088833 | 3300048912 | Bacteria | 2856 |
| 261 | Ga0496109_0175481 | 3300048912 | Bacteria | 2011 |
| 262 | Ga0496110_0056929 | 3300048913 | Bacteria | 3440 |
| 263 | Ga0496111_0003009 | 3300048914 | Bacteria | 10322 |
| 264 | Ga0496111_0195306 | 3300048914 | Bacteria | 1504 |
| 265 | Ga0496113_0438143 | 3300048916 | Bacteria | 1050 |
| 266 | Ga0496114_0013047 | 3300048917 | Bacteria | 6658 |
| 267 | Ga0496114_0033736 | 3300048917 | Bacteria | 4219 |
| 268 | Ga0496114_0035967 | 3300048917 | Bacteria | 4092 |
| 269 | Ga0496114_0174778 | 3300048917 | Bacteria | 1873 |
| 270 | Ga0496114_0238742 | 3300048917 | Bacteria | 1598 |
| 271 | Ga0496115_0030416 | 3300048918 | Bacteria | 4248 |
| 272 | Ga0496124_0063289 | 3300048927 | Bacteria | 3091 |
| 273 | Ga0495678_023385 | 3300049459 | Bacteria | 2686 |
| 274 | Ga0495682_0016281 | 3300049460 | Bacteria | 2815 |
| 275 | Ga0501031_0025987 | 3300049568 | Bacteria | 3820 |
| 276 | Ga0501031_0104312 | 3300049568 | Bacteria | 1850 |
| 277 | Ga0501032_0012901 | 3300049569 | Bacteria | 5958 |
| 278 | Ga0501032_0026361 | 3300049569 | Bacteria | 3999 |
| 279 | Ga0501032_0106292 | 3300049569 | Bacteria | 1859 |
| 280 | Ga0501033_0029061 | 3300049570 | Bacteria | 4153 |
| 281 | Ga0501034_0096738 | 3300049571 | Bacteria | 2948 |
| 282 | Ga0501034_0158118 | 3300049571 | Bacteria | 2239 |
| 283 | Ga0501036_0066361 | 3300049572 | Bacteria | 3053 |
| 284 | Ga0501036_0173203 | 3300049572 | Bacteria | 1818 |
| 285 | Ga0501036_0217170 | 3300049572 | Bacteria | 1606 |
| 286 | Ga0501037_0120049 | 3300049573 | Bacteria | 1891 |
| 287 | Ga0501037_0156201 | 3300049573 | Bacteria | 1628 |
| 288 | Ga0501038_0319103 | 3300049574 | Bacteria | 1216 |
| 289 | Ga0501039_0042291 | 3300049575 | Bacteria | 3520 |
| 290 | Ga0501039_0076733 | 3300049575 | Bacteria | 2598 |
| 291 | Ga0501039_0106369 | 3300049575 | Bacteria | 2191 |
| 292 | Ga0501040_0018239 | 3300049576 | Bacteria | 4659 |
| 293 | Ga0501040_0026504 | 3300049576 | Bacteria | 3899 |
| 294 | Ga0501042_0017293 | 3300049578 | Bacteria | 4971 |
| 295 | Ga0501042_0038377 | 3300049578 | Bacteria | 3402 |
| 296 | Ga0501042_0098109 | 3300049578 | Bacteria | 2107 |
| 297 | Ga0501043_0102703 | 3300049579 | Bacteria | 2247 |
| 298 | Ga0501047_0048865 | 3300049581 | Bacteria | 4085 |
| 299 | Ga0501047_0103459 | 3300049581 | Bacteria | 2728 |
| 300 | Ga0501048_0037447 | 3300049582 | Bacteria | 3483 |
| 301 | Ga0501048_0200808 | 3300049582 | Bacteria | 1413 |
| 302 | Ga0501067_0003367 | 3300049583 | Bacteria | 8787 |
| 303 | Ga0501067_0005257 | 3300049583 | Bacteria | 7194 |
| 304 | Ga0501067_0042321 | 3300049583 | Bacteria | 2529 |
| 305 | Ga0501068_0007354 | 3300049584 | Bacteria | 6099 |
| 306 | Ga0501069_0044112 | 3300049585 | Bacteria | 2469 |
| 307 | Ga0501069_0305630 | 3300049585 | Bacteria | 933 |
| 308 | Ga0501070_0019318 | 3300049586 | Bacteria | 5715 |
| 309 | Ga0501070_0030880 | 3300049586 | Bacteria | 4488 |
| 310 | Ga0501070_0095479 | 3300049586 | Bacteria | 2460 |
| 311 | Ga0501070_0112849 | 3300049586 | Bacteria | 2246 |
| 312 | Ga0501070_0241930 | 3300049586 | Bacteria | 1477 |
| 313 | Ga0501070_0310205 | 3300049586 | Bacteria | 1284 |
| 314 | Ga0501070_0491833 | 3300049586 | Bacteria | 986 |
| 315 | Ga0501071_0012628 | 3300049587 | Bacteria | 5737 |
| 316 | Ga0501071_0029825 | 3300049587 | Bacteria | 3853 |
| 317 | Ga0501071_0100927 | 3300049587 | Bacteria | 2127 |
| 318 | Ga0501071_0101859 | 3300049587 | Bacteria | 2117 |
| 319 | Ga0501071_0117408 | 3300049587 | Bacteria | 1970 |
| 320 | Ga0501071_0257584 | 3300049587 | Bacteria | 1317 |
| 321 | Ga0501071_0524478 | 3300049587 | Bacteria | 909 |
| 322 | Ga0501072_0142272 | 3300049588 | Bacteria | 1913 |
| 323 | Ga0501072_0190325 | 3300049588 | Bacteria | 1636 |
| 324 | Ga0501074_0006551 | 3300049590 | Bacteria | 8414 |
| 325 | Ga0501074_0008495 | 3300049590 | Bacteria | 7440 |
| 326 | Ga0501074_0023083 | 3300049590 | Bacteria | 4524 |
| 327 | Ga0501074_0102446 | 3300049590 | Bacteria | 2049 |
| 328 | Ga0501075_0061326 | 3300049591 | Bacteria | 2834 |
| 329 | Ga0501075_0157165 | 3300049591 | Bacteria | 1734 |
| 330 | Ga0501076_0107178 | 3300049592 | Bacteria | 2256 |
| 331 | Ga0501077_0007031 | 3300049593 | Bacteria | 6940 |
| 332 | Ga0501079_0021057 | 3300049741 | Bacteria | 4985 |
| 333 | Ga0501079_0053259 | 3300049741 | Bacteria | 3122 |
| 334 | Ga0501079_0102974 | 3300049741 | Bacteria | 2214 |
| 335 | Ga0501079_0159837 | 3300049741 | Bacteria | 1757 |
| 336 | Ga0501079_0181320 | 3300049741 | Bacteria | 1643 |
| 337 | Ga0501080_0037226 | 3300049742 | Bacteria | 4542 |
| 338 | Ga0501081_0208022 | 3300049743 | Bacteria | 1420 |
| 339 | Ga0501083_0013273 | 3300049744 | Bacteria | 5759 |
| 340 | Ga0501083_0014664 | 3300049744 | Bacteria | 5479 |
| 341 | Ga0501279_015097 | 3300049775 | Bacteria | 1068 |
| 342 | Ga0501035_0005979 | 3300049822 | Bacteria | 11459 |
| 343 | Ga0501044_0234884 | 3300049823 | Bacteria | 1779 |
| 344 | Ga0501045_0032311 | 3300049824 | Bacteria | 3793 |
| 345 | Ga0501045_0086527 | 3300049824 | Bacteria | 2313 |
| 346 | Ga0501045_0244528 | 3300049824 | Bacteria | 1336 |
| 347 | Ga0501045_0356764 | 3300049824 | Bacteria | 1088 |
| 348 | nmdc:mga03n38_14845_c1 | 3300050490 | Bacteria | 2997 |
| 349 | nmdc:mga03n38_40039_c1 | 3300050490 | Bacteria | 2035 |
| 350 | nmdc:mga03n38_42868_c1 | 3300050490 | Bacteria | 1981 |
| 351 | nmdc:mga03n38_58738_c1 | 3300050490 | Bacteria | 1744 |
| 352 | nmdc:mga00v17_109961_c2 | 3300050491 | Bacteria | 1359 |
| 353 | nmdc:mga00v17_142945_c1 | 3300050491 | Bacteria | 1535 |
| 354 | nmdc:mga00v17_239663_c1 | 3300050491 | Bacteria | 1176 |
| 355 | nmdc:mga00v17_69054_c1 | 3300050491 | Bacteria | 2186 |
| 356 | nmdc:mga0yw44_100952_c1 | 3300050492 | Bacteria | 1838 |
| 357 | nmdc:mga0yw44_125627_c1 | 3300050492 | Bacteria | 1656 |
| 358 | nmdc:mga0yw44_20297_c1 | 3300050492 | Bacteria | 3685 |
| 359 | nmdc:mga0yw44_22401_c1 | 3300050492 | Bacteria | 3543 |
| 360 | nmdc:mga0yw44_227547_c1 | 3300050492 | Bacteria | 1237 |
| 361 | nmdc:mga0yw44_229092_c1 | 3300050492 | Bacteria | 1233 |
| 362 | nmdc:mga0yw44_268319_c1 | 3300050492 | Bacteria | 1139 |
| 363 | nmdc:mga0yw44_54794_c1 | 3300050492 | Bacteria | 2425 |
| 364 | nmdc:mga06z11_11150_c1 | 3300050494 | Bacteria | 3862 |
| 365 | nmdc:mga06z11_191673_c1 | 3300050494 | Bacteria | 1184 |
| 366 | nmdc:mga07m45_241326_c1 | 3300050496 | Bacteria | 1051 |
| 367 | nmdc:mga07m45_56031_c1 | 3300050496 | Bacteria | 2228 |
| 368 | nmdc:mga08y16_68783_c1 | 3300050511 | Bacteria | 3692 |
| 369 | Ga0495619_0038159 | 3300053085 | Bacteria | 3133 |
| 370 | Ga0500644_0000679 | 3300053088 | Bacteria | 12345 |
| 371 | Ga0500641_0014073 | 3300053096 | Bacteria | 2948 |
| 372 | Ga0500556_0000981 | 3300053104 | Bacteria | 15108 |
| 373 | Ga0500593_000172 | 3300053117 | Bacteria | 26252 |
| 374 | Ga0501084_0006860 | 3300054114 | Bacteria | 9376 |
| 375 | Ga0501084_0016119 | 3300054114 | Bacteria | 6204 |
| 376 | Ga0501084_0059308 | 3300054114 | Bacteria | 3203 |
| 377 | Ga0501082_0009518 | 3300060353 | Bacteria | 8360 |
| 378 | Ga0501082_0012234 | 3300060353 | Bacteria | 7374 |
| 379 | Ga0466962_0027470 | 3300061719 | Bacteria | 2731 |
| 380 | Ga0466962_0079404 | 3300061719 | Bacteria | 1568 |
| 381 | Ga0530510_0036945 | 3300061734 | Bacteria | 3520 |
| 382 | Ga0530510_0240303 | 3300061734 | Bacteria | 1348 |
| 383 | 2585321371 | 2582581314 | Bacteria | 11452267 |
| 384 | 2643823587 | 2643221561 | Bacteria | 4984412 |
| 385 | 2643888770 | 2643221576 | Bacteria | 5214352 |
| 386 | 2643957825 | 2643221590 | Bacteria | 5214697 |
| 387 | 2644034318 | 2643221604 | Bacteria | 5014917 |
| 388 | 2644093987 | 2643221615 | Bacteria | 5487866 |
| 389 | 2644098619 | 2643221617 | Bacteria | 5139111 |
| 390 | 2644114522 | 2643221620 | Bacteria | 5134593 |
| 391 | 2644232313 | 2643221641 | Bacteria | 4490190 |
| 392 | 2644323831 | 2643221657 | Bacteria | 5490246 |
| 393 | 2644535268 | 2643221696 | Bacteria | 5431823 |
| 394 | 2738869897 | 2738541305 | Bacteria | 4910150 |
| 395 | 2740169266 | 2739367898 | Bacteria | 4367674 |
| 396 | 2774392831 | 2773857762 | Bacteria | 5971770 |
| 397 | 2809196656 | 2808606439 | Bacteria | 5952208 |
| 398 | 2812332592 | 2811994874 | Bacteria | 5367947 |
| 399 | 2812351208 | 2811994878 | Bacteria | 5992952 |
| 400 | 2855391144 | 2855386786 | Bacteria | 4752232 |
| 401 | 2857485717 | 2857481737 | Bacteria | 4761446 |
| 402 | 2863072244 | 2863067949 | Bacteria | 8541735 |
| 403 | 2891971175 | 2891968417 | Bacteria | 5821697 |
| 404 | 8054613031 | 8054609563 | Bacteria | 5170090 |
| 405 | 8056835979 | 8056829672 | Bacteria | 9045328 |
| 406 | Ga0501048_0281826 | |||
| 407 | LJQas_1003142 | |||
| 408 | JGI24735J21928_10009738 | |||
| 409 | Ga0006562J51391_1140841 | |||
| 410 | Ga0070658_10059254 | |||
| 411 | Ga0070683_100018336 | |||
| 412 | Ga0070683_100107640 | |||
| 413 | Ga0070683_100331120 | |||
| 414 | Ga0070682_100018037 | |||
| 415 | Ga0070682_100128811 | |||
| 416 | Ga0070660_100003305 | |||
| 417 | Ga0070660_100103860 | |||
| 418 | Ga0070660_100164393 | |||
| 419 | Ga0070691_10142255 | |||
| 420 | Ga0070687_100031177 | |||
| 421 | Ga0070675_100133067 | |||
| 422 | Ga0070671_100368999 | |||
| 423 | Ga0070674_100010033 | |||
| 424 | Ga0070674_100286963 | |||
| 425 | Ga0070659_100089242 | |||
| 426 | Ga0070667_100037890 | |||
| 427 | Ga0070701_10031580 | |||
| 428 | Ga0070663_100053475 | |||
| 429 | Ga0070678_100040251 | |||
| 430 | Ga0068867_100036032 | |||
| 431 | Ga0070698_100001494 | |||
| 432 | Ga0070679_100031880 | |||
| 433 | Ga0070684_100008524 | |||
| 434 | Ga0070684_100126153 | |||
| 435 | Ga0068853_100064489 | |||
| 436 | Ga0070672_100035086 | |||
| 437 | Ga0070665_100009827 | |||
| 438 | Ga0068855_100241764 | |||
| 439 | Ga0070702_100038906 | |||
| 440 | Ga0070702_100107373 | |||
| 441 | Ga0068852_100140735 | |||
| 442 | Ga0068863_100004293 | |||
| 443 | Ga0068860_100001541 | |||
| 444 | Ga0075365_10000618 | |||
| 445 | Ga0075365_10020373 | |||
| 446 | Ga0075365_10022500 | |||
| 447 | Ga0075365_10041332 | |||
| 448 | Ga0075365_10053452 | |||
| 449 | Ga0075365_10119653 | |||
| 450 | Ga0075365_10213943 | |||
| 451 | Ga0075365_10293197 | |||
| 452 | Ga0075365_10350021 | |||
| 453 | Ga0075368_10001765 | |||
| 454 | Ga0075368_10012837 | |||
| 455 | Ga0075368_10089166 | |||
| 456 | Ga0075363_100062618 | |||
| 457 | Ga0075363_100153282 | |||
| 458 | Ga0075363_100210891 | |||
| 459 | Ga0075364_10030417 | |||
| 460 | Ga0075364_10034785 | |||
| 461 | Ga0075364_10059239 | |||
| 462 | Ga0075364_10073540 | |||
| 463 | Ga0075364_10125732 | |||
| 464 | Ga0075362_10111755 | |||
| 465 | Ga0075367_10031633 | |||
| 466 | Ga0075367_10042584 | |||
| 467 | Ga0075367_10130885 | |||
| 468 | Ga0075367_10164668 | |||
| 469 | Ga0075370_10010424 | |||
| 470 | Ga0075370_10024533 | |||
| 471 | Ga0075428_100104226 | |||
| 472 | Ga0068865_100017374 | |||
| 473 | Ga0111539_10046733 | |||
| 474 | Ga0111539_10164849 | |||
| 475 | Ga0105245_10006602 | |||
| 476 | Ga0105245_10024490 | |||
| 477 | Ga0105243_10062066 | |||
| 478 | Ga0105243_10099417 | |||
| 479 | Ga0105248_10819034 | |||
| 480 | Ga0105237_10265455 | |||
| 481 | Ga0105238_10266091 | |||
| 482 | Ga0105249_10075993 | |||
| 483 | Ga0105249_10108709 | |||
| 484 | Ga0105249_10152018 | |||
| 485 | Ga0105239_10096396 | |||
| 486 | Ga0105239_10379940 | |||
| 487 | Ga0105239_10613417 | |||
| 488 | Ga0105239_10916155 | |||
| 489 | Ga0105246_10010188 | |||
| 490 | Ga0105246_10245517 | |||
| 491 | Ga0157372_10044921 | |||
| 492 | Ga0157375_10098214 | |||
| 493 | Ga0157375_10223570 | |||
| 494 | Ga0163163_10723589 | |||
| 495 | Ga0157380_10037943 | |||
| 496 | Ga0163161_10069206 | |||
| 497 | Ga0206353_10363779 | |||
| 498 | Ga0206353_10973789 | |||
| 499 | Ga0207647_10031477 | |||
| 500 | Ga0207643_10002264 | |||
| 501 | Ga0207705_10203037 | |||
| 502 | Ga0207662_10067863 | |||
| 503 | Ga0207662_10077355 | |||
| 504 | Ga0207657_10007406 | |||
| 505 | Ga0207657_10049700 | |||
| 506 | Ga0207659_10097769 | |||
| 507 | Ga0207659_10168806 | |||
| 508 | Ga0207690_10005350 | |||
| 509 | Ga0207706_10172915 | |||
| 510 | Ga0207709_10119322 | |||
| 511 | Ga0207709_10261197 | |||
| 512 | Ga0207704_10044232 | |||
| 513 | Ga0207704_10216205 | |||
| 514 | Ga0207691_10001201 | |||
| 515 | Ga0207661_10107326 | |||
| 516 | Ga0207661_10381770 | |||
| 517 | Ga0207661_10499955 | |||
| 518 | Ga0207679_10030572 | |||
| 519 | Ga0207679_10099338 | |||
| 520 | Ga0207679_10158822 | |||
| 521 | Ga0207651_10396685 | |||
| 522 | Ga0207712_10084081 | |||
| 523 | Ga0207712_10127680 | |||
| 524 | Ga0207658_10222709 | |||
| 525 | Ga0207639_10167140 | |||
| 526 | Ga0207678_10332984 | |||
| 527 | Ga0207708_10000513 | |||
| 528 | Ga0207648_10153184 | |||
| 529 | Ga0207675_100004561 | |||
| 530 | Ga0207675_100354918 | |||
| 531 | Ga0207698_10446288 | |||
| 532 | Ga0209813_10000804 | |||
| 533 | Ga0268266_10019422 | |||
| 534 | Ga0268266_10281386 | |||
| 535 | Ga0268265_10058996 | |||
| 536 | Ga0268264_10001453 | |||
| 537 | Ga0316579_10121431 | |||
| 538 | Ga0316576_10032091 | |||
| 539 | Ga0307405_10082756 | |||
| 540 | Ga0307413_10410243 | |||
| 541 | Ga0307410_10057184 | |||
| 542 | Ga0307410_10337832 | |||
| 543 | Ga0307407_10066484 | |||
| 544 | Ga0307407_10296101 | |||
| 545 | Ga0307412_10438520 | |||
| 546 | Ga0307409_100041121 | |||
| 547 | Ga0307409_100466939 | |||
| 548 | Ga0307416_100015342 | |||
| 549 | Ga0307416_100107302 | |||
| 550 | Ga0307416_100327783 | |||
| 551 | Ga0307414_10057169 | |||
| 552 | Ga0307411_10152914 | |||
| 553 | Ga0307411_10157820 | |||
| 554 | Ga0307411_10180755 | |||
| 555 | Ga0307415_100096140 | |||
| 556 | Ga0307507_10070140 | |||
| 557 | Ga0395900_0071170 | |||
| 558 | Ga0395898_0053418 | |||
| 559 | Ga0395905_0600995 | |||
| 560 | Ga0436364_1428798 | |||
| 561 | Ga0395901_0015285 | |||
| 562 | Ga0395901_0050200 | |||
| 563 | Ga0395901_0467533 | |||
| 564 | Ga0451853_2348089 | |||
| 565 | Ga0439431_0005543 | |||
| 566 | Ga0439442_015281 | |||
| 567 | Ga0439434_0014142 | |||
| 568 | Ga0466969_0049392 | |||
| 569 | Ga0466972_0036176 | |||
| 570 | Ga0466972_0036916 | |||
| 571 | Ga0466965_0013765 | |||
| 572 | Ga0466965_0034176 | |||
| 573 | Ga0466965_0126713 | |||
| 574 | Ga0466965_0136585 | |||
| 575 | Ga0466966_0020095 | |||
| 576 | Ga0466966_0033565 | |||
| 577 | Ga0466966_0118735 | |||
| 578 | Ga0466966_0121123 | |||
| 579 | Ga0466961_0106346 | |||
| 580 | Ga0466961_0112230 | |||
| 581 | Ga0466961_0150829 | |||
| 582 | Ga0466963_0017220 | |||
| 583 | Ga0466963_0064132 | |||
| 584 | Ga0466963_0069832 | |||
| 585 | Ga0466963_0157111 | |||
| 586 | Ga0466964_0008241 | |||
| 587 | Ga0466964_0039872 | |||
| 588 | Ga0466964_0104948 | |||
| 589 | Ga0466971_0051316 | |||
| 590 | Ga0466970_0014971 | |||
| 591 | Ga0466970_0015537 | |||
| 592 | Ga0466970_0119122 | |||
| 593 | Ga0466970_0194535 | |||
| 594 | Ga0466957_0041611 | |||
| 595 | Ga0466957_0064864 | |||
| 596 | Ga0466957_0068722 | |||
| 597 | Ga0466957_0104489 | |||
| 598 | Ga0466957_0121776 | |||
| 599 | Ga0466960_0004403 | |||
| 600 | Ga0466960_0038267 | |||
| 601 | Ga0466960_0044400 | |||
| 602 | Ga0466959_0098902 | |||
| 603 | Ga0466959_0104214 | |||
| 604 | Ga0451576_0540584 | |||
| 605 | Ga0466958_0028588 | |||
| 606 | Ga0466958_0108322 | |||
| 607 | Ga0466958_0196985 | |||
| 608 | Ga0466967_0088026 | |||
| 609 | Ga0466967_0089200 | |||
| 610 | Ga0466967_0093945 | |||
| 611 | Ga0466967_0127074 | |||
| 612 | Ga0466967_0133285 | |||
| 613 | Ga0466967_0224635 | |||
| 614 | Ga0495617_005675 | |||
| 615 | Ga0495627_064869 | |||
| 616 | Ga0495603_0002079 | |||
| 617 | Ga0495629_0001051 | |||
| 618 | Ga0495638_0043764 | |||
| 619 | Ga0495641_0028066 | |||
| 620 | Ga0495582_0014766 | |||
| 621 | Ga0495605_0028985 | |||
| 622 | Ga0495585_0027161 | |||
| 623 | Ga0495594_0002713 | |||
| 624 | Ga0495607_0005592 | |||
| 625 | Ga0495583_0016739 | |||
| 626 | Ga0495606_0019645 | |||
| 627 | Ga0495610_0007197 | |||
| 628 | Ga0495616_0012172 | |||
| 629 | Ga0495620_0009600 | |||
| 630 | Ga0495631_0012841 | |||
| 631 | Ga0495632_0132116 | |||
| 632 | Ga0495648_0043498 | |||
| 633 | Ga0495654_0077567 | |||
| 634 | Ga0495640_0171218 | |||
| 635 | Ga0495597_0003885 | |||
| 636 | Ga0495645_0107369 | |||
| 637 | Ga0495622_0019085 | |||
| 638 | Ga0495668_0017421 | |||
| 639 | Ga0495625_0029840 | |||
| 640 | Ga0495661_0066985 | |||
| 641 | Ga0495613_0053253 | |||
| 642 | Ga0495624_0006712 | |||
| 643 | Ga0495649_0003554 | |||
| 644 | Ga0495589_0002467 | |||
| 645 | Ga0495660_0062205 | |||
| 646 | Ga0495581_0037703 | |||
| 647 | Ga0495676_0008690 | |||
| 648 | Ga0495683_0024690 | |||
| 649 | Ga0495685_004349 | |||
| 650 | Ga0495686_0009414 | |||
| 651 | Ga0495614_0002372 | |||
| 652 | Ga0495626_0004843 | |||
| 653 | Ga0496100_0015111 | |||
| 654 | Ga0496101_0053853 | |||
| 655 | Ga0496103_0165029 | |||
| 656 | Ga0496105_0004428 | |||
| 657 | Ga0496106_0072088 | |||
| 658 | Ga0496107_0022866 | |||
| 659 | Ga0496107_0107573 | |||
| 660 | Ga0496108_0070759 | |||
| 661 | Ga0496108_0302517 | |||
| 662 | Ga0496109_0005602 | |||
| 663 | Ga0496109_0055797 | |||
| 664 | Ga0496109_0088441 | |||
| 665 | Ga0496109_0088833 | |||
| 666 | Ga0496109_0175481 | |||
| 667 | Ga0496110_0056929 | |||
| 668 | Ga0496111_0003009 | |||
| 669 | Ga0496111_0195306 | |||
| 670 | Ga0496113_0438143 | |||
| 671 | Ga0496114_0013047 | |||
| 672 | Ga0496114_0033736 | |||
| 673 | Ga0496114_0035967 | |||
| 674 | Ga0496114_0174778 | |||
| 675 | Ga0496114_0238742 | |||
| 676 | Ga0496115_0030416 | |||
| 677 | Ga0496124_0063289 | |||
| 678 | Ga0495678_023385 | |||
| 679 | Ga0495682_0016281 | |||
| 680 | Ga0501031_0025987 | |||
| 681 | Ga0501031_0104312 | |||
| 682 | Ga0501032_0012901 | |||
| 683 | Ga0501032_0026361 | |||
| 684 | Ga0501032_0106292 | |||
| 685 | Ga0501033_0029061 | |||
| 686 | Ga0501034_0096738 | |||
| 687 | Ga0501034_0158118 | |||
| 688 | Ga0501036_0066361 | |||
| 689 | Ga0501036_0173203 | |||
| 690 | Ga0501036_0217170 | |||
| 691 | Ga0501037_0120049 | |||
| 692 | Ga0501037_0156201 | |||
| 693 | Ga0501038_0319103 | |||
| 694 | Ga0501039_0042291 | |||
| 695 | Ga0501039_0076733 | |||
| 696 | Ga0501039_0106369 | |||
| 697 | Ga0501040_0018239 | |||
| 698 | Ga0501040_0026504 | |||
| 699 | Ga0501042_0017293 | |||
| 700 | Ga0501042_0038377 | |||
| 701 | Ga0501042_0098109 | |||
| 702 | Ga0501043_0102703 | |||
| 703 | Ga0501047_0048865 | |||
| 704 | Ga0501047_0103459 | |||
| 705 | Ga0501048_0037447 | |||
| 706 | Ga0501048_0200808 | |||
| 707 | Ga0501067_0003367 | |||
| 708 | Ga0501067_0005257 | |||
| 709 | Ga0501067_0042321 | |||
| 710 | Ga0501068_0007354 | |||
| 711 | Ga0501069_0044112 | |||
| 712 | Ga0501069_0305630 | |||
| 713 | Ga0501070_0019318 | |||
| 714 | Ga0501070_0030880 | |||
| 715 | Ga0501070_0095479 | |||
| 716 | Ga0501070_0112849 | |||
| 717 | Ga0501070_0241930 | |||
| 718 | Ga0501070_0310205 | |||
| 719 | Ga0501070_0491833 | |||
| 720 | Ga0501071_0012628 | |||
| 721 | Ga0501071_0029825 | |||
| 722 | Ga0501071_0100927 | |||
| 723 | Ga0501071_0101859 | |||
| 724 | Ga0501071_0117408 | |||
| 725 | Ga0501071_0257584 | |||
| 726 | Ga0501071_0524478 | |||
| 727 | Ga0501072_0142272 | |||
| 728 | Ga0501072_0190325 | |||
| 729 | Ga0501074_0006551 | |||
| 730 | Ga0501074_0008495 | |||
| 731 | Ga0501074_0023083 | |||
| 732 | Ga0501074_0102446 | |||
| 733 | Ga0501075_0061326 | |||
| 734 | Ga0501075_0157165 | |||
| 735 | Ga0501076_0107178 | |||
| 736 | Ga0501077_0007031 | |||
| 737 | Ga0501079_0021057 | |||
| 738 | Ga0501079_0053259 | |||
| 739 | Ga0501079_0102974 | |||
| 740 | Ga0501079_0159837 | |||
| 741 | Ga0501079_0181320 | |||
| 742 | Ga0501080_0037226 | |||
| 743 | Ga0501081_0208022 | |||
| 744 | Ga0501083_0013273 | |||
| 745 | Ga0501083_0014664 | |||
| 746 | Ga0501279_015097 | |||
| 747 | Ga0501035_0005979 | |||
| 748 | Ga0501044_0234884 | |||
| 749 | Ga0501045_0032311 | |||
| 750 | Ga0501045_0086527 | |||
| 751 | Ga0501045_0244528 | |||
| 752 | Ga0501045_0356764 | |||
| 753 | nmdc:mga03n38_14845_c1 | |||
| 754 | nmdc:mga03n38_40039_c1 | |||
| 755 | nmdc:mga03n38_42868_c1 | |||
| 756 | nmdc:mga03n38_58738_c1 | |||
| 757 | nmdc:mga00v17_109961_c2 | |||
| 758 | nmdc:mga00v17_142945_c1 | |||
| 759 | nmdc:mga00v17_239663_c1 | |||
| 760 | nmdc:mga00v17_69054_c1 | |||
| 761 | nmdc:mga0yw44_100952_c1 | |||
| 762 | nmdc:mga0yw44_125627_c1 | |||
| 763 | nmdc:mga0yw44_20297_c1 | |||
| 764 | nmdc:mga0yw44_22401_c1 | |||
| 765 | nmdc:mga0yw44_227547_c1 | |||
| 766 | nmdc:mga0yw44_229092_c1 | |||
| 767 | nmdc:mga0yw44_268319_c1 | |||
| 768 | nmdc:mga0yw44_54794_c1 | |||
| 769 | nmdc:mga06z11_11150_c1 | |||
| 770 | nmdc:mga06z11_191673_c1 | |||
| 771 | nmdc:mga07m45_241326_c1 | |||
| 772 | nmdc:mga07m45_56031_c1 | |||
| 773 | nmdc:mga08y16_68783_c1 | |||
| 774 | Ga0495619_0038159 | |||
| 775 | Ga0500644_0000679 | |||
| 776 | Ga0500641_0014073 | |||
| 777 | Ga0500556_0000981 | |||
| 778 | Ga0500593_000172 | |||
| 779 | Ga0501084_0006860 | |||
| 780 | Ga0501084_0016119 | |||
| 781 | Ga0501084_0059308 | |||
| 782 | Ga0501082_0009518 | |||
| 783 | Ga0501082_0012234 | |||
| 784 | Ga0466962_0027470 | |||
| 785 | Ga0466962_0079404 | |||
| 786 | Ga0530510_0036945 | |||
| 787 | Ga0530510_0240303 | |||
| 788 | 2585321371 | |||
| 789 | 2643823587 | |||
| 790 | 2643888770 | |||
| 791 | 2643957825 | |||
| 792 | 2644034318 | |||
| 793 | 2644093987 | |||
| 794 | 2644098619 | |||
| 795 | 2644114522 | |||
| 796 | 2644232313 | |||
| 797 | 2644323831 | |||
| 798 | 2644535268 | |||
| 799 | 2738869897 | |||
| 800 | 2740169266 | |||
| 801 | 2774392831 | |||
| 802 | 2809196656 | |||
| 803 | 2812332592 | |||
| 804 | 2812351208 | |||
| 805 | 2855391144 | |||
| 806 | 2857485717 | |||
| 807 | 2863072244 | |||
| 808 | 2891971175 | |||
| 809 | 8054613031 | |||
| 810 | 8056835979 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7nly-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis argb in complex with 2-chlorobenzimidazole. | 0.9589 | 8 | 295 |
| 2ap9-assembly1.cif.gz_B | crystal structure of acetylglutamate kinase from mycobacterium tuberculosis cdc1551 | 0.9588 | 8 | 296 |
| 2ap9-assembly1.cif.gz_B | crystal structure of acetylglutamate kinase from mycobacterium tuberculosis cdc1551 | 0.946 | 8 | 296 |
| 7nly-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis argb in complex with 2-chlorobenzimidazole. | 0.9398 | 8 | 295 |
| 2buf-assembly1.cif.gz_F | arginine feed-back inhibitable acetylglutamate kinase | 0.9386 | 11 | 294 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WQ01_4_294_3.40.1160.10 | Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like | 0.9822 | 8 | 295 | 3.40.1160.10 |
| af_P9WQ01_4_294_3.40.1160.10 | Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like | 0.9688 | 8 | 295 | 3.40.1160.10 |
| 2v5hF00 | Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like | 0.9434 | 6 | 296 | 3.40.1160.10 |
| 2v5hF00 | Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like | 0.9402 | 6 | 296 | 3.40.1160.10 |
| 1uvdA00 | Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like | 0.9245 | 11 | 297 | 3.40.1160.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6G7XPP0-F1-model_v4 | Acetylglutamate kinase (EC 2.7.2.8) (N-acetyl-L-glutamate 5-phosphotransferase) (NAG kinase) (NAGK) | 0.998 | 11 | 305 |
GO:0003991
GO:0005524 GO:0005737 GO:0006526 GO:0042450 |
| AF-A0A4S5E2E5-F1-model_v4 | acetylglutamate kinase (EC 2.7.2.8) | 0.992 | 26 | 294 |
GO:0003991
GO:0005524 GO:0005737 GO:0006526 |
| AF-A0A7K0TQ66-F1-model_v4 | Acetylglutamate kinase (EC 2.7.2.8) (N-acetyl-L-glutamate 5-phosphotransferase) (NAG kinase) (NAGK) | 0.991 | 31 | 293 |
GO:0003991
GO:0005524 GO:0005737 GO:0006526 GO:0042450 |
| AF-D2PM79-F1-model_v4 | Acetylglutamate kinase (EC 2.7.2.8) (N-acetyl-L-glutamate 5-phosphotransferase) (NAG kinase) (NAGK) | 0.9897 | 6 | 295 |
GO:0003991
GO:0005524 GO:0005737 GO:0006526 GO:0042450 |
| AF-A0A2V5L4X3-F1-model_v4 | Acetylglutamate kinase (EC 2.7.2.8) (N-acetyl-L-glutamate 5-phosphotransferase) (NAG kinase) (NAGK) | 0.9893 | 11 | 297 |
GO:0003991
GO:0005524 GO:0005737 GO:0006526 GO:0042450 |