F436061

General Info

Members Datasets Scaffolds Average Seq Length
405 240 810 301

Family's Representative Sequence

Representative Sequence 3300049582|Ga0501048_0281826|Ga0501048_0281826_37_1035
Length 332
Sequence MTTPRNRETGALRAEARASAGTPEKTSDKRIEADVLAAALPWLKAYNGKIVVIKYGGNAMTDDALKRAFAEDVAFLRFAGFKPVVVHGGGPQISQMLDRLGIESEFRGGLRVTTPEAMDVVRMVLVGQVQRELVGLINEHGPLAVGLSGEDAGLFTAKQTNTVVDGEEVDLGLVGEVVDVRPEAVLDIIEAGRIPVVSSVAPDVQGTVHNVNADSAAAXLAVALEAEKLLVLTDVEGLFLDWPTSQDVIGEISPEALAKILPTLESGMVPKMKACLDAVQSGVSRATVVDGREPHAVLLELFTQEGVGTQVLPDVETKTRRARAASEAEATS

Samples

Sample ID Description Type Environment
1 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
82 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
83 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
84 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
85 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
86 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
100 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
101 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
102 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
103 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
104 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
105 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
106 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
107 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
108 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
109 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
110 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
111 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
119 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
120 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
123 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
124 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
125 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
126 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
127 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
128 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
129 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
130 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
131 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
132 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
133 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
134 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
135 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
136 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
137 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
138 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
139 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
140 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
141 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
142 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
143 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
144 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
145 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
146 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
147 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
148 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
149 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
150 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
151 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
152 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
153 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
154 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
155 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
156 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
157 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
171 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
172 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
173 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
186 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
187 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
195 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
198 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
199 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
203 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
204 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
205 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
206 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
207 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
210 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
211 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
212 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
213 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
214 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
215 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
216 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
217 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
218 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
219 2643221561 Nocardioides sp. Root151 Isolate Unclassified
220 2643221576 Nocardioides sp. Root614 Isolate Unclassified
221 2643221590 Nocardioides sp. Root682 Isolate Unclassified
222 2643221604 Nocardioides sp. Root190 Isolate Unclassified
223 2643221615 Nocardioides sp. Root224 Isolate Unclassified
224 2643221617 Nocardioides sp. Root79 Isolate Unclassified
225 2643221620 Nocardioides sp. Root240 Isolate Unclassified
226 2643221641 Nocardioides sp. Root122 Isolate Unclassified
227 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
228 2643221696 Nocardioides sp. Root140 Isolate Unclassified
229 2738541305 Nocardioides sp. CF167 Isolate Unclassified
230 2739367898 Nocardioides sp. CF479 Isolate Unclassified
231 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
232 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
233 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
234 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
235 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
236 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
237 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
238 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
239 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
240 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.58
Metatranscriptomes 0.74
Isolates 5.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.84
Nodule 0.25
Rhizoplane 5.93
Rhizosphere 75.06
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501048_0281826 3300049582 Bacteria 1182
2 LJQas_1003142 3300000549 Bacteria 2228
3 JGI24735J21928_10009738 3300002067 Bacteria 3078
4 Ga0006562J51391_1140841 3300003578 Bacteria 2800
5 Ga0070658_10059254 3300005327 Bacteria 3118
6 Ga0070683_100018336 3300005329 Bacteria 6196
7 Ga0070683_100107640 3300005329 Bacteria 2629
8 Ga0070683_100331120 3300005329 Bacteria 1450
9 Ga0070682_100018037 3300005337 Bacteria 4119
10 Ga0070682_100128811 3300005337 Bacteria 1710
11 Ga0070660_100003305 3300005339 Bacteria 11084
12 Ga0070660_100103860 3300005339 Bacteria 2254
13 Ga0070660_100164393 3300005339 Bacteria 1790
14 Ga0070691_10142255 3300005341 Bacteria 1223
15 Ga0070687_100031177 3300005343 Bacteria 2614
16 Ga0070675_100133067 3300005354 Bacteria 2121
17 Ga0070671_100368999 3300005355 Bacteria 1226
18 Ga0070674_100010033 3300005356 Bacteria 5703
19 Ga0070674_100286963 3300005356 Bacteria 1307
20 Ga0070659_100089242 3300005366 Bacteria 2469
21 Ga0070667_100037890 3300005367 Bacteria 4043
22 Ga0070701_10031580 3300005438 Bacteria 2628
23 Ga0070663_100053475 3300005455 Bacteria 2883
24 Ga0070678_100040251 3300005456 Bacteria 3306
25 Ga0068867_100036032 3300005459 Bacteria 3590
26 Ga0070698_100001494 3300005471 Bacteria 25962
27 Ga0070679_100031880 3300005530 Bacteria 5210
28 Ga0070684_100008524 3300005535 Bacteria 8021
29 Ga0070684_100126153 3300005535 Bacteria 2305
30 Ga0068853_100064489 3300005539 Bacteria 3177
31 Ga0070672_100035086 3300005543 Bacteria 3810
32 Ga0070665_100009827 3300005548 Bacteria 9671
33 Ga0068855_100241764 3300005563 Bacteria 2017
34 Ga0070702_100038906 3300005615 Bacteria 2652
35 Ga0070702_100107373 3300005615 Bacteria 1724
36 Ga0068852_100140735 3300005616 Bacteria 2232
37 Ga0068863_100004293 3300005841 Bacteria 14035
38 Ga0068860_100001541 3300005843 Bacteria 24832
39 Ga0075365_10000618 3300006038 Bacteria 14004
40 Ga0075365_10020373 3300006038 Bacteria 4111
41 Ga0075365_10022500 3300006038 Bacteria 3950
42 Ga0075365_10041332 3300006038 Bacteria 3011
43 Ga0075365_10053452 3300006038 Bacteria 2675
44 Ga0075365_10119653 3300006038 Bacteria 1816
45 Ga0075365_10213943 3300006038 Bacteria 1352
46 Ga0075365_10293197 3300006038 Bacteria 1145
47 Ga0075365_10350021 3300006038 Bacteria 1041
48 Ga0075368_10001765 3300006042 Bacteria 6960
49 Ga0075368_10012837 3300006042 Bacteria 3068
50 Ga0075368_10089166 3300006042 Bacteria 1261
51 Ga0075363_100062618 3300006048 Bacteria 2006
52 Ga0075363_100153282 3300006048 Bacteria 1302
53 Ga0075363_100210891 3300006048 Bacteria 1112
54 Ga0075364_10030417 3300006051 Bacteria 3465
55 Ga0075364_10034785 3300006051 Bacteria 3253
56 Ga0075364_10059239 3300006051 Bacteria 2510
57 Ga0075364_10073540 3300006051 Bacteria 2253
58 Ga0075364_10125732 3300006051 Bacteria 1719
59 Ga0075362_10111755 3300006177 Bacteria 1286
60 Ga0075367_10031633 3300006178 Bacteria 3039
61 Ga0075367_10042584 3300006178 Bacteria 2657
62 Ga0075367_10130885 3300006178 Bacteria 1551
63 Ga0075367_10164668 3300006178 Bacteria 1379
64 Ga0075370_10010424 3300006353 Bacteria 4860
65 Ga0075370_10024533 3300006353 Bacteria 3332
66 Ga0075428_100104226 3300006844 Bacteria 3093
67 Ga0068865_100017374 3300006881 Bacteria 4627
68 Ga0111539_10046733 3300009094 Bacteria 5177
69 Ga0111539_10164849 3300009094 Bacteria 2591
70 Ga0105245_10006602 3300009098 Bacteria 10185
71 Ga0105245_10024490 3300009098 Bacteria 5300
72 Ga0105243_10062066 3300009148 Bacteria 2991
73 Ga0105243_10099417 3300009148 Bacteria 2411
74 Ga0105248_10819034 3300009177 Bacteria 1051
75 Ga0105237_10265455 3300009545 Bacteria 1720
76 Ga0105238_10266091 3300009551 Bacteria 1694
77 Ga0105249_10075993 3300009553 Bacteria 3112
78 Ga0105249_10108709 3300009553 Bacteria 2618
79 Ga0105249_10152018 3300009553 Bacteria 2229
80 Ga0105239_10096396 3300010375 Bacteria 3268
81 Ga0105239_10379940 3300010375 Bacteria 1597
82 Ga0105239_10613417 3300010375 Bacteria 1241
83 Ga0105239_10916155 3300010375 Bacteria 1006
84 Ga0105246_10010188 3300011119 Bacteria 5806
85 Ga0105246_10245517 3300011119 Bacteria 1418
86 Ga0157372_10044921 3300013307 Bacteria 4897
87 Ga0157375_10098214 3300013308 Bacteria 3004
88 Ga0157375_10223570 3300013308 Bacteria 2041
89 Ga0163163_10723589 3300014325 Bacteria 1059
90 Ga0157380_10037943 3300014326 Bacteria 3738
91 Ga0163161_10069206 3300017792 Bacteria 2580
92 Ga0206353_10363779 3300020082 Bacteria 1978
93 Ga0206353_10973789 3300020082 Bacteria 1726
94 Ga0207647_10031477 3300025904 Bacteria 3414
95 Ga0207643_10002264 3300025908 Bacteria 10488
96 Ga0207705_10203037 3300025909 Bacteria 1502
97 Ga0207662_10067863 3300025918 Bacteria 2152
98 Ga0207662_10077355 3300025918 Bacteria 2024
99 Ga0207657_10007406 3300025919 Bacteria 11252
100 Ga0207657_10049700 3300025919 Bacteria 3652
101 Ga0207659_10097769 3300025926 Bacteria 2206
102 Ga0207659_10168806 3300025926 Bacteria 1725
103 Ga0207690_10005350 3300025932 Bacteria 7566
104 Ga0207706_10172915 3300025933 Bacteria 1898
105 Ga0207709_10119322 3300025935 Bacteria 1778
106 Ga0207709_10261197 3300025935 Bacteria 1270
107 Ga0207704_10044232 3300025938 Bacteria 2636
108 Ga0207704_10216205 3300025938 Bacteria 1414
109 Ga0207691_10001201 3300025940 Bacteria 25783
110 Ga0207661_10107326 3300025944 Bacteria 2355
111 Ga0207661_10381770 3300025944 Bacteria 1275
112 Ga0207661_10499955 3300025944 Bacteria 1111
113 Ga0207679_10030572 3300025945 Bacteria 3762
114 Ga0207679_10099338 3300025945 Bacteria 2272
115 Ga0207679_10158822 3300025945 Bacteria 1849
116 Ga0207651_10396685 3300025960 Bacteria 1173
117 Ga0207712_10084081 3300025961 Bacteria 2324
118 Ga0207712_10127680 3300025961 Bacteria 1933
119 Ga0207658_10222709 3300025986 Bacteria 1588
120 Ga0207639_10167140 3300026041 Bacteria 1859
121 Ga0207678_10332984 3300026067 Bacteria 1307
122 Ga0207708_10000513 3300026075 Bacteria 29912
123 Ga0207648_10153184 3300026089 Bacteria 2034
124 Ga0207675_100004561 3300026118 Bacteria 13362
125 Ga0207675_100354918 3300026118 Bacteria 1438
126 Ga0207698_10446288 3300026142 Bacteria 1248
127 Ga0209813_10000804 3300027866 Bacteria 7117
128 Ga0268266_10019422 3300028379 Bacteria 5787
129 Ga0268266_10281386 3300028379 Bacteria 1547
130 Ga0268265_10058996 3300028380 Bacteria 2934
131 Ga0268264_10001453 3300028381 Bacteria 22147
132 Ga0316579_10121431 3300031691 Bacteria 1256
133 Ga0316576_10032091 3300031727 Bacteria 3731
134 Ga0307405_10082756 3300031731 Bacteria 2102
135 Ga0307413_10410243 3300031824 Bacteria 1064
136 Ga0307410_10057184 3300031852 Bacteria 2655
137 Ga0307410_10337832 3300031852 Bacteria 1200
138 Ga0307407_10066484 3300031903 Bacteria 2126
139 Ga0307407_10296101 3300031903 Bacteria 1126
140 Ga0307412_10438520 3300031911 Bacteria 1073
141 Ga0307409_100041121 3300031995 Bacteria 3449
142 Ga0307409_100466939 3300031995 Bacteria 1221
143 Ga0307416_100015342 3300032002 Bacteria 5290
144 Ga0307416_100107302 3300032002 Bacteria 2450
145 Ga0307416_100327783 3300032002 Bacteria 1537
146 Ga0307414_10057169 3300032004 Bacteria 2741
147 Ga0307411_10152914 3300032005 Bacteria 1717
148 Ga0307411_10157820 3300032005 Bacteria 1695
149 Ga0307411_10180755 3300032005 Bacteria 1601
150 Ga0307415_100096140 3300032126 Bacteria 2158
151 Ga0307507_10070140 3300033179 Bacteria 3182
152 Ga0395900_0071170 3300037418 Bacteria 3575
153 Ga0395898_0053418 3300037466 Bacteria 3946
154 Ga0395905_0600995 3300037471 Bacteria 1002
155 Ga0436364_1428798 3300037853 Bacteria 3501
156 Ga0395901_0015285 3300038443 Bacteria 7810
157 Ga0395901_0050200 3300038443 Bacteria 4335
158 Ga0395901_0467533 3300038443 Bacteria 1288
159 Ga0451853_2348089 3300041512 Bacteria 1741
160 Ga0439431_0005543 3300041997 Bacteria 2785
161 Ga0439442_015281 3300042002 Bacteria 1581
162 Ga0439434_0014142 3300042435 Bacteria 2373
163 Ga0466969_0049392 3300044656 Bacteria 2076
164 Ga0466972_0036176 3300044658 Bacteria 2416
165 Ga0466972_0036916 3300044658 Bacteria 2389
166 Ga0466965_0013765 3300044683 Bacteria 3822
167 Ga0466965_0034176 3300044683 Bacteria 2487
168 Ga0466965_0126713 3300044683 Bacteria 1321
169 Ga0466965_0136585 3300044683 Bacteria 1274
170 Ga0466966_0020095 3300044684 Bacteria 4394
171 Ga0466966_0033565 3300044684 Bacteria 3323
172 Ga0466966_0118735 3300044684 Bacteria 1626
173 Ga0466966_0121123 3300044684 Bacteria 1607
174 Ga0466961_0106346 3300044693 Bacteria 1766
175 Ga0466961_0112230 3300044693 Bacteria 1714
176 Ga0466961_0150829 3300044693 Bacteria 1451
177 Ga0466963_0017220 3300044694 Bacteria 4502
178 Ga0466963_0064132 3300044694 Bacteria 2460
179 Ga0466963_0069832 3300044694 Bacteria 2362
180 Ga0466963_0157111 3300044694 Bacteria 1581
181 Ga0466964_0008241 3300044706 Bacteria 3910
182 Ga0466964_0039872 3300044706 Bacteria 1894
183 Ga0466964_0104948 3300044706 Bacteria 1252
184 Ga0466971_0051316 3300044719 Bacteria 1856
185 Ga0466970_0014971 3300044765 Bacteria 3988
186 Ga0466970_0015537 3300044765 Bacteria 3918
187 Ga0466970_0119122 3300044765 Bacteria 1445
188 Ga0466970_0194535 3300044765 Bacteria 1127
189 Ga0466957_0041611 3300044842 Bacteria 2778
190 Ga0466957_0064864 3300044842 Bacteria 2247
191 Ga0466957_0068722 3300044842 Bacteria 2187
192 Ga0466957_0104489 3300044842 Bacteria 1789
193 Ga0466957_0121776 3300044842 Bacteria 1664
194 Ga0466960_0004403 3300044901 Bacteria 5502
195 Ga0466960_0038267 3300044901 Bacteria 2254
196 Ga0466960_0044400 3300044901 Bacteria 2118
197 Ga0466959_0098902 3300045049 Bacteria 2089
198 Ga0466959_0104214 3300045049 Bacteria 2029
199 Ga0451576_0540584 3300045051 Bacteria 1224
200 Ga0466958_0028588 3300045836 Bacteria 3306
201 Ga0466958_0108322 3300045836 Bacteria 1733
202 Ga0466958_0196985 3300045836 Bacteria 1281
203 Ga0466967_0088026 3300045976 Bacteria 2817
204 Ga0466967_0089200 3300045976 Bacteria 2800
205 Ga0466967_0093945 3300045976 Bacteria 2730
206 Ga0466967_0127074 3300045976 Bacteria 2362
207 Ga0466967_0133285 3300045976 Bacteria 2308
208 Ga0466967_0224635 3300045976 Bacteria 1786
209 Ga0495617_005675 3300046452 Bacteria 4412
210 Ga0495627_064869 3300046453 Bacteria 1074
211 Ga0495603_0002079 3300046455 Bacteria 11775
212 Ga0495629_0001051 3300046459 Bacteria 22078
213 Ga0495638_0043764 3300046460 Bacteria 2823
214 Ga0495641_0028066 3300046461 Bacteria 2728
215 Ga0495582_0014766 3300046473 Bacteria 4291
216 Ga0495605_0028985 3300046474 Bacteria 2853
217 Ga0495585_0027161 3300046492 Bacteria 3267
218 Ga0495594_0002713 3300046499 Bacteria 9181
219 Ga0495607_0005592 3300046501 Bacteria 8964
220 Ga0495583_0016739 3300046506 Bacteria 3926
221 Ga0495606_0019645 3300046507 Bacteria 5015
222 Ga0495610_0007197 3300046512 Bacteria 7479
223 Ga0495616_0012172 3300046513 Bacteria 4895
224 Ga0495620_0009600 3300046515 Bacteria 5135
225 Ga0495631_0012841 3300046518 Bacteria 4078
226 Ga0495632_0132116 3300046519 Bacteria 1161
227 Ga0495648_0043498 3300046524 Bacteria 2814
228 Ga0495654_0077567 3300046530 Bacteria 1563
229 Ga0495640_0171218 3300046533 Bacteria 1387
230 Ga0495597_0003885 3300046542 Bacteria 8451
231 Ga0495645_0107369 3300046543 Bacteria 1979
232 Ga0495622_0019085 3300046557 Bacteria 3193
233 Ga0495668_0017421 3300046616 Bacteria 4166
234 Ga0495625_0029840 3300046660 Bacteria 4073
235 Ga0495661_0066985 3300046665 Bacteria 2111
236 Ga0495613_0053253 3300046689 Bacteria 2978
237 Ga0495624_0006712 3300046690 Bacteria 8129
238 Ga0495649_0003554 3300046694 Bacteria 10468
239 Ga0495589_0002467 3300046794 Bacteria 10371
240 Ga0495660_0062205 3300046810 Bacteria 2001
241 Ga0495581_0037703 3300047315 Bacteria 2798
242 Ga0495676_0008690 3300047321 Bacteria 9296
243 Ga0495683_0024690 3300047323 Bacteria 3083
244 Ga0495685_004349 3300047447 Bacteria 4570
245 Ga0495686_0009414 3300047472 Bacteria 7038
246 Ga0495614_0002372 3300048089 Bacteria 8383
247 Ga0495626_0004843 3300048091 Bacteria 8108
248 Ga0496100_0015111 3300048903 Bacteria 4503
249 Ga0496101_0053853 3300048904 Bacteria 2904
250 Ga0496103_0165029 3300048906 Bacteria 1421
251 Ga0496105_0004428 3300048908 Bacteria 10575
252 Ga0496106_0072088 3300048909 Bacteria 2641
253 Ga0496107_0022866 3300048910 Bacteria 4419
254 Ga0496107_0107573 3300048910 Bacteria 2048
255 Ga0496108_0070759 3300048911 Bacteria 2944
256 Ga0496108_0302517 3300048911 Bacteria 1393
257 Ga0496109_0005602 3300048912 Bacteria 10510
258 Ga0496109_0055797 3300048912 Bacteria 3604
259 Ga0496109_0088441 3300048912 Bacteria 2863
260 Ga0496109_0088833 3300048912 Bacteria 2856
261 Ga0496109_0175481 3300048912 Bacteria 2011
262 Ga0496110_0056929 3300048913 Bacteria 3440
263 Ga0496111_0003009 3300048914 Bacteria 10322
264 Ga0496111_0195306 3300048914 Bacteria 1504
265 Ga0496113_0438143 3300048916 Bacteria 1050
266 Ga0496114_0013047 3300048917 Bacteria 6658
267 Ga0496114_0033736 3300048917 Bacteria 4219
268 Ga0496114_0035967 3300048917 Bacteria 4092
269 Ga0496114_0174778 3300048917 Bacteria 1873
270 Ga0496114_0238742 3300048917 Bacteria 1598
271 Ga0496115_0030416 3300048918 Bacteria 4248
272 Ga0496124_0063289 3300048927 Bacteria 3091
273 Ga0495678_023385 3300049459 Bacteria 2686
274 Ga0495682_0016281 3300049460 Bacteria 2815
275 Ga0501031_0025987 3300049568 Bacteria 3820
276 Ga0501031_0104312 3300049568 Bacteria 1850
277 Ga0501032_0012901 3300049569 Bacteria 5958
278 Ga0501032_0026361 3300049569 Bacteria 3999
279 Ga0501032_0106292 3300049569 Bacteria 1859
280 Ga0501033_0029061 3300049570 Bacteria 4153
281 Ga0501034_0096738 3300049571 Bacteria 2948
282 Ga0501034_0158118 3300049571 Bacteria 2239
283 Ga0501036_0066361 3300049572 Bacteria 3053
284 Ga0501036_0173203 3300049572 Bacteria 1818
285 Ga0501036_0217170 3300049572 Bacteria 1606
286 Ga0501037_0120049 3300049573 Bacteria 1891
287 Ga0501037_0156201 3300049573 Bacteria 1628
288 Ga0501038_0319103 3300049574 Bacteria 1216
289 Ga0501039_0042291 3300049575 Bacteria 3520
290 Ga0501039_0076733 3300049575 Bacteria 2598
291 Ga0501039_0106369 3300049575 Bacteria 2191
292 Ga0501040_0018239 3300049576 Bacteria 4659
293 Ga0501040_0026504 3300049576 Bacteria 3899
294 Ga0501042_0017293 3300049578 Bacteria 4971
295 Ga0501042_0038377 3300049578 Bacteria 3402
296 Ga0501042_0098109 3300049578 Bacteria 2107
297 Ga0501043_0102703 3300049579 Bacteria 2247
298 Ga0501047_0048865 3300049581 Bacteria 4085
299 Ga0501047_0103459 3300049581 Bacteria 2728
300 Ga0501048_0037447 3300049582 Bacteria 3483
301 Ga0501048_0200808 3300049582 Bacteria 1413
302 Ga0501067_0003367 3300049583 Bacteria 8787
303 Ga0501067_0005257 3300049583 Bacteria 7194
304 Ga0501067_0042321 3300049583 Bacteria 2529
305 Ga0501068_0007354 3300049584 Bacteria 6099
306 Ga0501069_0044112 3300049585 Bacteria 2469
307 Ga0501069_0305630 3300049585 Bacteria 933
308 Ga0501070_0019318 3300049586 Bacteria 5715
309 Ga0501070_0030880 3300049586 Bacteria 4488
310 Ga0501070_0095479 3300049586 Bacteria 2460
311 Ga0501070_0112849 3300049586 Bacteria 2246
312 Ga0501070_0241930 3300049586 Bacteria 1477
313 Ga0501070_0310205 3300049586 Bacteria 1284
314 Ga0501070_0491833 3300049586 Bacteria 986
315 Ga0501071_0012628 3300049587 Bacteria 5737
316 Ga0501071_0029825 3300049587 Bacteria 3853
317 Ga0501071_0100927 3300049587 Bacteria 2127
318 Ga0501071_0101859 3300049587 Bacteria 2117
319 Ga0501071_0117408 3300049587 Bacteria 1970
320 Ga0501071_0257584 3300049587 Bacteria 1317
321 Ga0501071_0524478 3300049587 Bacteria 909
322 Ga0501072_0142272 3300049588 Bacteria 1913
323 Ga0501072_0190325 3300049588 Bacteria 1636
324 Ga0501074_0006551 3300049590 Bacteria 8414
325 Ga0501074_0008495 3300049590 Bacteria 7440
326 Ga0501074_0023083 3300049590 Bacteria 4524
327 Ga0501074_0102446 3300049590 Bacteria 2049
328 Ga0501075_0061326 3300049591 Bacteria 2834
329 Ga0501075_0157165 3300049591 Bacteria 1734
330 Ga0501076_0107178 3300049592 Bacteria 2256
331 Ga0501077_0007031 3300049593 Bacteria 6940
332 Ga0501079_0021057 3300049741 Bacteria 4985
333 Ga0501079_0053259 3300049741 Bacteria 3122
334 Ga0501079_0102974 3300049741 Bacteria 2214
335 Ga0501079_0159837 3300049741 Bacteria 1757
336 Ga0501079_0181320 3300049741 Bacteria 1643
337 Ga0501080_0037226 3300049742 Bacteria 4542
338 Ga0501081_0208022 3300049743 Bacteria 1420
339 Ga0501083_0013273 3300049744 Bacteria 5759
340 Ga0501083_0014664 3300049744 Bacteria 5479
341 Ga0501279_015097 3300049775 Bacteria 1068
342 Ga0501035_0005979 3300049822 Bacteria 11459
343 Ga0501044_0234884 3300049823 Bacteria 1779
344 Ga0501045_0032311 3300049824 Bacteria 3793
345 Ga0501045_0086527 3300049824 Bacteria 2313
346 Ga0501045_0244528 3300049824 Bacteria 1336
347 Ga0501045_0356764 3300049824 Bacteria 1088
348 nmdc:mga03n38_14845_c1 3300050490 Bacteria 2997
349 nmdc:mga03n38_40039_c1 3300050490 Bacteria 2035
350 nmdc:mga03n38_42868_c1 3300050490 Bacteria 1981
351 nmdc:mga03n38_58738_c1 3300050490 Bacteria 1744
352 nmdc:mga00v17_109961_c2 3300050491 Bacteria 1359
353 nmdc:mga00v17_142945_c1 3300050491 Bacteria 1535
354 nmdc:mga00v17_239663_c1 3300050491 Bacteria 1176
355 nmdc:mga00v17_69054_c1 3300050491 Bacteria 2186
356 nmdc:mga0yw44_100952_c1 3300050492 Bacteria 1838
357 nmdc:mga0yw44_125627_c1 3300050492 Bacteria 1656
358 nmdc:mga0yw44_20297_c1 3300050492 Bacteria 3685
359 nmdc:mga0yw44_22401_c1 3300050492 Bacteria 3543
360 nmdc:mga0yw44_227547_c1 3300050492 Bacteria 1237
361 nmdc:mga0yw44_229092_c1 3300050492 Bacteria 1233
362 nmdc:mga0yw44_268319_c1 3300050492 Bacteria 1139
363 nmdc:mga0yw44_54794_c1 3300050492 Bacteria 2425
364 nmdc:mga06z11_11150_c1 3300050494 Bacteria 3862
365 nmdc:mga06z11_191673_c1 3300050494 Bacteria 1184
366 nmdc:mga07m45_241326_c1 3300050496 Bacteria 1051
367 nmdc:mga07m45_56031_c1 3300050496 Bacteria 2228
368 nmdc:mga08y16_68783_c1 3300050511 Bacteria 3692
369 Ga0495619_0038159 3300053085 Bacteria 3133
370 Ga0500644_0000679 3300053088 Bacteria 12345
371 Ga0500641_0014073 3300053096 Bacteria 2948
372 Ga0500556_0000981 3300053104 Bacteria 15108
373 Ga0500593_000172 3300053117 Bacteria 26252
374 Ga0501084_0006860 3300054114 Bacteria 9376
375 Ga0501084_0016119 3300054114 Bacteria 6204
376 Ga0501084_0059308 3300054114 Bacteria 3203
377 Ga0501082_0009518 3300060353 Bacteria 8360
378 Ga0501082_0012234 3300060353 Bacteria 7374
379 Ga0466962_0027470 3300061719 Bacteria 2731
380 Ga0466962_0079404 3300061719 Bacteria 1568
381 Ga0530510_0036945 3300061734 Bacteria 3520
382 Ga0530510_0240303 3300061734 Bacteria 1348
383 2585321371 2582581314 Bacteria 11452267
384 2643823587 2643221561 Bacteria 4984412
385 2643888770 2643221576 Bacteria 5214352
386 2643957825 2643221590 Bacteria 5214697
387 2644034318 2643221604 Bacteria 5014917
388 2644093987 2643221615 Bacteria 5487866
389 2644098619 2643221617 Bacteria 5139111
390 2644114522 2643221620 Bacteria 5134593
391 2644232313 2643221641 Bacteria 4490190
392 2644323831 2643221657 Bacteria 5490246
393 2644535268 2643221696 Bacteria 5431823
394 2738869897 2738541305 Bacteria 4910150
395 2740169266 2739367898 Bacteria 4367674
396 2774392831 2773857762 Bacteria 5971770
397 2809196656 2808606439 Bacteria 5952208
398 2812332592 2811994874 Bacteria 5367947
399 2812351208 2811994878 Bacteria 5992952
400 2855391144 2855386786 Bacteria 4752232
401 2857485717 2857481737 Bacteria 4761446
402 2863072244 2863067949 Bacteria 8541735
403 2891971175 2891968417 Bacteria 5821697
404 8054613031 8054609563 Bacteria 5170090
405 8056835979 8056829672 Bacteria 9045328
406 Ga0501048_0281826
407 LJQas_1003142
408 JGI24735J21928_10009738
409 Ga0006562J51391_1140841
410 Ga0070658_10059254
411 Ga0070683_100018336
412 Ga0070683_100107640
413 Ga0070683_100331120
414 Ga0070682_100018037
415 Ga0070682_100128811
416 Ga0070660_100003305
417 Ga0070660_100103860
418 Ga0070660_100164393
419 Ga0070691_10142255
420 Ga0070687_100031177
421 Ga0070675_100133067
422 Ga0070671_100368999
423 Ga0070674_100010033
424 Ga0070674_100286963
425 Ga0070659_100089242
426 Ga0070667_100037890
427 Ga0070701_10031580
428 Ga0070663_100053475
429 Ga0070678_100040251
430 Ga0068867_100036032
431 Ga0070698_100001494
432 Ga0070679_100031880
433 Ga0070684_100008524
434 Ga0070684_100126153
435 Ga0068853_100064489
436 Ga0070672_100035086
437 Ga0070665_100009827
438 Ga0068855_100241764
439 Ga0070702_100038906
440 Ga0070702_100107373
441 Ga0068852_100140735
442 Ga0068863_100004293
443 Ga0068860_100001541
444 Ga0075365_10000618
445 Ga0075365_10020373
446 Ga0075365_10022500
447 Ga0075365_10041332
448 Ga0075365_10053452
449 Ga0075365_10119653
450 Ga0075365_10213943
451 Ga0075365_10293197
452 Ga0075365_10350021
453 Ga0075368_10001765
454 Ga0075368_10012837
455 Ga0075368_10089166
456 Ga0075363_100062618
457 Ga0075363_100153282
458 Ga0075363_100210891
459 Ga0075364_10030417
460 Ga0075364_10034785
461 Ga0075364_10059239
462 Ga0075364_10073540
463 Ga0075364_10125732
464 Ga0075362_10111755
465 Ga0075367_10031633
466 Ga0075367_10042584
467 Ga0075367_10130885
468 Ga0075367_10164668
469 Ga0075370_10010424
470 Ga0075370_10024533
471 Ga0075428_100104226
472 Ga0068865_100017374
473 Ga0111539_10046733
474 Ga0111539_10164849
475 Ga0105245_10006602
476 Ga0105245_10024490
477 Ga0105243_10062066
478 Ga0105243_10099417
479 Ga0105248_10819034
480 Ga0105237_10265455
481 Ga0105238_10266091
482 Ga0105249_10075993
483 Ga0105249_10108709
484 Ga0105249_10152018
485 Ga0105239_10096396
486 Ga0105239_10379940
487 Ga0105239_10613417
488 Ga0105239_10916155
489 Ga0105246_10010188
490 Ga0105246_10245517
491 Ga0157372_10044921
492 Ga0157375_10098214
493 Ga0157375_10223570
494 Ga0163163_10723589
495 Ga0157380_10037943
496 Ga0163161_10069206
497 Ga0206353_10363779
498 Ga0206353_10973789
499 Ga0207647_10031477
500 Ga0207643_10002264
501 Ga0207705_10203037
502 Ga0207662_10067863
503 Ga0207662_10077355
504 Ga0207657_10007406
505 Ga0207657_10049700
506 Ga0207659_10097769
507 Ga0207659_10168806
508 Ga0207690_10005350
509 Ga0207706_10172915
510 Ga0207709_10119322
511 Ga0207709_10261197
512 Ga0207704_10044232
513 Ga0207704_10216205
514 Ga0207691_10001201
515 Ga0207661_10107326
516 Ga0207661_10381770
517 Ga0207661_10499955
518 Ga0207679_10030572
519 Ga0207679_10099338
520 Ga0207679_10158822
521 Ga0207651_10396685
522 Ga0207712_10084081
523 Ga0207712_10127680
524 Ga0207658_10222709
525 Ga0207639_10167140
526 Ga0207678_10332984
527 Ga0207708_10000513
528 Ga0207648_10153184
529 Ga0207675_100004561
530 Ga0207675_100354918
531 Ga0207698_10446288
532 Ga0209813_10000804
533 Ga0268266_10019422
534 Ga0268266_10281386
535 Ga0268265_10058996
536 Ga0268264_10001453
537 Ga0316579_10121431
538 Ga0316576_10032091
539 Ga0307405_10082756
540 Ga0307413_10410243
541 Ga0307410_10057184
542 Ga0307410_10337832
543 Ga0307407_10066484
544 Ga0307407_10296101
545 Ga0307412_10438520
546 Ga0307409_100041121
547 Ga0307409_100466939
548 Ga0307416_100015342
549 Ga0307416_100107302
550 Ga0307416_100327783
551 Ga0307414_10057169
552 Ga0307411_10152914
553 Ga0307411_10157820
554 Ga0307411_10180755
555 Ga0307415_100096140
556 Ga0307507_10070140
557 Ga0395900_0071170
558 Ga0395898_0053418
559 Ga0395905_0600995
560 Ga0436364_1428798
561 Ga0395901_0015285
562 Ga0395901_0050200
563 Ga0395901_0467533
564 Ga0451853_2348089
565 Ga0439431_0005543
566 Ga0439442_015281
567 Ga0439434_0014142
568 Ga0466969_0049392
569 Ga0466972_0036176
570 Ga0466972_0036916
571 Ga0466965_0013765
572 Ga0466965_0034176
573 Ga0466965_0126713
574 Ga0466965_0136585
575 Ga0466966_0020095
576 Ga0466966_0033565
577 Ga0466966_0118735
578 Ga0466966_0121123
579 Ga0466961_0106346
580 Ga0466961_0112230
581 Ga0466961_0150829
582 Ga0466963_0017220
583 Ga0466963_0064132
584 Ga0466963_0069832
585 Ga0466963_0157111
586 Ga0466964_0008241
587 Ga0466964_0039872
588 Ga0466964_0104948
589 Ga0466971_0051316
590 Ga0466970_0014971
591 Ga0466970_0015537
592 Ga0466970_0119122
593 Ga0466970_0194535
594 Ga0466957_0041611
595 Ga0466957_0064864
596 Ga0466957_0068722
597 Ga0466957_0104489
598 Ga0466957_0121776
599 Ga0466960_0004403
600 Ga0466960_0038267
601 Ga0466960_0044400
602 Ga0466959_0098902
603 Ga0466959_0104214
604 Ga0451576_0540584
605 Ga0466958_0028588
606 Ga0466958_0108322
607 Ga0466958_0196985
608 Ga0466967_0088026
609 Ga0466967_0089200
610 Ga0466967_0093945
611 Ga0466967_0127074
612 Ga0466967_0133285
613 Ga0466967_0224635
614 Ga0495617_005675
615 Ga0495627_064869
616 Ga0495603_0002079
617 Ga0495629_0001051
618 Ga0495638_0043764
619 Ga0495641_0028066
620 Ga0495582_0014766
621 Ga0495605_0028985
622 Ga0495585_0027161
623 Ga0495594_0002713
624 Ga0495607_0005592
625 Ga0495583_0016739
626 Ga0495606_0019645
627 Ga0495610_0007197
628 Ga0495616_0012172
629 Ga0495620_0009600
630 Ga0495631_0012841
631 Ga0495632_0132116
632 Ga0495648_0043498
633 Ga0495654_0077567
634 Ga0495640_0171218
635 Ga0495597_0003885
636 Ga0495645_0107369
637 Ga0495622_0019085
638 Ga0495668_0017421
639 Ga0495625_0029840
640 Ga0495661_0066985
641 Ga0495613_0053253
642 Ga0495624_0006712
643 Ga0495649_0003554
644 Ga0495589_0002467
645 Ga0495660_0062205
646 Ga0495581_0037703
647 Ga0495676_0008690
648 Ga0495683_0024690
649 Ga0495685_004349
650 Ga0495686_0009414
651 Ga0495614_0002372
652 Ga0495626_0004843
653 Ga0496100_0015111
654 Ga0496101_0053853
655 Ga0496103_0165029
656 Ga0496105_0004428
657 Ga0496106_0072088
658 Ga0496107_0022866
659 Ga0496107_0107573
660 Ga0496108_0070759
661 Ga0496108_0302517
662 Ga0496109_0005602
663 Ga0496109_0055797
664 Ga0496109_0088441
665 Ga0496109_0088833
666 Ga0496109_0175481
667 Ga0496110_0056929
668 Ga0496111_0003009
669 Ga0496111_0195306
670 Ga0496113_0438143
671 Ga0496114_0013047
672 Ga0496114_0033736
673 Ga0496114_0035967
674 Ga0496114_0174778
675 Ga0496114_0238742
676 Ga0496115_0030416
677 Ga0496124_0063289
678 Ga0495678_023385
679 Ga0495682_0016281
680 Ga0501031_0025987
681 Ga0501031_0104312
682 Ga0501032_0012901
683 Ga0501032_0026361
684 Ga0501032_0106292
685 Ga0501033_0029061
686 Ga0501034_0096738
687 Ga0501034_0158118
688 Ga0501036_0066361
689 Ga0501036_0173203
690 Ga0501036_0217170
691 Ga0501037_0120049
692 Ga0501037_0156201
693 Ga0501038_0319103
694 Ga0501039_0042291
695 Ga0501039_0076733
696 Ga0501039_0106369
697 Ga0501040_0018239
698 Ga0501040_0026504
699 Ga0501042_0017293
700 Ga0501042_0038377
701 Ga0501042_0098109
702 Ga0501043_0102703
703 Ga0501047_0048865
704 Ga0501047_0103459
705 Ga0501048_0037447
706 Ga0501048_0200808
707 Ga0501067_0003367
708 Ga0501067_0005257
709 Ga0501067_0042321
710 Ga0501068_0007354
711 Ga0501069_0044112
712 Ga0501069_0305630
713 Ga0501070_0019318
714 Ga0501070_0030880
715 Ga0501070_0095479
716 Ga0501070_0112849
717 Ga0501070_0241930
718 Ga0501070_0310205
719 Ga0501070_0491833
720 Ga0501071_0012628
721 Ga0501071_0029825
722 Ga0501071_0100927
723 Ga0501071_0101859
724 Ga0501071_0117408
725 Ga0501071_0257584
726 Ga0501071_0524478
727 Ga0501072_0142272
728 Ga0501072_0190325
729 Ga0501074_0006551
730 Ga0501074_0008495
731 Ga0501074_0023083
732 Ga0501074_0102446
733 Ga0501075_0061326
734 Ga0501075_0157165
735 Ga0501076_0107178
736 Ga0501077_0007031
737 Ga0501079_0021057
738 Ga0501079_0053259
739 Ga0501079_0102974
740 Ga0501079_0159837
741 Ga0501079_0181320
742 Ga0501080_0037226
743 Ga0501081_0208022
744 Ga0501083_0013273
745 Ga0501083_0014664
746 Ga0501279_015097
747 Ga0501035_0005979
748 Ga0501044_0234884
749 Ga0501045_0032311
750 Ga0501045_0086527
751 Ga0501045_0244528
752 Ga0501045_0356764
753 nmdc:mga03n38_14845_c1
754 nmdc:mga03n38_40039_c1
755 nmdc:mga03n38_42868_c1
756 nmdc:mga03n38_58738_c1
757 nmdc:mga00v17_109961_c2
758 nmdc:mga00v17_142945_c1
759 nmdc:mga00v17_239663_c1
760 nmdc:mga00v17_69054_c1
761 nmdc:mga0yw44_100952_c1
762 nmdc:mga0yw44_125627_c1
763 nmdc:mga0yw44_20297_c1
764 nmdc:mga0yw44_22401_c1
765 nmdc:mga0yw44_227547_c1
766 nmdc:mga0yw44_229092_c1
767 nmdc:mga0yw44_268319_c1
768 nmdc:mga0yw44_54794_c1
769 nmdc:mga06z11_11150_c1
770 nmdc:mga06z11_191673_c1
771 nmdc:mga07m45_241326_c1
772 nmdc:mga07m45_56031_c1
773 nmdc:mga08y16_68783_c1
774 Ga0495619_0038159
775 Ga0500644_0000679
776 Ga0500641_0014073
777 Ga0500556_0000981
778 Ga0500593_000172
779 Ga0501084_0006860
780 Ga0501084_0016119
781 Ga0501084_0059308
782 Ga0501082_0009518
783 Ga0501082_0012234
784 Ga0466962_0027470
785 Ga0466962_0079404
786 Ga0530510_0036945
787 Ga0530510_0240303
788 2585321371
789 2643823587
790 2643888770
791 2643957825
792 2644034318
793 2644093987
794 2644098619
795 2644114522
796 2644232313
797 2644323831
798 2644535268
799 2738869897
800 2740169266
801 2774392831
802 2809196656
803 2812332592
804 2812351208
805 2855391144
806 2857485717
807 2863072244
808 2891971175
809 8054613031
810 8056835979

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00696

AA_kinase

Amino acid kinase family

49

290

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nly-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis argb in complex with 2-chlorobenzimidazole. 0.9589 8 295
2ap9-assembly1.cif.gz_B crystal structure of acetylglutamate kinase from mycobacterium tuberculosis cdc1551 0.9588 8 296
2ap9-assembly1.cif.gz_B crystal structure of acetylglutamate kinase from mycobacterium tuberculosis cdc1551 0.946 8 296
7nly-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis argb in complex with 2-chlorobenzimidazole. 0.9398 8 295
2buf-assembly1.cif.gz_F arginine feed-back inhibitable acetylglutamate kinase 0.9386 11 294
ID Description Score Start End Superfamily
af_P9WQ01_4_294_3.40.1160.10 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9822 8 295 3.40.1160.10
af_P9WQ01_4_294_3.40.1160.10 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9688 8 295 3.40.1160.10
2v5hF00 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9434 6 296 3.40.1160.10
2v5hF00 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9402 6 296 3.40.1160.10
1uvdA00 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9245 11 297 3.40.1160.10
ID Description Score Start End GO Terms
AF-A0A6G7XPP0-F1-model_v4 Acetylglutamate kinase (EC 2.7.2.8) (N-acetyl-L-glutamate 5-phosphotransferase) (NAG kinase) (NAGK) 0.998 11 305 GO:0003991
GO:0005524
GO:0005737
GO:0006526
GO:0042450
AF-A0A4S5E2E5-F1-model_v4 acetylglutamate kinase (EC 2.7.2.8) 0.992 26 294 GO:0003991
GO:0005524
GO:0005737
GO:0006526
AF-A0A7K0TQ66-F1-model_v4 Acetylglutamate kinase (EC 2.7.2.8) (N-acetyl-L-glutamate 5-phosphotransferase) (NAG kinase) (NAGK) 0.991 31 293 GO:0003991
GO:0005524
GO:0005737
GO:0006526
GO:0042450
AF-D2PM79-F1-model_v4 Acetylglutamate kinase (EC 2.7.2.8) (N-acetyl-L-glutamate 5-phosphotransferase) (NAG kinase) (NAGK) 0.9897 6 295 GO:0003991
GO:0005524
GO:0005737
GO:0006526
GO:0042450
AF-A0A2V5L4X3-F1-model_v4 Acetylglutamate kinase (EC 2.7.2.8) (N-acetyl-L-glutamate 5-phosphotransferase) (NAG kinase) (NAGK) 0.9893 11 297 GO:0003991
GO:0005524
GO:0005737
GO:0006526
GO:0042450

Map