F436035

General Info

Members Datasets Scaffolds Average Seq Length
405 240 405 249

Family's Representative Sequence

Representative Sequence 3300046529|Ga0495652_0103130|Ga0495652_0103130_782_1543
Length 253
Sequence MTEPGNADATAVRAVVRGEVQGIGYRDATLRRARRLGVMGWVRNDAQDGSVLVHAEGPEPAVDDLVAFLREGPSGARIAEVAIEPVKVEGHEQFAIRGVSAGVFVVQEHAATAHHFDLRLEVGGVMRSWAVPKGPSMDPAVKRLALEVDDHAIAHNDFEGAAGEGQVIVWDRGRYEQGGRVAWPQALDRGHAVFVLHGEKLRGGFALQRTRPGEKAQWLLIKRRDEHARPGSDVVAERPQSVLSDSTLDQLKR

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
99 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
100 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
103 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
104 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
105 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
106 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
107 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
108 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
109 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
110 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
117 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
118 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
119 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
120 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
121 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
124 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
125 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
126 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
127 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
130 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
131 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
132 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
133 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
134 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
135 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
136 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
137 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
138 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
139 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
140 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
141 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
142 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
143 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
147 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
148 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
149 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
150 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
151 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
152 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
153 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
154 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
155 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
156 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
157 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
158 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
159 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
160 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
161 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
162 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
163 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
164 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
165 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
168 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
169 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
170 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
171 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
172 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
173 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
191 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
192 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
193 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
194 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
195 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
196 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
211 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
212 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
215 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
219 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
226 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
227 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
228 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
230 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
231 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
232 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
233 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
234 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
235 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
236 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
237 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
238 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
239 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
240 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.22
Nodule 0
Rhizoplane 11.36
Rhizosphere 79.75
Stem 0
Stem Tuber 0
Unclassified 6.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000306 3300001977 Bacteria 7029
2 JGI24740J21852_10007407 3300001979 Bacteria 4464
3 JGI24034J26672_10000097 3300002239 Bacteria 15286
4 JGI24742J22300_10001208 3300002244 Bacteria 4036
5 JGI25404J52841_10029196 3300003659 Bacteria 1183
6 Ga0070683_100025281 3300005329 Bacteria 5331
7 Ga0070677_10000002 3300005333 Bacteria 87295
8 Ga0068869_100146262 3300005334 Bacteria 1829
9 Ga0070666_10371440 3300005335 Bacteria 1026
10 Ga0070666_10390493 3300005335 Bacteria 1000
11 Ga0068868_100004195 3300005338 Bacteria 10077
12 Ga0070691_10000112 3300005341 Bacteria 24438
13 Ga0070668_100012615 3300005347 Bacteria 6290
14 Ga0070674_100000004 3300005356 Bacteria 169446
15 Ga0070659_100022157 3300005366 Bacteria 4847
16 Ga0070667_100017587 3300005367 Bacteria 5924
17 Ga0070667_100119000 3300005367 Bacteria 2296
18 Ga0070714_100029000 3300005435 Bacteria 4597
19 Ga0070714_100171774 3300005435 Unclassified 1967
20 Ga0070714_100199273 3300005435 Unclassified 1831
21 Ga0070714_100212758 3300005435 Bacteria 1773
22 Ga0070714_100460435 3300005435 Bacteria 1209
23 Ga0070713_100054278 3300005436 Bacteria 3324
24 Ga0070713_100161360 3300005436 Bacteria 2001
25 Ga0070713_100177179 3300005436 Bacteria 1914
26 Ga0070711_100044227 3300005439 Unclassified 3022
27 Ga0068867_100168435 3300005459 Bacteria 1733
28 Ga0070685_10000027 3300005466 Bacteria 91882
29 Ga0070679_100002833 3300005530 Bacteria 15766
30 Ga0070684_100012292 3300005535 Bacteria 6856
31 Ga0070684_100690748 3300005535 Bacteria 951
32 Ga0070693_100000307 3300005547 Bacteria 22748
33 Ga0070665_100000308 3300005548 Bacteria 76310
34 Ga0070665_100100493 3300005548 Bacteria 2896
35 Ga0070665_100119671 3300005548 Bacteria 2635
36 Ga0070665_100164598 3300005548 Bacteria 2220
37 Ga0068855_100248634 3300005563 Bacteria 1984
38 Ga0068857_100133716 3300005577 Bacteria 2239
39 Ga0068856_100083132 3300005614 Bacteria 3179
40 Ga0068856_100704790 3300005614 Bacteria 1030
41 Ga0068864_100000090 3300005618 Bacteria 96213
42 Ga0068866_10000004 3300005718 Bacteria 202810
43 Ga0068863_100003356 3300005841 Bacteria 15818
44 Ga0068858_100000066 3300005842 Bacteria 108011
45 Ga0068858_100000204 3300005842 Bacteria 63915
46 Ga0068860_100061287 3300005843 Bacteria 3574
47 Ga0081455_10043735 3300005937 Bacteria 3914
48 Ga0081540_1000116 3300005983 Bacteria 84152
49 Ga0070717_10019774 3300006028 Bacteria 5287
50 Ga0070717_10084223 3300006028 Bacteria 2675
51 Ga0070717_10143093 3300006028 Unclassified 2064
52 Ga0070717_10144863 3300006028 Bacteria 2051
53 Ga0075364_10039506 3300006051 Bacteria 3059
54 Ga0070715_10000014 3300006163 Bacteria 154272
55 Ga0070716_100341414 3300006173 Unclassified 1057
56 Ga0070712_100013954 3300006175 Bacteria 5147
57 Ga0070712_100260359 3300006175 Bacteria 1390
58 Ga0075367_10198750 3300006178 Bacteria 1252
59 Ga0075433_10013912 3300006852 Bacteria 6560
60 Ga0105240_10033226 3300009093 Bacteria 6669
61 Ga0105240_10195288 3300009093 Bacteria 2377
62 Ga0105240_10841259 3300009093 Bacteria 991
63 Ga0105245_10000040 3300009098 Bacteria 144005
64 Ga0105245_10000587 3300009098 Bacteria 32974
65 Ga0105247_10000275 3300009101 Bacteria 47915
66 Ga0105242_10001336 3300009176 Bacteria 19497
67 Ga0105248_10324336 3300009177 Bacteria 1735
68 Ga0105237_10018145 3300009545 Bacteria 7286
69 Ga0105237_10344327 3300009545 Bacteria 1495
70 Ga0105238_10000033 3300009551 Bacteria 172981
71 Ga0105249_10000150 3300009553 Bacteria 88154
72 Ga0105249_10010181 3300009553 Bacteria 8256
73 Ga0105249_10103348 3300009553 Bacteria 2683
74 Ga0157374_10000692 3300013296 Bacteria 29700
75 Ga0157378_10026903 3300013297 Bacteria 5073
76 Ga0157375_10003561 3300013308 Bacteria 13518
77 Ga0157375_10241024 3300013308 Bacteria 1968
78 Ga0157375_10252582 3300013308 Bacteria 1924
79 Ga0163163_10083274 3300014325 Bacteria 3204
80 Ga0157379_10014189 3300014968 Bacteria 6987
81 Ga0157379_10380178 3300014968 Bacteria 1296
82 Ga0157376_10398345 3300014969 Bacteria 1330
83 Ga0163161_10295322 3300017792 Bacteria 1275
84 Ga0206356_11355238 3300020070 Bacteria 2096
85 Ga0213876_10010508 3300021384 Bacteria 4963
86 Ga0213876_10013051 3300021384 Bacteria 4416
87 Ga0213875_10016701 3300021388 Bacteria 3556
88 Ga0213875_10080878 3300021388 Unclassified 1516
89 Ga0207682_10000012 3300025893 Bacteria 84521
90 Ga0207692_10073560 3300025898 Bacteria 1808
91 Ga0207642_10000005 3300025899 Bacteria 401934
92 Ga0207680_10052645 3300025903 Bacteria 2440
93 Ga0207680_10249348 3300025903 Bacteria 1226
94 Ga0207685_10000046 3300025905 Bacteria 46018
95 Ga0207699_10011178 3300025906 Bacteria 4524
96 Ga0207699_10101436 3300025906 Bacteria 1827
97 Ga0207707_10142541 3300025912 Bacteria 2095
98 Ga0207695_10541509 3300025913 Bacteria 1045
99 Ga0207671_10011693 3300025914 Bacteria 7114
100 Ga0207693_10000165 3300025915 Bacteria 59717
101 Ga0207693_10002704 3300025915 Bacteria 15373
102 Ga0207693_10307729 3300025915 Bacteria 1241
103 Ga0207663_10011112 3300025916 Bacteria 4821
104 Ga0207663_10178465 3300025916 Bacteria 1515
105 Ga0207652_10000080 3300025921 Bacteria 104739
106 Ga0207694_10000012 3300025924 Bacteria 411218
107 Ga0207687_10000046 3300025927 Bacteria 99576
108 Ga0207687_10000075 3300025927 Bacteria 71856
109 Ga0207700_10015992 3300025928 Bacteria 4971
110 Ga0207700_10371462 3300025928 Bacteria 1249
111 Ga0207664_10151888 3300025929 Bacteria 1968
112 Ga0207664_10158840 3300025929 Unclassified 1927
113 Ga0207664_10216776 3300025929 Bacteria 1658
114 Ga0207664_10378572 3300025929 Bacteria 1256
115 Ga0207664_10554240 3300025929 Unclassified 1031
116 Ga0207690_10011149 3300025932 Bacteria 5364
117 Ga0207686_10000212 3300025934 Bacteria 44261
118 Ga0207686_10003942 3300025934 Bacteria 7957
119 Ga0207709_10245711 3300025935 Bacteria 1304
120 Ga0207669_10000021 3300025937 Bacteria 100327
121 Ga0207689_10097197 3300025942 Bacteria 2419
122 Ga0207661_10001061 3300025944 Bacteria 18280
123 Ga0207661_10001766 3300025944 Bacteria 14792
124 Ga0207667_10098885 3300025949 Bacteria 3010
125 Ga0207712_10000027 3300025961 Bacteria 263739
126 Ga0207712_10003093 3300025961 Bacteria 10619
127 Ga0207668_10005014 3300025972 Bacteria 7793
128 Ga0207640_10001937 3300025981 Bacteria 11147
129 Ga0207658_10001096 3300025986 Bacteria 21860
130 Ga0207658_10008929 3300025986 Bacteria 6798
131 Ga0207677_10005000 3300026023 Bacteria 7160
132 Ga0207703_10000042 3300026035 Bacteria 161459
133 Ga0207703_10000054 3300026035 Bacteria 143734
134 Ga0207639_10014109 3300026041 Bacteria 5610
135 Ga0207708_10054041 3300026075 Bacteria 3061
136 Ga0207702_10636737 3300026078 Bacteria 1048
137 Ga0207641_10000252 3300026088 Bacteria 68086
138 Ga0207641_10004106 3300026088 Bacteria 12687
139 Ga0207676_10000016 3300026095 Bacteria 311561
140 Ga0207675_100443805 3300026118 Bacteria 1285
141 Ga0207683_10098099 3300026121 Bacteria 2614
142 Ga0268266_10000099 3300028379 Bacteria 182294
143 Ga0268266_10015619 3300028379 Bacteria 6506
144 Ga0268266_10046706 3300028379 Bacteria 3707
145 Ga0268266_10091117 3300028379 Bacteria 2673
146 Ga0268265_10080039 3300028380 Bacteria 2575
147 Ga0265337_1000123 3300028556 Bacteria 39654
148 Ga0265326_10000111 3300028558 Bacteria 41592
149 Ga0265322_10000005 3300028654 Bacteria 246112
150 Ga0265338_10000171 3300028800 Bacteria 120054
151 Ga0265338_10359926 3300028800 Bacteria 1044
152 Ga0265324_10001504 3300029957 Bacteria 13183
153 Ga0265328_10026202 3300031239 Bacteria 2193
154 Ga0265320_10000293 3300031240 Bacteria 40653
155 Ga0265325_10026028 3300031241 Bacteria 3173
156 Ga0265329_10008722 3300031242 Bacteria 3827
157 Ga0265339_10028240 3300031249 Bacteria 3193
158 Ga0265331_10001064 3300031250 Bacteria 21387
159 Ga0265327_10000040 3300031251 Bacteria 291052
160 Ga0265327_10004082 3300031251 Bacteria 13211
161 Ga0265314_10000983 3300031711 Bacteria 33551
162 Ga0307416_100272178 3300032002 Bacteria 1664
163 Ga0373954_0264875 3300035118 Bacteria 847
164 Ga0373937_0015820 3300036401 Bacteria 6683
165 Ga0436364_0070620 3300037853 Unclassified 1808
166 Ga0436364_0193121 3300037853 Bacteria 34052
167 Ga0436364_0723236 3300037853 Bacteria 3391
168 Ga0436364_0885412 3300037853 Bacteria 14438
169 Ga0436365_0140783 3300039437 Bacteria 30804
170 Ga0436365_0150830 3300039437 Bacteria 8782
171 Ga0436365_1084861 3300039437 Bacteria 6434
172 Ga0436363_0198760 3300039450 Bacteria 34031
173 Ga0436363_0496970 3300039450 Bacteria 2549
174 Ga0436363_0698225 3300039450 Bacteria 2879
175 Ga0436363_1349946 3300039450 Bacteria 18733
176 Ga0436362_0249417 3300039453 Bacteria 3010
177 Ga0451853_1535246 3300041512 Bacteria 5025
178 Ga0439459_0022205 3300042438 Bacteria 1226
179 Ga0466966_0143392 3300044684 Bacteria 1459
180 Ga0466966_0161736 3300044684 Bacteria 1363
181 Ga0466961_0020891 3300044693 Bacteria 4212
182 Ga0466961_0022578 3300044693 Bacteria 4048
183 Ga0466963_0000712 3300044694 Bacteria 16256
184 Ga0466963_0078262 3300044694 Bacteria 2235
185 Ga0466964_0051279 3300044706 Bacteria 1694
186 Ga0466971_0079950 3300044719 Unclassified 1490
187 Ga0466968_0078105 3300044735 Unclassified 1450
188 Ga0466968_0089109 3300044735 Bacteria 1365
189 Ga0466959_0038974 3300045049 Bacteria 3511
190 Ga0466959_0055770 3300045049 Bacteria 2884
191 Ga0466959_0097028 3300045049 Bacteria 2113
192 Ga0466958_0004225 3300045836 Bacteria 7555
193 Ga0466958_0008664 3300045836 Bacteria 5648
194 Ga0466958_0040893 3300045836 Bacteria 2787
195 Ga0466958_0392909 3300045836 Bacteria 895
196 Ga0466967_0003301 3300045976 Bacteria 10475
197 Ga0466967_0087980 3300045976 Bacteria 2818
198 Ga0466967_0393147 3300045976 Bacteria 1348
199 Ga0466967_0460755 3300045976 Bacteria 1243
200 Ga0466967_0515354 3300045976 Bacteria 1175
201 Ga0466967_0709531 3300045976 Bacteria 996
202 Ga0495592_0115449 3300046454 Bacteria 1895
203 Ga0495592_0120480 3300046454 Unclassified 1846
204 Ga0495592_0145056 3300046454 Bacteria 1647
205 Ga0495603_0023061 3300046455 Bacteria 3768
206 Ga0495629_0001902 3300046459 Bacteria 16259
207 Ga0495629_0269276 3300046459 Unclassified 1170
208 Ga0495638_0079904 3300046460 Bacteria 1988
209 Ga0495641_0000040 3300046461 Bacteria 82337
210 Ga0495651_0004571 3300046462 Bacteria 10584
211 Ga0495653_0019772 3300046463 Bacteria 5460
212 Ga0495662_0000010 3300046476 Bacteria 70156
213 Ga0495662_0005585 3300046476 Bacteria 6292
214 Ga0495662_0045133 3300046476 Bacteria 2127
215 Ga0495664_0000032 3300046477 Bacteria 85909
216 Ga0495594_0000009 3300046499 Bacteria 122139
217 Ga0495596_0114320 3300046500 Bacteria 1048
218 Ga0495608_0003286 3300046511 Bacteria 11549
219 Ga0495608_0014687 3300046511 Bacteria 5433
220 Ga0495610_0147213 3300046512 Bacteria 1008
221 Ga0495618_0000054 3300046514 Bacteria 83787
222 Ga0495618_0052192 3300046514 Unclassified 2584
223 Ga0495620_0000041 3300046515 Bacteria 112605
224 Ga0495628_0000170 3300046516 Bacteria 56830
225 Ga0495628_0019726 3300046516 Bacteria 5570
226 Ga0495628_0106876 3300046516 Bacteria 2155
227 Ga0495630_0000167 3300046517 Bacteria 51244
228 Ga0495652_0017241 3300046529 Bacteria 6448
229 Ga0495652_0103130 3300046529 Bacteria 2309
230 Ga0495640_0127091 3300046533 Bacteria 1652
231 Ga0495586_0008630 3300046535 Bacteria 5425
232 Ga0495587_0005352 3300046536 Bacteria 8395
233 Ga0495587_0062553 3300046536 Bacteria 2179
234 Ga0495645_0000088 3300046543 Bacteria 63785
235 Ga0495645_0000119 3300046543 Bacteria 53463
236 Ga0495622_0000097 3300046557 Bacteria 76953
237 Ga0495667_0000038 3300046559 Bacteria 131349
238 Ga0495667_0009672 3300046559 Bacteria 6534
239 Ga0495634_0000908 3300046642 Bacteria 28256
240 Ga0495634_0022387 3300046642 Bacteria 4453
241 Ga0495635_0047870 3300046663 Bacteria 2947
242 Ga0495635_0152933 3300046663 Bacteria 1571
243 Ga0495657_0000006 3300046675 Bacteria 250610
244 Ga0495657_0010387 3300046675 Bacteria 7008
245 Ga0495599_0012162 3300046678 Bacteria 5299
246 Ga0495623_0020121 3300046679 Bacteria 4314
247 Ga0495646_0047020 3300046680 Bacteria 2628
248 Ga0495647_0000004 3300046681 Bacteria 140700
249 Ga0495669_0000223 3300046684 Bacteria 33954
250 Ga0495613_0000021 3300046689 Bacteria 159188
251 Ga0495613_0009403 3300046689 Bacteria 7250
252 Ga0495613_0070761 3300046689 Bacteria 2543
253 Ga0495624_0000007 3300046690 Bacteria 146202
254 Ga0495649_0002326 3300046694 Bacteria 13461
255 Ga0495600_0031135 3300046809 Bacteria 3455
256 Ga0495604_0000058 3300047317 Bacteria 96955
257 Ga0495604_0002171 3300047317 Bacteria 15757
258 Ga0495604_0004857 3300047317 Bacteria 10648
259 Ga0495674_0000010 3300047319 Bacteria 285794
260 Ga0495674_0004375 3300047319 Bacteria 13581
261 Ga0495676_0000612 3300047321 Bacteria 29546
262 Ga0495676_0000860 3300047321 Bacteria 25376
263 Ga0495680_0006123 3300047322 Bacteria 11232
264 Ga0495680_0008542 3300047322 Bacteria 9301
265 Ga0495680_0082714 3300047322 Bacteria 2422
266 Ga0495675_0029200 3300047444 Bacteria 3516
267 Ga0495679_011234 3300047446 Bacteria 3470
268 Ga0495684_0027975 3300047471 Bacteria 4330
269 Ga0495686_0029983 3300047472 Bacteria 3535
270 Ga0495686_0039497 3300047472 Bacteria 3014
271 Ga0495602_0000393 3300048088 Bacteria 40803
272 Ga0495602_0003458 3300048088 Bacteria 16338
273 Ga0495602_0016302 3300048088 Bacteria 7475
274 Ga0495602_0088744 3300048088 Bacteria 2573
275 Ga0495602_0395328 3300048088 Unclassified 987
276 Ga0496100_0000001 3300048903 Bacteria 530179
277 Ga0496100_0000024 3300048903 Bacteria 116138
278 Ga0496101_0000028 3300048904 Bacteria 198664
279 Ga0496101_0000072 3300048904 Bacteria 116138
280 Ga0496102_0000002 3300048905 Bacteria 814588
281 Ga0496102_0000075 3300048905 Bacteria 147013
282 Ga0496102_0012902 3300048905 Bacteria 7234
283 Ga0496102_0861617 3300048905 Bacteria 828
284 Ga0496103_0000107 3300048906 Bacteria 91213
285 Ga0496103_0000218 3300048906 Bacteria 56596
286 Ga0496103_0022454 3300048906 Bacteria 3800
287 Ga0496103_0025573 3300048906 Bacteria 3569
288 Ga0496104_0000008 3300048907 Bacteria 516976
289 Ga0496104_0005525 3300048907 Bacteria 11072
290 Ga0496104_0079815 3300048907 Bacteria 3119
291 Ga0496104_0656248 3300048907 Bacteria 958
292 Ga0496105_0000003 3300048908 Bacteria 713251
293 Ga0496105_0000005 3300048908 Bacteria 475797
294 Ga0496105_0000095 3300048908 Bacteria 60866
295 Ga0496105_0342909 3300048908 Bacteria 1194
296 Ga0496106_0000040 3300048909 Bacteria 108754
297 Ga0496106_0000055 3300048909 Bacteria 91570
298 Ga0496106_0172251 3300048909 Bacteria 1716
299 Ga0496107_0000002 3300048910 Bacteria 320871
300 Ga0496107_0000025 3300048910 Bacteria 116138
301 Ga0496108_0000039 3300048911 Bacteria 149440
302 Ga0496108_0000120 3300048911 Bacteria 77596
303 Ga0496108_0003227 3300048911 Bacteria 13110
304 Ga0496109_0000038 3300048912 Bacteria 150745
305 Ga0496109_0000044 3300048912 Bacteria 133779
306 Ga0496109_0069232 3300048912 Bacteria 3236
307 Ga0496110_0015412 3300048913 Bacteria 6360
308 Ga0496110_0021454 3300048913 Bacteria 5470
309 Ga0496111_0004309 3300048914 Bacteria 8974
310 Ga0496112_0000013 3300048915 Bacteria 237194
311 Ga0496112_0004499 3300048915 Bacteria 11834
312 Ga0496113_0017227 3300048916 Bacteria 5010
313 Ga0496113_0019571 3300048916 Bacteria 4739
314 Ga0496113_0108141 3300048916 Bacteria 2161
315 Ga0496113_0128931 3300048916 Bacteria 1983
316 Ga0496114_0000003 3300048917 Bacteria 630981
317 Ga0496114_0009707 3300048917 Bacteria 7645
318 Ga0496115_0000016 3300048918 Bacteria 187067
319 Ga0496115_0000017 3300048918 Bacteria 185702
320 Ga0496115_0000031 3300048918 Bacteria 138258
321 Ga0496115_0016776 3300048918 Bacteria 5581
322 Ga0496117_0001530 3300048920 Bacteria 33004
323 Ga0496117_0174648 3300048920 Bacteria 1243
324 Ga0496118_0000289 3300048921 Bacteria 87537
325 Ga0496119_0000623 3300048922 Bacteria 47810
326 Ga0496119_0020627 3300048922 Bacteria 4799
327 Ga0496119_0025986 3300048922 Bacteria 4074
328 Ga0496121_0101187 3300048924 Bacteria 2223
329 Ga0496121_0209468 3300048924 Bacteria 1382
330 Ga0496125_0004465 3300048928 Bacteria 16125
331 Ga0496125_0195441 3300048928 Bacteria 1331
332 Ga0496126_0025901 3300048929 Bacteria 5633
333 Ga0501031_0001747 3300049568 Bacteria 13630
334 Ga0501032_0002784 3300049569 Bacteria 13605
335 Ga0501033_0000704 3300049570 Bacteria 30846
336 Ga0501034_0047679 3300049571 Bacteria 4325
337 Ga0501034_0051092 3300049571 Bacteria 4168
338 Ga0501036_0002903 3300049572 Bacteria 13603
339 Ga0501037_0002260 3300049573 Bacteria 13921
340 Ga0501038_0000825 3300049574 Bacteria 27591
341 Ga0501039_0031240 3300049575 Bacteria 4105
342 Ga0501040_0029918 3300049576 Bacteria 3676
343 Ga0501042_0029525 3300049578 Bacteria 3867
344 Ga0501042_0151376 3300049578 Bacteria 1673
345 Ga0501043_0001179 3300049579 Bacteria 22990
346 Ga0501043_0173448 3300049579 Bacteria 1682
347 Ga0501046_0000798 3300049580 Bacteria 30547
348 Ga0501047_0000879 3300049581 Bacteria 30673
349 Ga0501048_0002672 3300049582 Bacteria 13611
350 Ga0501067_0098255 3300049583 Bacteria 1626
351 Ga0501068_0027722 3300049584 Bacteria 3346
352 Ga0501069_0010862 3300049585 Bacteria 4824
353 Ga0501069_0025308 3300049585 Bacteria 3242
354 Ga0501070_0000703 3300049586 Bacteria 30732
355 Ga0501070_0002141 3300049586 Bacteria 17348
356 Ga0501070_0039779 3300049586 Bacteria 3921
357 Ga0501070_0159263 3300049586 Bacteria 1861
358 Ga0501070_0544508 3300049586 Bacteria 929
359 Ga0501071_0118477 3300049587 Bacteria 1961
360 Ga0501071_0200648 3300049587 Bacteria 1498
361 Ga0501072_0155401 3300049588 Bacteria 1824
362 Ga0501073_0002725 3300049589 Bacteria 13241
363 Ga0501074_0034999 3300049590 Bacteria 3639
364 Ga0501074_0044398 3300049590 Bacteria 3217
365 Ga0501074_0067520 3300049590 Bacteria 2571
366 Ga0501076_0041709 3300049592 Bacteria 3612
367 Ga0501076_0068241 3300049592 Bacteria 2840
368 Ga0501077_0426763 3300049593 Bacteria 848
369 Ga0501079_0018117 3300049741 Bacteria 5378
370 Ga0501079_0025280 3300049741 Bacteria 4555
371 Ga0501080_0007948 3300049742 Bacteria 9609
372 Ga0501083_0027437 3300049744 Bacteria 3929
373 Ga0501083_0121997 3300049744 Bacteria 1709
374 Ga0501083_0194254 3300049744 Bacteria 1324
375 Ga0501035_0001052 3300049822 Bacteria 28914
376 Ga0501044_0000735 3300049823 Bacteria 39493
377 Ga0501044_0162965 3300049823 Bacteria 2205
378 Ga0501044_0352299 3300049823 Bacteria 1391
379 Ga0501045_0203725 3300049824 Bacteria 1474
380 nmdc:mga00v17_172069_c1 3300050491 Bacteria 1397
381 nmdc:mga0yw44_135763_c1 3300050492 Bacteria 1596
382 nmdc:mga0yw44_179169_c1 3300050492 Bacteria 1394
383 nmdc:mga04h51_97842_c1 3300050495 Bacteria 1065
384 nmdc:mga0a205_55_c2 3300050515 Bacteria 2169
385 Ga0495601_0000022 3300053077 Bacteria 148418
386 Ga0495601_0003583 3300053077 Bacteria 8930
387 Ga0495601_0005776 3300053077 Bacteria 7220
388 Ga0495601_0052535 3300053077 Bacteria 2573
389 Ga0495601_0067075 3300053077 Bacteria 2285
390 Ga0495601_0128694 3300053077 Unclassified 1648
391 Ga0495612_0000031 3300053078 Bacteria 80955
392 Ga0495612_0000049 3300053078 Bacteria 54959
393 Ga0495612_0000130 3300053078 Bacteria 31802
394 Ga0495655_0000005 3300053083 Bacteria 257472
395 Ga0495595_0010237 3300053084 Bacteria 3894
396 Ga0495595_0044981 3300053084 Unclassified 2029
397 Ga0495619_0006515 3300053085 Bacteria 7389
398 Ga0495619_0037236 3300053085 Bacteria 3168
399 Ga0495619_0054964 3300053085 Bacteria 2636
400 Ga0500595_061229 3300053119 Bacteria 1136
401 Ga0500614_000363 3300053123 Bacteria 11805
402 Ga0500628_000013 3300053129 Bacteria 106419
403 Ga0501084_0049695 3300054114 Bacteria 3510
404 Ga0501082_0049754 3300060353 Bacteria 3614
405 Ga0466962_0066474 3300061719 Bacteria 1721

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046689 Ga0495613_0000021 Ga0495613_0000021_107736_108386 215
2 3300009093 Ga0105240_10195288 Ga0105240_101952881 222
3 3300009545 Ga0105237_10018145 Ga0105237_100181456 222
4 3300025914 Ga0207671_10011693 Ga0207671_100116935 222
5 3300005466 Ga0070685_10000027 Ga0070685_1000002712 233
6 3300045976 Ga0466967_0515354 Ga0466967_0515354_52_771 233
7 3300046533 Ga0495640_0127091 Ga0495640_0127091_198_968 234
8 3300047319 Ga0495674_0000010 Ga0495674_0000010_282810_283580 234
9 3300006051 Ga0075364_10039506 Ga0075364_100395062 235
10 3300006178 Ga0075367_10198750 Ga0075367_101987502 235
11 3300048929 Ga0496126_0025901 Ga0496126_0025901_3736_4497 235
12 3300049579 Ga0501043_0173448 Ga0501043_0173448_663_1427 235
13 3300049585 Ga0501069_0025308 Ga0501069_0025308_875_1639 235
14 3300049586 Ga0501070_0544508 Ga0501070_0544508_18_782 235
15 3300049587 Ga0501071_0118477 Ga0501071_0118477_485_1249 235
16 3300049590 Ga0501074_0044398 Ga0501074_0044398_2239_3003 235
17 3300049741 Ga0501079_0025280 Ga0501079_0025280_3576_4340 235
18 3300049823 Ga0501044_0352299 Ga0501044_0352299_88_852 235
19 3300050491 nmdc:mga00v17_172069_c1 nmdc:mga00v17_172069_c1_322_1041 235
20 3300050492 nmdc:mga0yw44_135763_c1 nmdc:mga0yw44_135763_c1_199_918 235
21 3300050492 nmdc:mga0yw44_179169_c1 nmdc:mga0yw44_179169_c1_94_813 235
22 3300046515 Ga0495620_0000041 Ga0495620_0000041_84248_85003 236
23 3300050495 nmdc:mga04h51_97842_c1 nmdc:mga04h51_97842_c1_202_945 236
24 3300032002 Ga0307416_100272178 Ga0307416_1002721782 237
25 3300049592 Ga0501076_0041709 Ga0501076_0041709_542_1270 237
26 3300049593 Ga0501077_0426763 Ga0501077_0426763_96_824 237
27 3300049824 Ga0501045_0203725 Ga0501045_0203725_282_1010 237
28 3300053085 Ga0495619_0054964 Ga0495619_0054964_1635_2351 237
29 3300005356 Ga0070674_100000004 Ga0070674_10000000417 238
30 3300005718 Ga0068866_10000004 Ga0068866_1000000454 238
31 3300025899 Ga0207642_10000005 Ga0207642_10000005153 238
32 3300025937 Ga0207669_10000021 Ga0207669_1000002174 238
33 3300025944 Ga0207661_10001061 Ga0207661_1000106113 238
34 3300046512 Ga0495610_0147213 Ga0495610_0147213_121_873 238
35 3300048916 Ga0496113_0108141 Ga0496113_0108141_755_1528 238
36 3300048918 Ga0496115_0000016 Ga0496115_0000016_67775_68572 238
37 3300049744 Ga0501083_0121997 Ga0501083_0121997_579_1343 238
38 3300053083 Ga0495655_0000005 Ga0495655_0000005_183934_184686 238
39 3300053129 Ga0500628_000013 Ga0500628_000013_72962_73714 238
40 3300014325 Ga0163163_10083274 Ga0163163_100832743 239
41 3300017792 Ga0163161_10295322 Ga0163161_102953221 239
42 3300025915 Ga0207693_10000165 Ga0207693_1000016532 239
43 3300048907 Ga0496104_0005525 Ga0496104_0005525_7042_7761 239
44 3300048907 Ga0496104_0656248 Ga0496104_0656248_140_859 239
45 3300048908 Ga0496105_0000095 Ga0496105_0000095_34555_35274 239
46 3300053077 Ga0495601_0003583 Ga0495601_0003583_3191_3910 239
47 3300005366 Ga0070659_100022157 Ga0070659_1000221576 240
48 3300006852 Ga0075433_10013912 Ga0075433_100139124 240
49 3300025932 Ga0207690_10011149 Ga0207690_100111492 240
50 3300045976 Ga0466967_0393147 Ga0466967_0393147_37_759 240
51 3300046516 Ga0495628_0000170 Ga0495628_0000170_48528_49337 240
52 3300046642 Ga0495634_0000908 Ga0495634_0000908_11500_12234 240
53 3300046684 Ga0495669_0000223 Ga0495669_0000223_31941_32663 240
54 3300048088 Ga0495602_0003458 Ga0495602_0003458_2941_3750 240
55 3300050515 nmdc:mga0a205_55_c2 nmdc:mga0a205_55_c2_1298_2074 240
56 3300003659 JGI25404J52841_10029196 JGI25404J52841_100291961 241
57 3300005338 Ga0068868_100004195 Ga0068868_1000041958 241
58 3300005547 Ga0070693_100000307 Ga0070693_10000030731 241
59 3300005983 Ga0081540_1000116 Ga0081540_100011632 241
60 3300044693 Ga0466961_0022578 Ga0466961_0022578_1430_2164 241
61 3300045836 Ga0466958_0008664 Ga0466958_0008664_329_1063 241
62 3300048905 Ga0496102_0012902 Ga0496102_0012902_3845_4606 241
63 3300048906 Ga0496103_0025573 Ga0496103_0025573_221_982 241
64 3300048920 Ga0496117_0001530 Ga0496117_0001530_3313_4074 241
65 3300048921 Ga0496118_0000289 Ga0496118_0000289_79293_80054 241
66 3300048922 Ga0496119_0020627 Ga0496119_0020627_138_899 241
67 3300048924 Ga0496121_0209468 Ga0496121_0209468_592_1359 241
68 3300049586 Ga0501070_0159263 Ga0501070_0159263_299_1042 241
69 3300005367 Ga0070667_100017587 Ga0070667_1000175871 242
70 3300005435 Ga0070714_100171774 Ga0070714_1001717742 242
71 3300005435 Ga0070714_100199273 Ga0070714_1001992732 242
72 3300005436 Ga0070713_100161360 Ga0070713_1001613602 242
73 3300005439 Ga0070711_100044227 Ga0070711_1000442272 242
74 3300005548 Ga0070665_100119671 Ga0070665_1001196712 242
75 3300006028 Ga0070717_10019774 Ga0070717_100197745 242
76 3300006028 Ga0070717_10143093 Ga0070717_101430932 242
77 3300006175 Ga0070712_100013954 Ga0070712_1000139542 242
78 3300009101 Ga0105247_10000275 Ga0105247_100002757 242
79 3300025898 Ga0207692_10073560 Ga0207692_100735602 242
80 3300025906 Ga0207699_10011178 Ga0207699_100111782 242
81 3300025915 Ga0207693_10002704 Ga0207693_100027045 242
82 3300025916 Ga0207663_10011112 Ga0207663_100111123 242
83 3300025928 Ga0207700_10015992 Ga0207700_100159922 242
84 3300025929 Ga0207664_10554240 Ga0207664_105542401 242
85 3300025935 Ga0207709_10245711 Ga0207709_102457112 242
86 3300028379 Ga0268266_10046706 Ga0268266_100467062 242
87 3300035118 Ga0373954_0264875 Ga0373954_0264875_33_761 242
88 3300036401 Ga0373937_0015820 Ga0373937_0015820_2266_2994 242
89 3300045049 Ga0466959_0097028 Ga0466959_0097028_303_1034 242
90 3300045836 Ga0466958_0392909 Ga0466958_0392909_151_882 242
91 3300046454 Ga0495592_0120480 Ga0495592_0120480_799_1527 242
92 3300046459 Ga0495629_0269276 Ga0495629_0269276_232_960 242
93 3300046462 Ga0495651_0004571 Ga0495651_0004571_6881_7609 242
94 3300046463 Ga0495653_0019772 Ga0495653_0019772_995_1723 242
95 3300046476 Ga0495662_0000010 Ga0495662_0000010_44753_45484 242
96 3300046511 Ga0495608_0003286 Ga0495608_0003286_7280_8008 242
97 3300046514 Ga0495618_0052192 Ga0495618_0052192_691_1419 242
98 3300046516 Ga0495628_0019726 Ga0495628_0019726_3682_4410 242
99 3300046529 Ga0495652_0017241 Ga0495652_0017241_4922_5650 242
100 3300046536 Ga0495587_0005352 Ga0495587_0005352_1231_1959 242
101 3300046559 Ga0495667_0009672 Ga0495667_0009672_1001_1729 242
102 3300046642 Ga0495634_0022387 Ga0495634_0022387_366_1094 242
103 3300046663 Ga0495635_0047870 Ga0495635_0047870_1090_1818 242
104 3300046675 Ga0495657_0010387 Ga0495657_0010387_5773_6501 242
105 3300046679 Ga0495623_0020121 Ga0495623_0020121_197_925 242
106 3300046680 Ga0495646_0047020 Ga0495646_0047020_1333_2061 242
107 3300046689 Ga0495613_0070761 Ga0495613_0070761_1769_2497 242
108 3300046809 Ga0495600_0031135 Ga0495600_0031135_163_891 242
109 3300047317 Ga0495604_0000058 Ga0495604_0000058_27438_28166 242
110 3300047317 Ga0495604_0002171 Ga0495604_0002171_8714_9442 242
111 3300047317 Ga0495604_0004857 Ga0495604_0004857_8588_9316 242
112 3300047319 Ga0495674_0004375 Ga0495674_0004375_7692_8420 242
113 3300047322 Ga0495680_0006123 Ga0495680_0006123_3824_4552 242
114 3300047471 Ga0495684_0027975 Ga0495684_0027975_2603_3331 242
115 3300047472 Ga0495686_0029983 Ga0495686_0029983_1963_2718 242
116 3300048088 Ga0495602_0000393 Ga0495602_0000393_8617_9345 242
117 3300048088 Ga0495602_0016302 Ga0495602_0016302_5792_6520 242
118 3300048907 Ga0496104_0079815 Ga0496104_0079815_1319_2047 242
119 3300048908 Ga0496105_0342909 Ga0496105_0342909_433_1161 242
120 3300048915 Ga0496112_0004499 Ga0496112_0004499_3145_3873 242
121 3300048916 Ga0496113_0017227 Ga0496113_0017227_3511_4239 242
122 3300053077 Ga0495601_0128694 Ga0495601_0128694_610_1338 242
123 3300053084 Ga0495595_0010237 Ga0495595_0010237_1094_1822 242
124 3300053084 Ga0495595_0044981 Ga0495595_0044981_1209_1937 242
125 3300053085 Ga0495619_0037236 Ga0495619_0037236_1553_2281 242
126 3300005435 Ga0070714_100029000 Ga0070714_1000290002 243
127 3300005436 Ga0070713_100054278 Ga0070713_1000542782 243
128 3300005436 Ga0070713_100177179 Ga0070713_1001771792 243
129 3300006028 Ga0070717_10084223 Ga0070717_100842232 243
130 3300006028 Ga0070717_10144863 Ga0070717_101448633 243
131 3300020070 Ga0206356_11355238 Ga0206356_113552383 243
132 3300025928 Ga0207700_10371462 Ga0207700_103714621 243
133 3300025929 Ga0207664_10216776 Ga0207664_102167761 243
134 3300025929 Ga0207664_10378572 Ga0207664_103785721 243
135 3300046459 Ga0495629_0001902 Ga0495629_0001902_5607_6362 243
136 3300046476 Ga0495662_0005585 Ga0495662_0005585_3985_4716 243
137 3300048088 Ga0495602_0395328 Ga0495602_0395328_196_942 243
138 3300005435 Ga0070714_100460435 Ga0070714_1004604351 244
139 3300005563 Ga0068855_100248634 Ga0068855_1002486341 244
140 3300009093 Ga0105240_10033226 Ga0105240_100332262 244
141 3300025927 Ga0207687_10000075 Ga0207687_1000007567 244
142 3300025929 Ga0207664_10158840 Ga0207664_101588402 244
143 3300025949 Ga0207667_10098885 Ga0207667_100988853 244
144 3300044684 Ga0466966_0143392 Ga0466966_0143392_292_1041 244
145 3300044693 Ga0466961_0020891 Ga0466961_0020891_1602_2351 244
146 3300044694 Ga0466963_0078262 Ga0466963_0078262_1040_1792 244
147 3300044719 Ga0466971_0079950 Ga0466971_0079950_496_1248 244
148 3300044735 Ga0466968_0078105 Ga0466968_0078105_616_1374 244
149 3300044735 Ga0466968_0089109 Ga0466968_0089109_209_955 244
150 3300045049 Ga0466959_0038974 Ga0466959_0038974_77_829 244
151 3300045836 Ga0466958_0040893 Ga0466958_0040893_1794_2552 244
152 3300045976 Ga0466967_0460755 Ga0466967_0460755_98_832 244
153 3300046476 Ga0495662_0045133 Ga0495662_0045133_106_867 244
154 3300048088 Ga0495602_0088744 Ga0495602_0088744_1690_2436 244
155 3300061719 Ga0466962_0066474 Ga0466962_0066474_714_1460 244
156 3300005842 Ga0068858_100000204 Ga0068858_10000020464 245
157 3300021384 Ga0213876_10010508 Ga0213876_100105084 245
158 3300021388 Ga0213875_10016701 Ga0213875_100167015 245
159 3300025929 Ga0207664_10151888 Ga0207664_101518882 245
160 3300026035 Ga0207703_10000042 Ga0207703_10000042117 245
161 3300026121 Ga0207683_10098099 Ga0207683_100980993 245
162 3300037853 Ga0436364_0070620 Ga0436364_0070620_1051_1788 245
163 3300037853 Ga0436364_0193121 Ga0436364_0193121_13008_13748 245
164 3300037853 Ga0436364_0885412 Ga0436364_0885412_10955_11692 245
165 3300039437 Ga0436365_0140783 Ga0436365_0140783_13931_14671 245
166 3300039437 Ga0436365_1084861 Ga0436365_1084861_5091_5828 245
167 3300039450 Ga0436363_0496970 Ga0436363_0496970_518_1255 245
168 3300039450 Ga0436363_0698225 Ga0436363_0698225_225_962 245
169 3300039450 Ga0436363_1349946 Ga0436363_1349946_11810_12550 245
170 3300039453 Ga0436362_0249417 Ga0436362_0249417_1574_2314 245
171 3300044694 Ga0466963_0000712 Ga0466963_0000712_4036_4785 245
172 3300044706 Ga0466964_0051279 Ga0466964_0051279_162_911 245
173 3300045836 Ga0466958_0004225 Ga0466958_0004225_3831_4580 245
174 3300045976 Ga0466967_0003301 Ga0466967_0003301_8651_9400 245
175 3300045976 Ga0466967_0709531 Ga0466967_0709531_222_962 245
176 3300046517 Ga0495630_0000167 Ga0495630_0000167_26625_27365 245
177 3300046663 Ga0495635_0152933 Ga0495635_0152933_170_910 245
178 3300046689 Ga0495613_0009403 Ga0495613_0009403_4105_4842 245
179 3300047322 Ga0495680_0082714 Ga0495680_0082714_755_1507 245
180 3300048918 Ga0496115_0000017 Ga0496115_0000017_163453_164199 245
181 3300048920 Ga0496117_0174648 Ga0496117_0174648_164_925 245
182 3300048922 Ga0496119_0000623 Ga0496119_0000623_6251_7012 245
183 3300053077 Ga0495601_0052535 Ga0495601_0052535_1573_2313 245
184 3300053077 Ga0495601_0067075 Ga0495601_0067075_993_1733 245
185 3300053085 Ga0495619_0006515 Ga0495619_0006515_2285_3025 245
186 3300005435 Ga0070714_100212758 Ga0070714_1002127583 246
187 3300013308 Ga0157375_10003561 Ga0157375_1000356119 246
188 3300014968 Ga0157379_10380178 Ga0157379_103801781 246
189 3300025934 Ga0207686_10000212 Ga0207686_1000021246 246
190 3300026118 Ga0207675_100443805 Ga0207675_1004438051 246
191 3300046477 Ga0495664_0000032 Ga0495664_0000032_50067_50810 246
192 3300046500 Ga0495596_0114320 Ga0495596_0114320_208_969 246
193 3300046516 Ga0495628_0106876 Ga0495628_0106876_1065_1805 246
194 3300048905 Ga0496102_0000075 Ga0496102_0000075_94004_94756 246
195 3300048906 Ga0496103_0000107 Ga0496103_0000107_50786_51538 246
196 3300048906 Ga0496103_0022454 Ga0496103_0022454_2930_3691 246
197 3300048928 Ga0496125_0004465 Ga0496125_0004465_8515_9276 246
198 3300049578 Ga0501042_0151376 Ga0501042_0151376_742_1488 246
199 3300049592 Ga0501076_0068241 Ga0501076_0068241_1053_1808 246
200 3300053077 Ga0495601_0005776 Ga0495601_0005776_5679_6431 246
201 3300053119 Ga0500595_061229 Ga0500595_061229_266_1027 246
202 3300005333 Ga0070677_10000002 Ga0070677_1000000242 247
203 3300005341 Ga0070691_10000112 Ga0070691_100001124 247
204 3300005459 Ga0068867_100168435 Ga0068867_1001684354 247
205 3300005577 Ga0068857_100133716 Ga0068857_1001337163 247
206 3300009093 Ga0105240_10841259 Ga0105240_108412591 247
207 3300013308 Ga0157375_10241024 Ga0157375_102410244 247
208 3300013308 Ga0157375_10252582 Ga0157375_102525823 247
209 3300014969 Ga0157376_10398345 Ga0157376_103983452 247
210 3300025893 Ga0207682_10000012 Ga0207682_1000001226 247
211 3300025913 Ga0207695_10541509 Ga0207695_105415092 247
212 3300026088 Ga0207641_10004106 Ga0207641_100041066 247
213 3300046454 Ga0495592_0115449 Ga0495592_0115449_722_1468 247
214 3300046543 Ga0495645_0000119 Ga0495645_0000119_13216_13959 247
215 3300046681 Ga0495647_0000004 Ga0495647_0000004_66842_67597 247
216 3300048903 Ga0496100_0000024 Ga0496100_0000024_21475_22236 247
217 3300048904 Ga0496101_0000072 Ga0496101_0000072_93903_94664 247
218 3300048905 Ga0496102_0000002 Ga0496102_0000002_203478_204221 247
219 3300048906 Ga0496103_0000218 Ga0496103_0000218_53417_54160 247
220 3300048909 Ga0496106_0000040 Ga0496106_0000040_14091_14852 247
221 3300048910 Ga0496107_0000025 Ga0496107_0000025_21475_22236 247
222 3300048911 Ga0496108_0000039 Ga0496108_0000039_50679_51428 247
223 3300048912 Ga0496109_0000038 Ga0496109_0000038_98242_98991 247
224 3300048913 Ga0496110_0015412 Ga0496110_0015412_3609_4373 247
225 3300048914 Ga0496111_0004309 Ga0496111_0004309_2001_2765 247
226 3300048916 Ga0496113_0128931 Ga0496113_0128931_740_1504 247
227 3300048928 Ga0496125_0195441 Ga0496125_0195441_35_784 247
228 3300053078 Ga0495612_0000031 Ga0495612_0000031_80151_80912 247
229 3300005329 Ga0070683_100025281 Ga0070683_1000252815 248
230 3300005347 Ga0070668_100012615 Ga0070668_1000126152 248
231 3300005367 Ga0070667_100119000 Ga0070667_1001190002 248
232 3300005535 Ga0070684_100012292 Ga0070684_1000122924 248
233 3300005548 Ga0070665_100100493 Ga0070665_1001004932 248
234 3300005614 Ga0068856_100704790 Ga0068856_1007047902 248
235 3300005618 Ga0068864_100000090 Ga0068864_1000000907 248
236 3300005843 Ga0068860_100061287 Ga0068860_1000612872 248
237 3300005937 Ga0081455_10043735 Ga0081455_100437355 248
238 3300009553 Ga0105249_10010181 Ga0105249_100101812 248
239 3300013297 Ga0157378_10026903 Ga0157378_100269033 248
240 3300021384 Ga0213876_10013051 Ga0213876_100130514 248
241 3300021388 Ga0213875_10080878 Ga0213875_100808782 248
242 3300025944 Ga0207661_10001766 Ga0207661_100017662 248
243 3300025961 Ga0207712_10003093 Ga0207712_1000309311 248
244 3300025972 Ga0207668_10005014 Ga0207668_100050148 248
245 3300025986 Ga0207658_10001096 Ga0207658_100010961 248
246 3300026023 Ga0207677_10005000 Ga0207677_100050006 248
247 3300026078 Ga0207702_10636737 Ga0207702_106367372 248
248 3300026095 Ga0207676_10000016 Ga0207676_10000016224 248
249 3300028379 Ga0268266_10091117 Ga0268266_100911172 248
250 3300028380 Ga0268265_10080039 Ga0268265_100800392 248
251 3300031251 Ga0265327_10004082 Ga0265327_100040823 248
252 3300037853 Ga0436364_0723236 Ga0436364_0723236_2029_2775 248
253 3300039437 Ga0436365_0150830 Ga0436365_0150830_6285_7043 248
254 3300039450 Ga0436363_0198760 Ga0436363_0198760_3518_4276 248
255 3300044684 Ga0466966_0161736 Ga0466966_0161736_456_1214 248
256 3300045049 Ga0466959_0055770 Ga0466959_0055770_806_1564 248
257 3300045976 Ga0466967_0087980 Ga0466967_0087980_1626_2372 248
258 3300046454 Ga0495592_0145056 Ga0495592_0145056_582_1361 248
259 3300046514 Ga0495618_0000054 Ga0495618_0000054_42758_43519 248
260 3300046529 Ga0495652_0103130 Ga0495652_0103130_782_1543 248
261 3300046543 Ga0495645_0000088 Ga0495645_0000088_15917_16678 248
262 3300046675 Ga0495657_0000006 Ga0495657_0000006_174648_175454 248
263 3300046678 Ga0495599_0012162 Ga0495599_0012162_37_795 248
264 3300047321 Ga0495676_0000612 Ga0495676_0000612_19094_19861 248
265 3300048905 Ga0496102_0861617 Ga0496102_0861617_25_789 248
266 3300048909 Ga0496106_0172251 Ga0496106_0172251_571_1335 248
267 3300048913 Ga0496110_0021454 Ga0496110_0021454_1626_2381 248
268 3300048915 Ga0496112_0000013 Ga0496112_0000013_85588_86337 248
269 3300048916 Ga0496113_0019571 Ga0496113_0019571_623_1399 248
270 3300048917 Ga0496114_0000003 Ga0496114_0000003_550642_551394 248
271 3300048918 Ga0496115_0000031 Ga0496115_0000031_100109_100861 248
272 3300049586 Ga0501070_0039779 Ga0501070_0039779_3155_3901 248
273 3300053077 Ga0495601_0000022 Ga0495601_0000022_67875_68678 248
274 3300053078 Ga0495612_0000049 Ga0495612_0000049_26155_26916 248
275 3300053078 Ga0495612_0000130 Ga0495612_0000130_4803_5561 248
276 3300001977 JGI24746J21847_1000306 JGI24746J21847_10003064 249
277 3300001979 JGI24740J21852_10007407 JGI24740J21852_100074076 249
278 3300002239 JGI24034J26672_10000097 JGI24034J26672_1000009712 249
279 3300002244 JGI24742J22300_10001208 JGI24742J22300_100012083 249
280 3300005334 Ga0068869_100146262 Ga0068869_1001462622 249
281 3300005335 Ga0070666_10371440 Ga0070666_103714401 249
282 3300005335 Ga0070666_10390493 Ga0070666_103904932 249
283 3300005530 Ga0070679_100002833 Ga0070679_1000028339 249
284 3300005535 Ga0070684_100690748 Ga0070684_1006907481 249
285 3300005548 Ga0070665_100000308 Ga0070665_1000003083 249
286 3300005548 Ga0070665_100164598 Ga0070665_1001645983 249
287 3300005614 Ga0068856_100083132 Ga0068856_1000831323 249
288 3300005841 Ga0068863_100003356 Ga0068863_1000033562 249
289 3300005842 Ga0068858_100000066 Ga0068858_10000006683 249
290 3300006163 Ga0070715_10000014 Ga0070715_1000001413 249
291 3300006173 Ga0070716_100341414 Ga0070716_1003414141 249
292 3300006175 Ga0070712_100260359 Ga0070712_1002603592 249
293 3300009098 Ga0105245_10000040 Ga0105245_10000040127 249
294 3300009098 Ga0105245_10000587 Ga0105245_1000058726 249
295 3300009176 Ga0105242_10001336 Ga0105242_1000133623 249
296 3300009177 Ga0105248_10324336 Ga0105248_103243362 249
297 3300009545 Ga0105237_10344327 Ga0105237_103443272 249
298 3300009551 Ga0105238_10000033 Ga0105238_1000003366 249
299 3300009553 Ga0105249_10000150 Ga0105249_1000015037 249
300 3300009553 Ga0105249_10103348 Ga0105249_101033483 249
301 3300013296 Ga0157374_10000692 Ga0157374_1000069229 249
302 3300014968 Ga0157379_10014189 Ga0157379_100141893 249
303 3300025903 Ga0207680_10052645 Ga0207680_100526453 249
304 3300025903 Ga0207680_10249348 Ga0207680_102493482 249
305 3300025905 Ga0207685_10000046 Ga0207685_1000004612 249
306 3300025906 Ga0207699_10101436 Ga0207699_101014362 249
307 3300025912 Ga0207707_10142541 Ga0207707_101425413 249
308 3300025915 Ga0207693_10307729 Ga0207693_103077292 249
309 3300025916 Ga0207663_10178465 Ga0207663_101784652 249
310 3300025921 Ga0207652_10000080 Ga0207652_10000080102 249
311 3300025924 Ga0207694_10000012 Ga0207694_1000001267 249
312 3300025927 Ga0207687_10000046 Ga0207687_1000004698 249
313 3300025934 Ga0207686_10003942 Ga0207686_100039422 249
314 3300025942 Ga0207689_10097197 Ga0207689_100971973 249
315 3300025961 Ga0207712_10000027 Ga0207712_1000002756 249
316 3300025981 Ga0207640_10001937 Ga0207640_100019376 249
317 3300025986 Ga0207658_10008929 Ga0207658_100089291 249
318 3300026035 Ga0207703_10000054 Ga0207703_1000005482 249
319 3300026041 Ga0207639_10014109 Ga0207639_100141096 249
320 3300026075 Ga0207708_10054041 Ga0207708_100540412 249
321 3300026088 Ga0207641_10000252 Ga0207641_1000025251 249
322 3300028379 Ga0268266_10000099 Ga0268266_1000009983 249
323 3300028379 Ga0268266_10015619 Ga0268266_100156197 249
324 3300028556 Ga0265337_1000123 Ga0265337_100012317 249
325 3300028558 Ga0265326_10000111 Ga0265326_1000011117 249
326 3300028654 Ga0265322_10000005 Ga0265322_10000005238 249
327 3300028800 Ga0265338_10000171 Ga0265338_10000171106 249
328 3300028800 Ga0265338_10359926 Ga0265338_103599261 249
329 3300029957 Ga0265324_10001504 Ga0265324_100015046 249
330 3300031239 Ga0265328_10026202 Ga0265328_100262022 249
331 3300031240 Ga0265320_10000293 Ga0265320_1000029316 249
332 3300031241 Ga0265325_10026028 Ga0265325_100260284 249
333 3300031242 Ga0265329_10008722 Ga0265329_100087224 249
334 3300031249 Ga0265339_10028240 Ga0265339_100282402 249
335 3300031250 Ga0265331_10001064 Ga0265331_1000106416 249
336 3300031251 Ga0265327_10000040 Ga0265327_1000004022 249
337 3300031711 Ga0265314_10000983 Ga0265314_1000098322 249
338 3300041512 Ga0451853_1535246 Ga0451853_1535246_168_962 249
339 3300042438 Ga0439459_0022205 Ga0439459_0022205_363_1124 249
340 3300046455 Ga0495603_0023061 Ga0495603_0023061_69_833 249
341 3300046460 Ga0495638_0079904 Ga0495638_0079904_1076_1834 249
342 3300046461 Ga0495641_0000040 Ga0495641_0000040_47377_48165 249
343 3300046499 Ga0495594_0000009 Ga0495594_0000009_119365_120129 249
344 3300046511 Ga0495608_0014687 Ga0495608_0014687_922_1710 249
345 3300046535 Ga0495586_0008630 Ga0495586_0008630_2188_2946 249
346 3300046536 Ga0495587_0062553 Ga0495587_0062553_1012_1776 249
347 3300046557 Ga0495622_0000097 Ga0495622_0000097_2009_2773 249
348 3300046559 Ga0495667_0000038 Ga0495667_0000038_97826_98590 249
349 3300046690 Ga0495624_0000007 Ga0495624_0000007_90226_90990 249
350 3300046694 Ga0495649_0002326 Ga0495649_0002326_3734_4630 249
351 3300047321 Ga0495676_0000860 Ga0495676_0000860_17715_18479 249
352 3300047322 Ga0495680_0008542 Ga0495680_0008542_4067_4831 249
353 3300047444 Ga0495675_0029200 Ga0495675_0029200_2425_3183 249
354 3300047446 Ga0495679_011234 Ga0495679_011234_2644_3444 249
355 3300047472 Ga0495686_0039497 Ga0495686_0039497_49_801 249
356 3300048903 Ga0496100_0000001 Ga0496100_0000001_121234_121998 249
357 3300048904 Ga0496101_0000028 Ga0496101_0000028_121223_121987 249
358 3300048907 Ga0496104_0000008 Ga0496104_0000008_61784_62551 249
359 3300048908 Ga0496105_0000003 Ga0496105_0000003_61784_62551 249
360 3300048908 Ga0496105_0000005 Ga0496105_0000005_132415_133245 249
361 3300048909 Ga0496106_0000055 Ga0496106_0000055_14153_14917 249
362 3300048910 Ga0496107_0000002 Ga0496107_0000002_126490_127254 249
363 3300048911 Ga0496108_0000120 Ga0496108_0000120_12463_13263 249
364 3300048911 Ga0496108_0003227 Ga0496108_0003227_3364_4143 249
365 3300048912 Ga0496109_0000044 Ga0496109_0000044_18886_19686 249
366 3300048912 Ga0496109_0069232 Ga0496109_0069232_392_1171 249
367 3300048917 Ga0496114_0009707 Ga0496114_0009707_6613_7377 249
368 3300048918 Ga0496115_0016776 Ga0496115_0016776_376_1143 249
369 3300048922 Ga0496119_0025986 Ga0496119_0025986_1039_1869 249
370 3300048924 Ga0496121_0101187 Ga0496121_0101187_317_1072 249
371 3300049568 Ga0501031_0001747 Ga0501031_0001747_9881_10642 249
372 3300049569 Ga0501032_0002784 Ga0501032_0002784_9877_10638 249
373 3300049570 Ga0501033_0000704 Ga0501033_0000704_20235_20996 249
374 3300049571 Ga0501034_0047679 Ga0501034_0047679_2309_3070 249
375 3300049571 Ga0501034_0051092 Ga0501034_0051092_2981_3742 249
376 3300049572 Ga0501036_0002903 Ga0501036_0002903_2986_3747 249
377 3300049573 Ga0501037_0002260 Ga0501037_0002260_9911_10672 249
378 3300049574 Ga0501038_0000825 Ga0501038_0000825_20210_20971 249
379 3300049575 Ga0501039_0031240 Ga0501039_0031240_2984_3745 249
380 3300049576 Ga0501040_0029918 Ga0501040_0029918_2867_3628 249
381 3300049578 Ga0501042_0029525 Ga0501042_0029525_177_938 249
382 3300049579 Ga0501043_0001179 Ga0501043_0001179_2968_3729 249
383 3300049580 Ga0501046_0000798 Ga0501046_0000798_19953_20714 249
384 3300049581 Ga0501047_0000879 Ga0501047_0000879_19969_20730 249
385 3300049582 Ga0501048_0002672 Ga0501048_0002672_2991_3752 249
386 3300049583 Ga0501067_0098255 Ga0501067_0098255_275_1039 249
387 3300049584 Ga0501068_0027722 Ga0501068_0027722_245_1006 249
388 3300049585 Ga0501069_0010862 Ga0501069_0010862_2421_3182 249
389 3300049586 Ga0501070_0000703 Ga0501070_0000703_9942_10703 249
390 3300049586 Ga0501070_0002141 Ga0501070_0002141_5237_6001 249
391 3300049587 Ga0501071_0200648 Ga0501071_0200648_421_1182 249
392 3300049588 Ga0501072_0155401 Ga0501072_0155401_932_1693 249
393 3300049589 Ga0501073_0002725 Ga0501073_0002725_2689_3450 249
394 3300049590 Ga0501074_0034999 Ga0501074_0034999_2576_3337 249
395 3300049590 Ga0501074_0067520 Ga0501074_0067520_1480_2241 249
396 3300049741 Ga0501079_0018117 Ga0501079_0018117_2970_3731 249
397 3300049742 Ga0501080_0007948 Ga0501080_0007948_2958_3719 249
398 3300049744 Ga0501083_0027437 Ga0501083_0027437_2966_3727 249
399 3300049744 Ga0501083_0194254 Ga0501083_0194254_305_1063 249
400 3300049822 Ga0501035_0001052 Ga0501035_0001052_10122_10883 249
401 3300049823 Ga0501044_0000735 Ga0501044_0000735_28821_29582 249
402 3300049823 Ga0501044_0162965 Ga0501044_0162965_39_803 249
403 3300053123 Ga0500614_000363 Ga0500614_000363_5820_6608 249
404 3300054114 Ga0501084_0049695 Ga0501084_0049695_2602_3363 249
405 3300060353 Ga0501082_0049754 Ga0501082_0049754_106_867 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00708

Acylphosphatase

Acylphosphatase

12

96

0.95

PF13298

LigD_N

DNA polymerase Ligase (LigD)

107

209

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tnv-assembly1.cif.gz_A acylphosphatase with thermophilic surface and mesophilic core 0.9814 4 93
1ulr-assembly1.cif.gz_A crystal structure of tt0497 from thermus thermophilus hb8 0.9785 7 91
8jfs-assembly2.cif.gz_B phosphate bound acylphosphatase from deinococcus radiodurans at 1 angstrom resolution 0.9779 7 91
2w4d-assembly1.cif.gz_B acylphosphatase variant g91a from pyrococcus horikoshii 0.977 4 93
4ojh-assembly2.cif.gz_B the crystal structure of truncated, y86e mutant of s. solfataricus acylphosphatase 0.9768 4 91
ID Description Score Start End Superfamily
af_A4I1P4_95_208_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.986 4 83 3.30.70.100
af_K7LZQ3_146_256_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9819 4 92 3.30.70.100
3tnvA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9814 4 93 3.30.70.100
3tnvA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9707 4 93 3.30.70.100
2hltA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9684 6 91 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A6C1NPZ5-F1-model_v4 Acylphosphatase (EC 3.6.1.7) 1.006 10 77 GO:0003998
AF-A0A7J2JHW8-F1-model_v4 acylphosphatase (EC 3.6.1.7) 0.9972 7 77 GO:0003998
AF-A0A3C2AJ36-F1-model_v4 acylphosphatase (EC 3.6.1.7) 0.9965 4 74 GO:0003998
AF-A0A146KJF8-F1-model_v4 acylphosphatase (EC 3.6.1.7) 0.9954 6 81 GO:0003998
AF-A0A7C0W6E8-F1-model_v4 Acylphosphatase (EC 3.6.1.7) 0.9953 3 85 GO:0003998

Feature Viewer

pLDDT pTM Quality
85.38 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map