F435994

General Info

Members Datasets Scaffolds Average Seq Length
405 227 404 138

Family's Representative Sequence

Representative Sequence 3300035172|Ga0373955_1033353|Ga0373955_1033353_67_477
Length 136
Sequence MKAHTEYLTFNTKKRRELVHLTPTLESILARSGVTEGFMLVSAMHITAGVFVNDDESGLHADIWEWLEKLAPRADYRHHQTGEDNGDAHLKSMLVHHEVIVPITKGALDLGPWQRVFYAEFDGQRSKRLIVKVMGE

Samples

Sample ID Description Type Environment
1 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
102 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
103 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
104 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
105 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
106 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
107 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
108 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
110 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
111 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
112 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
113 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
114 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
115 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
116 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
117 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
118 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
119 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
120 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
123 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
129 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
130 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
132 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
133 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
134 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
135 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
140 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
143 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
149 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
150 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
151 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
152 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
153 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
154 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
155 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
165 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
166 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
167 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
178 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
179 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
180 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
181 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
206 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
207 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
208 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
209 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
212 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
213 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
214 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
215 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
216 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
222 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
223 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
224 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
225 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
226 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
227 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.26
Metatranscriptomes 0.49
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.74
Rhizosphere 96.79
Stem 0
Stem Tuber 0
Unclassified 2.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25405J52794_10131939 3300003911 Unclassified 566
2 Ga0070658_10016271 3300005327 Bacteria 5952
3 Ga0070658_10253192 3300005327 Bacteria 1494
4 Ga0070676_10128406 3300005328 Bacteria 1600
5 Ga0070676_10520542 3300005328 Unclassified 847
6 Ga0070683_101055864 3300005329 Unclassified 780
7 Ga0070666_10380907 3300005335 Bacteria 1012
8 Ga0070680_100007098 3300005336 Bacteria 8539
9 Ga0070680_100026536 3300005336 Bacteria 4633
10 Ga0070660_100681320 3300005339 Bacteria 861
11 Ga0070669_100044563 3300005353 Bacteria 3232
12 Ga0070674_100750964 3300005356 Bacteria 838
13 Ga0070674_101345420 3300005356 Bacteria 638
14 Ga0070659_100231853 3300005366 Bacteria 1526
15 Ga0070709_10068202 3300005434 Unclassified 2287
16 Ga0070714_100055779 3300005435 Bacteria 3378
17 Ga0070714_100590495 3300005435 Bacteria 1066
18 Ga0070714_101058655 3300005435 Bacteria 790
19 Ga0070713_100832201 3300005436 Bacteria 886
20 Ga0070710_10665865 3300005437 Bacteria 731
21 Ga0070711_100999279 3300005439 Unclassified 718
22 Ga0070700_101006366 3300005441 Bacteria 685
23 Ga0070681_10006232 3300005458 Bacteria 11596
24 Ga0070681_10070206 3300005458 Bacteria 3468
25 Ga0070681_10317735 3300005458 Bacteria 1467
26 Ga0068867_100552783 3300005459 Bacteria 997
27 Ga0068867_101420195 3300005459 Unclassified 644
28 Ga0070706_100001169 3300005467 Bacteria 28200
29 Ga0070706_100133401 3300005467 Bacteria 2318
30 Ga0070707_100000945 3300005468 Bacteria 28847
31 Ga0070707_101204386 3300005468 Unclassified 723
32 Ga0070699_100348250 3300005518 Bacteria 1334
33 Ga0070699_101004545 3300005518 Bacteria 765
34 Ga0070679_100045583 3300005530 Bacteria 4370
35 Ga0070679_100589507 3300005530 Bacteria 1055
36 Ga0070684_101259319 3300005535 Unclassified 696
37 Ga0070697_100012897 3300005536 Bacteria 6548
38 Ga0070697_100241055 3300005536 Bacteria 1544
39 Ga0070697_100383896 3300005536 Bacteria 1217
40 Ga0070697_100639142 3300005536 Bacteria 937
41 Ga0070686_101441471 3300005544 Bacteria 579
42 Ga0070665_100890552 3300005548 Bacteria 903
43 Ga0070665_101305792 3300005548 Bacteria 735
44 Ga0068855_100004998 3300005563 Bacteria 16177
45 Ga0068855_100006960 3300005563 Bacteria 13725
46 Ga0068857_100442022 3300005577 Bacteria 1215
47 Ga0068857_101104800 3300005577 Unclassified 766
48 Ga0068856_100085851 3300005614 Unclassified 3127
49 Ga0068856_100177047 3300005614 Bacteria 2145
50 Ga0068852_100017493 3300005616 Bacteria 5626
51 Ga0068852_100408955 3300005616 Bacteria 1336
52 Ga0068859_100744657 3300005617 Bacteria 1069
53 Ga0068864_100557003 3300005618 Bacteria 1109
54 Ga0068864_100562759 3300005618 Bacteria 1103
55 Ga0068863_100335760 3300005841 Unclassified 1470
56 Ga0068860_100198600 3300005843 Unclassified 1943
57 Ga0081455_10009735 3300005937 Bacteria 9852
58 Ga0081539_10001590 3300005985 Bacteria 37532
59 Ga0070717_10015499 3300006028 Bacteria 5890
60 Ga0070717_10070539 3300006028 Bacteria 2912
61 Ga0070717_10572243 3300006028 Bacteria 1024
62 Ga0070717_11933460 3300006028 Bacteria 532
63 Ga0070715_10356800 3300006163 Bacteria 800
64 Ga0070715_10657137 3300006163 Unclassified 621
65 Ga0097621_100110810 3300006237 Unclassified 2319
66 Ga0097621_101280183 3300006237 Bacteria 692
67 Ga0068871_100125136 3300006358 Bacteria 2175
68 Ga0075428_100374698 3300006844 Bacteria 1526
69 Ga0075433_10001100 3300006852 Bacteria 19529
70 Ga0075434_100000253 3300006871 Bacteria 37649
71 Ga0075434_101196136 3300006871 Bacteria 772
72 Ga0075436_100026960 3300006914 Bacteria 3957
73 Ga0075436_100039295 3300006914 Bacteria 3266
74 Ga0097620_100744772 3300006931 Bacteria 1069
75 Ga0075435_100003070 3300007076 Bacteria 11263
76 Ga0099794_10000024 3300007265 Bacteria 62816
77 Ga0105240_10020810 3300009093 Bacteria 8738
78 Ga0105240_10402643 3300009093 Unclassified 1541
79 Ga0105240_10735372 3300009093 Unclassified 1074
80 Ga0105240_11105679 3300009093 Bacteria 843
81 Ga0105240_11635531 3300009093 Bacteria 673
82 Ga0105240_12218315 3300009093 Unclassified 569
83 Ga0105240_12419988 3300009093 Bacteria 543
84 Ga0105245_10112077 3300009098 Bacteria 2538
85 Ga0105241_10192788 3300009174 Unclassified 1697
86 Ga0105241_10409772 3300009174 Unclassified 1191
87 Ga0105241_11386788 3300009174 Unclassified 672
88 Ga0105241_11746286 3300009174 Bacteria 606
89 Ga0105242_11533422 3300009176 Bacteria 698
90 Ga0105242_13234666 3300009176 Bacteria 506
91 Ga0105237_10224418 3300009545 Bacteria 1879
92 Ga0105237_10315145 3300009545 Bacteria 1567
93 Ga0105237_11519157 3300009545 Unclassified 676
94 Ga0105238_10078643 3300009551 Bacteria 3288
95 Ga0105238_10439647 3300009551 Bacteria 1300
96 Ga0105239_11219671 3300010375 Bacteria 867
97 Ga0157373_10090261 3300013100 Bacteria 2158
98 Ga0157373_10630698 3300013100 Bacteria 782
99 Ga0157373_10847068 3300013100 Bacteria 676
100 Ga0157371_10102800 3300013102 Bacteria 2027
101 Ga0157370_10000292 3300013104 Bacteria 63401
102 Ga0157370_10406962 3300013104 Bacteria 1252
103 Ga0157370_10507573 3300013104 Bacteria 1107
104 Ga0157370_10705057 3300013104 Bacteria 921
105 Ga0157370_11087580 3300013104 Bacteria 723
106 Ga0157369_10036289 3300013105 Bacteria 5402
107 Ga0157369_10040879 3300013105 Bacteria 5061
108 Ga0157369_10317743 3300013105 Bacteria 1619
109 Ga0157369_10347407 3300013105 Unclassified 1541
110 Ga0157374_10334018 3300013296 Bacteria 1504
111 Ga0157374_11156376 3300013296 Bacteria 795
112 Ga0157374_12667023 3300013296 Unclassified 527
113 Ga0157378_10066372 3300013297 Bacteria 3232
114 Ga0157378_10413825 3300013297 Unclassified 1331
115 Ga0157378_10685581 3300013297 Bacteria 1043
116 Ga0157378_11800080 3300013297 Bacteria 660
117 Ga0163162_11997503 3300013306 Unclassified 664
118 Ga0157372_10105968 3300013307 Bacteria 3216
119 Ga0157372_10300330 3300013307 Bacteria 1868
120 Ga0157372_10513011 3300013307 Bacteria 1398
121 Ga0157375_12077273 3300013308 Bacteria 676
122 Ga0157375_13097167 3300013308 Bacteria 555
123 Ga0163163_10045088 3300014325 Bacteria 4327
124 Ga0163163_10561600 3300014325 Unclassified 1204
125 Ga0163163_10972545 3300014325 Unclassified 912
126 Ga0163163_11327455 3300014325 Unclassified 781
127 Ga0157379_11805568 3300014968 Bacteria 601
128 Ga0157376_10571519 3300014969 Bacteria 1121
129 Ga0157376_11958720 3300014969 Bacteria 623
130 Ga0213875_10046855 3300021388 Unclassified 2028
131 Ga0207680_10216559 3300025903 Bacteria 1311
132 Ga0207685_10701835 3300025905 Unclassified 551
133 Ga0207699_10107911 3300025906 Unclassified 1779
134 Ga0207645_10047683 3300025907 Bacteria 2735
135 Ga0207705_10007769 3300025909 Bacteria 7875
136 Ga0207705_10089166 3300025909 Bacteria 2257
137 Ga0207684_10000182 3300025910 Bacteria 100957
138 Ga0207707_10016762 3300025912 Bacteria 6382
139 Ga0207707_10098123 3300025912 Bacteria 2561
140 Ga0207707_10192335 3300025912 Bacteria 1780
141 Ga0207695_10106011 3300025913 Bacteria 2797
142 Ga0207695_10175653 3300025913 Unclassified 2065
143 Ga0207695_11340107 3300025913 Bacteria 596
144 Ga0207671_10191186 3300025914 Unclassified 1596
145 Ga0207693_11332681 3300025915 Unclassified 536
146 Ga0207663_10034019 3300025916 Bacteria 3043
147 Ga0207660_10074906 3300025917 Bacteria 2471
148 Ga0207660_10076266 3300025917 Bacteria 2451
149 Ga0207660_10586480 3300025917 Bacteria 907
150 Ga0207660_10983944 3300025917 Unclassified 688
151 Ga0207657_10184684 3300025919 Bacteria 1684
152 Ga0207657_10580444 3300025919 Bacteria 875
153 Ga0207652_10151096 3300025921 Bacteria 2079
154 Ga0207646_10005272 3300025922 Bacteria 13634
155 Ga0207646_10300513 3300025922 Bacteria 1450
156 Ga0207681_10231929 3300025923 Bacteria 1433
157 Ga0207694_10116635 3300025924 Unclassified 2128
158 Ga0207694_10337987 3300025924 Unclassified 1245
159 Ga0207687_10063984 3300025927 Bacteria 2606
160 Ga0207700_10038009 3300025928 Unclassified 3491
161 Ga0207664_10063718 3300025929 Bacteria 2947
162 Ga0207664_10391490 3300025929 Bacteria 1235
163 Ga0207664_10559693 3300025929 Bacteria 1026
164 Ga0207669_10676537 3300025937 Bacteria 846
165 Ga0207669_11216348 3300025937 Bacteria 638
166 Ga0207704_10124294 3300025938 Bacteria 1773
167 Ga0207661_10148453 3300025944 Bacteria 2025
168 Ga0207661_11345814 3300025944 Bacteria 656
169 Ga0207667_10018894 3300025949 Bacteria 7710
170 Ga0207667_10019913 3300025949 Bacteria 7476
171 Ga0207667_10788268 3300025949 Bacteria 948
172 Ga0207708_10258502 3300026075 Bacteria 1405
173 Ga0207702_10084141 3300026078 Unclassified 2769
174 Ga0207702_10142093 3300026078 Bacteria 2173
175 Ga0207641_11576677 3300026088 Unclassified 658
176 Ga0207674_10180992 3300026116 Unclassified 2059
177 Ga0207683_10421008 3300026121 Bacteria 1230
178 Ga0207683_10655605 3300026121 Bacteria 972
179 Ga0207683_10753617 3300026121 Bacteria 903
180 Ga0207683_11660064 3300026121 Bacteria 588
181 Ga0207698_10006391 3300026142 Bacteria 7348
182 Ga0209588_1000026 3300027671 Bacteria 81177
183 Ga0268264_10621813 3300028381 Unclassified 1066
184 Ga0268264_10815294 3300028381 Bacteria 933
185 Ga0265319_1000997 3300028563 Bacteria 17737
186 Ga0265319_1189024 3300028563 Bacteria 633
187 Ga0265334_10002136 3300028573 Bacteria 9317
188 Ga0265318_10000203 3300028577 Bacteria 51133
189 Ga0265318_10000946 3300028577 Bacteria 18747
190 Ga0265323_10021661 3300028653 Unclassified 2462
191 Ga0265323_10160936 3300028653 Unclassified 716
192 Ga0265322_10043188 3300028654 Unclassified 1283
193 Ga0265322_10182489 3300028654 Unclassified 601
194 Ga0265336_10046296 3300028666 Bacteria 1322
195 Ga0265338_10007036 3300028800 Bacteria 14113
196 Ga0265338_10039079 3300028800 Bacteria 4484
197 Ga0265338_10059966 3300028800 Bacteria 3349
198 Ga0265338_10135050 3300028800 Unclassified 1941
199 Ga0265760_10142091 3300031090 Bacteria 782
200 Ga0265760_10153509 3300031090 Unclassified 756
201 Ga0265330_10000562 3300031235 Bacteria 24182
202 Ga0265330_10302199 3300031235 Bacteria 675
203 Ga0265332_10000369 3300031238 Bacteria 33334
204 Ga0265328_10004863 3300031239 Bacteria 5788
205 Ga0265328_10320423 3300031239 Unclassified 601
206 Ga0265320_10001291 3300031240 Bacteria 18271
207 Ga0265320_10184828 3300031240 Bacteria 933
208 Ga0265325_10000136 3300031241 Bacteria 50918
209 Ga0265325_10197461 3300031241 Bacteria 930
210 Ga0265329_10001244 3300031242 Bacteria 12464
211 Ga0265340_10000201 3300031247 Bacteria 29823
212 Ga0265340_10012025 3300031247 Bacteria 4577
213 Ga0265339_10006243 3300031249 Bacteria 7848
214 Ga0265339_10504607 3300031249 Unclassified 558
215 Ga0265331_10092789 3300031250 Unclassified 1394
216 Ga0265331_10207436 3300031250 Bacteria 882
217 Ga0265331_10234842 3300031250 Unclassified 823
218 Ga0265316_10002005 3300031344 Bacteria 21456
219 Ga0265316_10003440 3300031344 Bacteria 16019
220 Ga0265316_10005096 3300031344 Bacteria 12873
221 Ga0265316_10031636 3300031344 Bacteria 4324
222 Ga0265316_10034298 3300031344 Unclassified 4124
223 Ga0265316_10109977 3300031344 Unclassified 2088
224 Ga0265316_10130614 3300031344 Bacteria 1892
225 Ga0265316_10288846 3300031344 Bacteria 1197
226 Ga0265313_10000095 3300031595 Bacteria 89645
227 Ga0265313_10004235 3300031595 Bacteria 11122
228 Ga0265313_10151498 3300031595 Bacteria 991
229 Ga0316579_10556742 3300031691 Bacteria 555
230 Ga0265314_10001016 3300031711 Bacteria 32760
231 Ga0265342_10000560 3300031712 Bacteria 39323
232 Ga0265342_10069748 3300031712 Bacteria 2052
233 Ga0316578_10016231 3300031728 Unclassified 4025
234 Ga0307406_10047949 3300031901 Bacteria 2695
235 Ga0307407_10456246 3300031903 Bacteria 929
236 Ga0307412_10004940 3300031911 Bacteria 7449
237 Ga0307409_100602781 3300031995 Bacteria 1086
238 Ga0307409_101518484 3300031995 Bacteria 697
239 Ga0316583_10019859 3300032133 Bacteria 2409
240 Ga0373926_0027646 3300035083 Bacteria 1989
241 Ga0373923_0145960 3300035111 Bacteria 1072
242 Ga0373953_0238122 3300035117 Bacteria 790
243 Ga0373954_0030355 3300035118 Bacteria 2492
244 Ga0373954_0499969 3300035118 Unclassified 602
245 Ga0373956_0325544 3300035119 Unclassified 732
246 Ga0373955_0001140 3300035172 Bacteria 11273
247 Ga0373955_1033353 3300035172 Bacteria 506
248 Ga0373924_0083546 3300035410 Bacteria 1360
249 Ga0373931_0323064 3300035691 Bacteria 959
250 Ga0373935_0120347 3300035692 Unclassified 1753
251 Ga0373935_0204830 3300035692 Unclassified 1365
252 Ga0373927_0010149 3300035695 Bacteria 6297
253 Ga0373927_0046612 3300035695 Bacteria 2804
254 Ga0373927_0349195 3300035695 Unclassified 975
255 Ga0373927_0815827 3300035695 Bacteria 616
256 Ga0373933_0449574 3300035724 Bacteria 843
257 Ga0373933_0489315 3300035724 Bacteria 806
258 Ga0373933_0592938 3300035724 Bacteria 728
259 Ga0373947_0174958 3300035725 Bacteria 1395
260 Ga0373937_0019595 3300036401 Archaea 6055
261 Ga0373937_0035981 3300036401 Unclassified 4510
262 Ga0373937_0127313 3300036401 Bacteria 2377
263 Ga0373937_0404019 3300036401 Bacteria 1296
264 Ga0373937_1665242 3300036401 Bacteria 585
265 Ga0316582_0021254 3300036647 Bacteria 3830
266 Ga0316582_0539396 3300036647 Unclassified 804
267 Ga0316584_0111219 3300036712 Unclassified 2050
268 Ga0316584_0517677 3300036712 Bacteria 836
269 Ga0373925_0002020 3300037068 Bacteria 16792
270 Ga0373925_0031533 3300037068 Unclassified 3896
271 Ga0373925_0243483 3300037068 Unclassified 1441
272 Ga0373925_0986754 3300037068 Unclassified 694
273 Ga0373925_1074555 3300037068 Bacteria 662
274 Ga0395905_0116840 3300037471 Bacteria 2507
275 Ga0436364_0511469 3300037853 Bacteria 1723
276 Ga0436364_0620271 3300037853 Unclassified 2273
277 Ga0436364_0678502 3300037853 Bacteria 7677
278 Ga0436364_0881915 3300037853 Unclassified 1329
279 Ga0436365_0845325 3300039437 Bacteria 3259
280 Ga0436365_1321707 3300039437 Bacteria 608
281 Ga0436361_0827053 3300039447 Unclassified 546
282 Ga0436361_1117670 3300039447 Unclassified 755
283 Ga0436363_1214298 3300039450 Unclassified 772
284 Ga0451851_0949180 3300041507 Bacteria 690
285 Ga0451853_2679832 3300041512 Bacteria 780
286 Ga0451577_0002478 3300042876 Bacteria 21949
287 Ga0451577_0073828 3300042876 Bacteria 3043
288 Ga0451577_0172382 3300042876 Bacteria 1950
289 Ga0451577_0923505 3300042876 Bacteria 785
290 Ga0451577_1429046 3300042876 Bacteria 613
291 Ga0453683_0020215 3300044673 Bacteria 4255
292 Ga0453683_0157451 3300044673 Unclassified 1436
293 Ga0466966_0212325 3300044684 Bacteria 1169
294 Ga0466963_0605331 3300044694 Unclassified 774
295 Ga0453684_0000576 3300044712 Bacteria 136529
296 Ga0453684_0069845 3300044712 Unclassified 4452
297 Ga0453684_0858917 3300044712 Bacteria 975
298 Ga0453684_2406073 3300044712 Unclassified 522
299 Ga0466959_0104440 3300045049 Unclassified 2027
300 Ga0466959_0163869 3300045049 Bacteria 1562
301 Ga0451576_0000398 3300045051 Bacteria 101148
302 Ga0451576_0105494 3300045051 Bacteria 2932
303 Ga0451576_0230633 3300045051 Bacteria 1934
304 Ga0451576_1456996 3300045051 Unclassified 712
305 Ga0466958_0989858 3300045836 Bacteria 549
306 Ga0466967_0004589 3300045976 Bacteria 9358
307 Ga0466967_0063618 3300045976 Bacteria 3279
308 Ga0466967_1527496 3300045976 Bacteria 665
309 Ga0495651_0057826 3300046462 Unclassified 2976
310 Ga0495651_0224693 3300046462 Bacteria 1297
311 Ga0495653_0927264 3300046463 Bacteria 518
312 Ga0495580_0003381 3300046472 Bacteria 13631
313 Ga0495580_0003528 3300046472 Bacteria 13289
314 Ga0495580_0004230 3300046472 Bacteria 12074
315 Ga0495580_0023440 3300046472 Bacteria 4532
316 Ga0495580_0696844 3300046472 Unclassified 665
317 Ga0495580_0791305 3300046472 Bacteria 615
318 Ga0495639_0456638 3300046475 Unclassified 649
319 Ga0495639_0503182 3300046475 Bacteria 619
320 Ga0495662_0027587 3300046476 Unclassified 2743
321 Ga0495594_0065631 3300046499 Unclassified 2013
322 Ga0495608_0308779 3300046511 Bacteria 978
323 Ga0495628_0069478 3300046516 Unclassified 2747
324 Ga0495630_0009826 3300046517 Bacteria 6890
325 Ga0495630_0588184 3300046517 Bacteria 853
326 Ga0495652_0172799 3300046529 Unclassified 1666
327 Ga0495665_0047302 3300046531 Bacteria 2282
328 Ga0495665_0178317 3300046531 Bacteria 1105
329 Ga0495640_0050697 3300046533 Unclassified 2858
330 Ga0495586_0357941 3300046535 Unclassified 839
331 Ga0495587_0037519 3300046536 Unclassified 2909
332 Ga0495645_0006266 3300046543 Bacteria 8247
333 Ga0495645_0056821 3300046543 Bacteria 2842
334 Ga0495667_0092634 3300046559 Unclassified 1956
335 Ga0495634_0200386 3300046642 Unclassified 1240
336 Ga0495635_0009511 3300046663 Bacteria 6795
337 Ga0495635_0165272 3300046663 Bacteria 1506
338 Ga0495599_0058586 3300046678 Unclassified 2409
339 Ga0495623_0080375 3300046679 Bacteria 2018
340 Ga0495623_0105369 3300046679 Unclassified 1714
341 Ga0495613_0064487 3300046689 Unclassified 2679
342 Ga0495613_0427127 3300046689 Bacteria 901
343 Ga0495600_0032361 3300046809 Unclassified 3393
344 Ga0495600_0308395 3300046809 Bacteria 997
345 Ga0495604_0084977 3300047317 Unclassified 2362
346 Ga0495604_0139779 3300047317 Bacteria 1731
347 Ga0495674_0022192 3300047319 Bacteria 5855
348 Ga0495674_0110244 3300047319 Bacteria 2334
349 Ga0495674_0749383 3300047319 Bacteria 763
350 Ga0495674_1442145 3300047319 Unclassified 511
351 Ga0495680_0109767 3300047322 Unclassified 2045
352 Ga0495675_0083603 3300047444 Unclassified 2009
353 Ga0495675_0177334 3300047444 Bacteria 1306
354 Ga0495684_0008686 3300047471 Bacteria 7856
355 Ga0495684_0070305 3300047471 Bacteria 2661
356 Ga0495684_0363960 3300047471 Bacteria 1024
357 Ga0495602_0122822 3300048088 Bacteria 2086
358 Ga0496103_0010417 3300048906 Bacteria 5502
359 Ga0496104_1812451 3300048907 Bacteria 512
360 Ga0496115_0347118 3300048918 Bacteria 1211
361 Ga0501031_0000820 3300049568 Bacteria 18692
362 Ga0501032_0012728 3300049569 Bacteria 5998
363 Ga0501033_0045384 3300049570 Bacteria 3270
364 Ga0501034_0014266 3300049571 Bacteria 8187
365 Ga0501036_0000321 3300049572 Bacteria 33369
366 Ga0501037_0012059 3300049573 Bacteria 6364
367 Ga0501038_0000944 3300049574 Bacteria 25942
368 Ga0501039_0036874 3300049575 Bacteria 3772
369 Ga0501040_0331736 3300049576 Bacteria 1089
370 Ga0501043_0002091 3300049579 Bacteria 17040
371 Ga0501046_0000237 3300049580 Bacteria 56869
372 Ga0501046_0688452 3300049580 Bacteria 721
373 Ga0501047_0018911 3300049581 Bacteria 6606
374 Ga0501048_0037201 3300049582 Bacteria 3495
375 Ga0501067_0008866 3300049583 Bacteria 5571
376 Ga0501068_0000434 3300049584 Bacteria 21263
377 Ga0501069_0000529 3300049585 Bacteria 17473
378 Ga0501070_0065138 3300049586 Bacteria 3017
379 Ga0501072_0000682 3300049588 Bacteria 24502
380 Ga0501072_1089610 3300049588 Unclassified 622
381 Ga0501073_0004338 3300049589 Bacteria 10649
382 Ga0501073_0113144 3300049589 Bacteria 1882
383 Ga0501074_0026358 3300049590 Bacteria 4214
384 Ga0501076_0109220 3300049592 Bacteria 2235
385 Ga0501077_0011585 3300049593 Bacteria 5510
386 Ga0501079_0056245 3300049741 Bacteria 3035
387 Ga0501080_0179891 3300049742 Bacteria 1946
388 Ga0501083_0245170 3300049744 Bacteria 1166
389 Ga0501035_0024577 3300049822 Bacteria 5524
390 Ga0501044_0036883 3300049823 Bacteria 5112
391 Ga0501045_0442825 3300049824 Bacteria 966
392 nmdc:mga0n895_1322972_c1 3300050512 Bacteria 691
393 nmdc:mga0n895_237_c1 3300050512 Bacteria 34922
394 nmdc:mga0rr50_23282_c1 3300050513 Bacteria 4268
395 nmdc:mga08x19_2272_c1 3300050514 Bacteria 11696
396 nmdc:mga08x19_68357_c1 3300050514 Unclassified 2312
397 nmdc:mga0a205_1502_c1 3300050515 Bacteria 19899
398 Ga0495601_0410596 3300053077 Unclassified 877
399 Ga0495601_0850670 3300053077 Unclassified 578
400 Ga0495619_0311226 3300053085 Bacteria 1091
401 Ga0495619_1040012 3300053085 Bacteria 547
402 Ga0501084_0001239 3300054114 Bacteria 20111
403 Ga0501084_0020535 3300054114 Bacteria 5510
404 Ga0501082_0012443 3300060353 Bacteria 7312

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046472 Ga0495580_0023440 Ga0495580_0023440_3372_3761 126
2 3300005937 Ga0081455_10009735 Ga0081455_100097359 130
3 3300014325 Ga0163163_11327455 Ga0163163_113274551 130
4 3300035172 Ga0373955_1033353 Ga0373955_1033353_67_477 136
5 iso_pu_bacteria 2884215851 2884217054 136
6 3300003911 JGI25405J52794_10131939 JGI25405J52794_101319391 137
7 3300005327 Ga0070658_10016271 Ga0070658_100162715 137
8 3300005327 Ga0070658_10253192 Ga0070658_102531922 137
9 3300005328 Ga0070676_10128406 Ga0070676_101284063 137
10 3300005328 Ga0070676_10520542 Ga0070676_105205422 137
11 3300005329 Ga0070683_101055864 Ga0070683_1010558641 137
12 3300005335 Ga0070666_10380907 Ga0070666_103809072 137
13 3300005336 Ga0070680_100007098 Ga0070680_1000070982 137
14 3300005336 Ga0070680_100026536 Ga0070680_1000265364 137
15 3300005339 Ga0070660_100681320 Ga0070660_1006813202 137
16 3300005353 Ga0070669_100044563 Ga0070669_1000445632 137
17 3300005356 Ga0070674_100750964 Ga0070674_1007509642 137
18 3300005356 Ga0070674_101345420 Ga0070674_1013454202 137
19 3300005366 Ga0070659_100231853 Ga0070659_1002318532 137
20 3300005434 Ga0070709_10068202 Ga0070709_100682023 137
21 3300005435 Ga0070714_100055779 Ga0070714_1000557794 137
22 3300005435 Ga0070714_100590495 Ga0070714_1005904952 137
23 3300005435 Ga0070714_101058655 Ga0070714_1010586551 137
24 3300005436 Ga0070713_100832201 Ga0070713_1008322012 137
25 3300005437 Ga0070710_10665865 Ga0070710_106658651 137
26 3300005439 Ga0070711_100999279 Ga0070711_1009992792 137
27 3300005441 Ga0070700_101006366 Ga0070700_1010063661 137
28 3300005458 Ga0070681_10006232 Ga0070681_100062327 137
29 3300005458 Ga0070681_10070206 Ga0070681_100702062 137
30 3300005458 Ga0070681_10317735 Ga0070681_103177352 137
31 3300005459 Ga0068867_100552783 Ga0068867_1005527832 137
32 3300005459 Ga0068867_101420195 Ga0068867_1014201952 137
33 3300005467 Ga0070706_100001169 Ga0070706_10000116917 137
34 3300005467 Ga0070706_100133401 Ga0070706_1001334013 137
35 3300005468 Ga0070707_100000945 Ga0070707_10000094522 137
36 3300005468 Ga0070707_101204386 Ga0070707_1012043861 137
37 3300005518 Ga0070699_100348250 Ga0070699_1003482502 137
38 3300005518 Ga0070699_101004545 Ga0070699_1010045452 137
39 3300005530 Ga0070679_100045583 Ga0070679_1000455832 137
40 3300005530 Ga0070679_100589507 Ga0070679_1005895072 137
41 3300005535 Ga0070684_101259319 Ga0070684_1012593191 137
42 3300005536 Ga0070697_100012897 Ga0070697_1000128974 137
43 3300005536 Ga0070697_100241055 Ga0070697_1002410551 137
44 3300005536 Ga0070697_100383896 Ga0070697_1003838962 137
45 3300005536 Ga0070697_100639142 Ga0070697_1006391422 137
46 3300005544 Ga0070686_101441471 Ga0070686_1014414711 137
47 3300005548 Ga0070665_100890552 Ga0070665_1008905522 137
48 3300005548 Ga0070665_101305792 Ga0070665_1013057922 137
49 3300005563 Ga0068855_100004998 Ga0068855_1000049987 137
50 3300005563 Ga0068855_100006960 Ga0068855_10000696012 137
51 3300005577 Ga0068857_100442022 Ga0068857_1004420223 137
52 3300005577 Ga0068857_101104800 Ga0068857_1011048001 137
53 3300005614 Ga0068856_100085851 Ga0068856_1000858512 137
54 3300005614 Ga0068856_100177047 Ga0068856_1001770471 137
55 3300005616 Ga0068852_100017493 Ga0068852_1000174933 137
56 3300005616 Ga0068852_100408955 Ga0068852_1004089552 137
57 3300005617 Ga0068859_100744657 Ga0068859_1007446572 137
58 3300005618 Ga0068864_100557003 Ga0068864_1005570032 137
59 3300005618 Ga0068864_100562759 Ga0068864_1005627592 137
60 3300005841 Ga0068863_100335760 Ga0068863_1003357602 137
61 3300005843 Ga0068860_100198600 Ga0068860_1001986003 137
62 3300005985 Ga0081539_10001590 Ga0081539_1000159010 137
63 3300006028 Ga0070717_10015499 Ga0070717_100154995 137
64 3300006028 Ga0070717_10070539 Ga0070717_100705392 137
65 3300006028 Ga0070717_10572243 Ga0070717_105722432 137
66 3300006028 Ga0070717_11933460 Ga0070717_119334601 137
67 3300006163 Ga0070715_10356800 Ga0070715_103568002 137
68 3300006163 Ga0070715_10657137 Ga0070715_106571371 137
69 3300006237 Ga0097621_100110810 Ga0097621_1001108103 137
70 3300006237 Ga0097621_101280183 Ga0097621_1012801832 137
71 3300006358 Ga0068871_100125136 Ga0068871_1001251363 137
72 3300006844 Ga0075428_100374698 Ga0075428_1003746982 137
73 3300006852 Ga0075433_10001100 Ga0075433_100011005 137
74 3300006871 Ga0075434_100000253 Ga0075434_10000025324 137
75 3300006871 Ga0075434_101196136 Ga0075434_1011961361 137
76 3300006914 Ga0075436_100026960 Ga0075436_1000269603 137
77 3300006914 Ga0075436_100039295 Ga0075436_1000392954 137
78 3300006931 Ga0097620_100744772 Ga0097620_1007447722 137
79 3300007076 Ga0075435_100003070 Ga0075435_10000307011 137
80 3300007265 Ga0099794_10000024 Ga0099794_100000246 137
81 3300009093 Ga0105240_10020810 Ga0105240_100208105 137
82 3300009093 Ga0105240_10402643 Ga0105240_104026432 137
83 3300009093 Ga0105240_10735372 Ga0105240_107353722 137
84 3300009093 Ga0105240_11105679 Ga0105240_111056792 137
85 3300009093 Ga0105240_11635531 Ga0105240_116355311 137
86 3300009093 Ga0105240_12218315 Ga0105240_122183151 137
87 3300009093 Ga0105240_12419988 Ga0105240_124199881 137
88 3300009098 Ga0105245_10112077 Ga0105245_101120772 137
89 3300009174 Ga0105241_10192788 Ga0105241_101927884 137
90 3300009174 Ga0105241_10409772 Ga0105241_104097722 137
91 3300009174 Ga0105241_11386788 Ga0105241_113867881 137
92 3300009174 Ga0105241_11746286 Ga0105241_117462862 137
93 3300009176 Ga0105242_11533422 Ga0105242_115334221 137
94 3300009176 Ga0105242_13234666 Ga0105242_132346661 137
95 3300009545 Ga0105237_10224418 Ga0105237_102244182 137
96 3300009545 Ga0105237_10315145 Ga0105237_103151452 137
97 3300009545 Ga0105237_11519157 Ga0105237_115191571 137
98 3300009551 Ga0105238_10078643 Ga0105238_100786436 137
99 3300009551 Ga0105238_10439647 Ga0105238_104396471 137
100 3300010375 Ga0105239_11219671 Ga0105239_112196712 137
101 3300013100 Ga0157373_10090261 Ga0157373_100902612 137
102 3300013100 Ga0157373_10630698 Ga0157373_106306982 137
103 3300013100 Ga0157373_10847068 Ga0157373_108470681 137
104 3300013102 Ga0157371_10102800 Ga0157371_101028002 137
105 3300013104 Ga0157370_10000292 Ga0157370_1000029215 137
106 3300013104 Ga0157370_10406962 Ga0157370_104069622 137
107 3300013104 Ga0157370_10507573 Ga0157370_105075732 137
108 3300013104 Ga0157370_10705057 Ga0157370_107050571 137
109 3300013104 Ga0157370_11087580 Ga0157370_110875801 137
110 3300013105 Ga0157369_10036289 Ga0157369_100362897 137
111 3300013105 Ga0157369_10040879 Ga0157369_100408797 137
112 3300013105 Ga0157369_10317743 Ga0157369_103177431 137
113 3300013105 Ga0157369_10347407 Ga0157369_103474072 137
114 3300013296 Ga0157374_10334018 Ga0157374_103340182 137
115 3300013296 Ga0157374_11156376 Ga0157374_111563762 137
116 3300013296 Ga0157374_12667023 Ga0157374_126670231 137
117 3300013297 Ga0157378_10066372 Ga0157378_100663723 137
118 3300013297 Ga0157378_10413825 Ga0157378_104138252 137
119 3300013297 Ga0157378_10685581 Ga0157378_106855812 137
120 3300013297 Ga0157378_11800080 Ga0157378_118000801 137
121 3300013306 Ga0163162_11997503 Ga0163162_119975032 137
122 3300013307 Ga0157372_10105968 Ga0157372_101059682 137
123 3300013307 Ga0157372_10300330 Ga0157372_103003302 137
124 3300013307 Ga0157372_10513011 Ga0157372_105130112 137
125 3300013308 Ga0157375_12077273 Ga0157375_120772731 137
126 3300013308 Ga0157375_13097167 Ga0157375_130971671 137
127 3300014325 Ga0163163_10045088 Ga0163163_100450882 137
128 3300014325 Ga0163163_10561600 Ga0163163_105616002 137
129 3300014325 Ga0163163_10972545 Ga0163163_109725452 137
130 3300014968 Ga0157379_11805568 Ga0157379_118055681 137
131 3300014969 Ga0157376_10571519 Ga0157376_105715191 137
132 3300014969 Ga0157376_11958720 Ga0157376_119587201 137
133 3300021388 Ga0213875_10046855 Ga0213875_100468552 137
134 3300025903 Ga0207680_10216559 Ga0207680_102165594 137
135 3300025905 Ga0207685_10701835 Ga0207685_107018352 137
136 3300025906 Ga0207699_10107911 Ga0207699_101079113 137
137 3300025907 Ga0207645_10047683 Ga0207645_100476832 137
138 3300025909 Ga0207705_10007769 Ga0207705_100077693 137
139 3300025909 Ga0207705_10089166 Ga0207705_100891662 137
140 3300025910 Ga0207684_10000182 Ga0207684_1000018219 137
141 3300025912 Ga0207707_10016762 Ga0207707_100167626 137
142 3300025912 Ga0207707_10098123 Ga0207707_100981232 137
143 3300025912 Ga0207707_10192335 Ga0207707_101923352 137
144 3300025913 Ga0207695_10106011 Ga0207695_101060112 137
145 3300025913 Ga0207695_10175653 Ga0207695_101756532 137
146 3300025913 Ga0207695_11340107 Ga0207695_113401071 137
147 3300025914 Ga0207671_10191186 Ga0207671_101911861 137
148 3300025915 Ga0207693_11332681 Ga0207693_113326812 137
149 3300025916 Ga0207663_10034019 Ga0207663_100340193 137
150 3300025917 Ga0207660_10074906 Ga0207660_100749062 137
151 3300025917 Ga0207660_10076266 Ga0207660_100762662 137
152 3300025917 Ga0207660_10586480 Ga0207660_105864801 137
153 3300025917 Ga0207660_10983944 Ga0207660_109839441 137
154 3300025919 Ga0207657_10184684 Ga0207657_101846842 137
155 3300025919 Ga0207657_10580444 Ga0207657_105804442 137
156 3300025921 Ga0207652_10151096 Ga0207652_101510962 137
157 3300025922 Ga0207646_10005272 Ga0207646_100052729 137
158 3300025922 Ga0207646_10300513 Ga0207646_103005132 137
159 3300025923 Ga0207681_10231929 Ga0207681_102319292 137
160 3300025924 Ga0207694_10116635 Ga0207694_101166355 137
161 3300025924 Ga0207694_10337987 Ga0207694_103379872 137
162 3300025927 Ga0207687_10063984 Ga0207687_100639842 137
163 3300025928 Ga0207700_10038009 Ga0207700_100380092 137
164 3300025929 Ga0207664_10063718 Ga0207664_100637182 137
165 3300025929 Ga0207664_10391490 Ga0207664_103914902 137
166 3300025929 Ga0207664_10559693 Ga0207664_105596932 137
167 3300025937 Ga0207669_10676537 Ga0207669_106765372 137
168 3300025937 Ga0207669_11216348 Ga0207669_112163481 137
169 3300025938 Ga0207704_10124294 Ga0207704_101242942 137
170 3300025944 Ga0207661_10148453 Ga0207661_101484532 137
171 3300025944 Ga0207661_11345814 Ga0207661_113458141 137
172 3300025949 Ga0207667_10018894 Ga0207667_100188943 137
173 3300025949 Ga0207667_10019913 Ga0207667_100199135 137
174 3300025949 Ga0207667_10788268 Ga0207667_107882682 137
175 3300026075 Ga0207708_10258502 Ga0207708_102585022 137
176 3300026078 Ga0207702_10084141 Ga0207702_100841412 137
177 3300026078 Ga0207702_10142093 Ga0207702_101420931 137
178 3300026088 Ga0207641_11576677 Ga0207641_115766771 137
179 3300026116 Ga0207674_10180992 Ga0207674_101809923 137
180 3300026121 Ga0207683_10421008 Ga0207683_104210081 137
181 3300026121 Ga0207683_10655605 Ga0207683_106556052 137
182 3300026121 Ga0207683_10753617 Ga0207683_107536172 137
183 3300026121 Ga0207683_11660064 Ga0207683_116600642 137
184 3300026142 Ga0207698_10006391 Ga0207698_100063912 137
185 3300027671 Ga0209588_1000026 Ga0209588_100002652 137
186 3300028381 Ga0268264_10621813 Ga0268264_106218132 137
187 3300028381 Ga0268264_10815294 Ga0268264_108152941 137
188 3300028563 Ga0265319_1000997 Ga0265319_10009979 137
189 3300028563 Ga0265319_1189024 Ga0265319_11890241 137
190 3300028573 Ga0265334_10002136 Ga0265334_100021367 137
191 3300028577 Ga0265318_10000203 Ga0265318_1000020319 137
192 3300028577 Ga0265318_10000946 Ga0265318_100009466 137
193 3300028653 Ga0265323_10021661 Ga0265323_100216612 137
194 3300028653 Ga0265323_10160936 Ga0265323_101609362 137
195 3300028654 Ga0265322_10043188 Ga0265322_100431882 137
196 3300028654 Ga0265322_10182489 Ga0265322_101824891 137
197 3300028666 Ga0265336_10046296 Ga0265336_100462961 137
198 3300028800 Ga0265338_10007036 Ga0265338_1000703610 137
199 3300028800 Ga0265338_10039079 Ga0265338_100390794 137
200 3300028800 Ga0265338_10059966 Ga0265338_100599662 137
201 3300028800 Ga0265338_10135050 Ga0265338_101350502 137
202 3300031090 Ga0265760_10142091 Ga0265760_101420912 137
203 3300031090 Ga0265760_10153509 Ga0265760_101535091 137
204 3300031235 Ga0265330_10000562 Ga0265330_1000056219 137
205 3300031235 Ga0265330_10302199 Ga0265330_103021991 137
206 3300031238 Ga0265332_10000369 Ga0265332_1000036919 137
207 3300031239 Ga0265328_10004863 Ga0265328_100048632 137
208 3300031239 Ga0265328_10320423 Ga0265328_103204231 137
209 3300031240 Ga0265320_10001291 Ga0265320_100012917 137
210 3300031240 Ga0265320_10184828 Ga0265320_101848282 137
211 3300031241 Ga0265325_10000136 Ga0265325_1000013640 137
212 3300031241 Ga0265325_10197461 Ga0265325_101974612 137
213 3300031242 Ga0265329_10001244 Ga0265329_100012447 137
214 3300031247 Ga0265340_10000201 Ga0265340_1000020111 137
215 3300031247 Ga0265340_10012025 Ga0265340_100120254 137
216 3300031249 Ga0265339_10006243 Ga0265339_100062433 137
217 3300031249 Ga0265339_10504607 Ga0265339_105046071 137
218 3300031250 Ga0265331_10092789 Ga0265331_100927892 137
219 3300031250 Ga0265331_10207436 Ga0265331_102074362 137
220 3300031250 Ga0265331_10234842 Ga0265331_102348421 137
221 3300031344 Ga0265316_10002005 Ga0265316_1000200512 137
222 3300031344 Ga0265316_10003440 Ga0265316_100034409 137
223 3300031344 Ga0265316_10005096 Ga0265316_1000509616 137
224 3300031344 Ga0265316_10031636 Ga0265316_100316366 137
225 3300031344 Ga0265316_10034298 Ga0265316_100342983 137
226 3300031344 Ga0265316_10109977 Ga0265316_101099774 137
227 3300031344 Ga0265316_10130614 Ga0265316_101306142 137
228 3300031344 Ga0265316_10288846 Ga0265316_102888462 137
229 3300031595 Ga0265313_10000095 Ga0265313_1000009563 137
230 3300031595 Ga0265313_10004235 Ga0265313_100042353 137
231 3300031595 Ga0265313_10151498 Ga0265313_101514982 137
232 3300031691 Ga0316579_10556742 Ga0316579_105567421 137
233 3300031711 Ga0265314_10001016 Ga0265314_100010169 137
234 3300031712 Ga0265342_10000560 Ga0265342_1000056019 137
235 3300031712 Ga0265342_10069748 Ga0265342_100697482 137
236 3300031728 Ga0316578_10016231 Ga0316578_100162312 137
237 3300031901 Ga0307406_10047949 Ga0307406_100479492 137
238 3300031903 Ga0307407_10456246 Ga0307407_104562462 137
239 3300031911 Ga0307412_10004940 Ga0307412_100049406 137
240 3300031995 Ga0307409_100602781 Ga0307409_1006027812 137
241 3300031995 Ga0307409_101518484 Ga0307409_1015184842 137
242 3300032133 Ga0316583_10019859 Ga0316583_100198591 137
243 3300035083 Ga0373926_0027646 Ga0373926_0027646_1392_1805 137
244 3300035111 Ga0373923_0145960 Ga0373923_0145960_442_855 137
245 3300035117 Ga0373953_0238122 Ga0373953_0238122_352_765 137
246 3300035118 Ga0373954_0030355 Ga0373954_0030355_2030_2443 137
247 3300035118 Ga0373954_0499969 Ga0373954_0499969_107_520 137
248 3300035119 Ga0373956_0325544 Ga0373956_0325544_69_482 137
249 3300035172 Ga0373955_0001140 Ga0373955_0001140_2716_3129 137
250 3300035410 Ga0373924_0083546 Ga0373924_0083546_497_910 137
251 3300035691 Ga0373931_0323064 Ga0373931_0323064_11_424 137
252 3300035692 Ga0373935_0120347 Ga0373935_0120347_771_1184 137
253 3300035692 Ga0373935_0204830 Ga0373935_0204830_670_1083 137
254 3300035695 Ga0373927_0010149 Ga0373927_0010149_4505_4918 137
255 3300035695 Ga0373927_0046612 Ga0373927_0046612_790_1203 137
256 3300035695 Ga0373927_0349195 Ga0373927_0349195_22_507 137
257 3300035695 Ga0373927_0815827 Ga0373927_0815827_171_584 137
258 3300035724 Ga0373933_0449574 Ga0373933_0449574_319_732 137
259 3300035724 Ga0373933_0489315 Ga0373933_0489315_59_472 137
260 3300035724 Ga0373933_0592938 Ga0373933_0592938_225_638 137
261 3300035725 Ga0373947_0174958 Ga0373947_0174958_59_472 137
262 3300036401 Ga0373937_0019595 Ga0373937_0019595_5494_5907 137
263 3300036401 Ga0373937_0035981 Ga0373937_0035981_1749_2162 137
264 3300036401 Ga0373937_0127313 Ga0373937_0127313_149_562 137
265 3300036401 Ga0373937_0404019 Ga0373937_0404019_260_673 137
266 3300036401 Ga0373937_1665242 Ga0373937_1665242_98_511 137
267 3300036647 Ga0316582_0021254 Ga0316582_0021254_1930_2343 137
268 3300036647 Ga0316582_0539396 Ga0316582_0539396_149_562 137
269 3300036712 Ga0316584_0111219 Ga0316584_0111219_1627_2040 137
270 3300036712 Ga0316584_0517677 Ga0316584_0517677_126_539 137
271 3300037068 Ga0373925_0002020 Ga0373925_0002020_9543_9956 137
272 3300037068 Ga0373925_0031533 Ga0373925_0031533_2306_2719 137
273 3300037068 Ga0373925_0243483 Ga0373925_0243483_935_1348 137
274 3300037068 Ga0373925_0986754 Ga0373925_0986754_52_465 137
275 3300037068 Ga0373925_1074555 Ga0373925_1074555_36_449 137
276 3300037471 Ga0395905_0116840 Ga0395905_0116840_1044_1460 137
277 3300037853 Ga0436364_0511469 Ga0436364_0511469_1170_1583 137
278 3300037853 Ga0436364_0620271 Ga0436364_0620271_1158_1571 137
279 3300037853 Ga0436364_0678502 Ga0436364_0678502_1316_1729 137
280 3300037853 Ga0436364_0881915 Ga0436364_0881915_666_1079 137
281 3300039437 Ga0436365_0845325 Ga0436365_0845325_18_431 137
282 3300039437 Ga0436365_1321707 Ga0436365_1321707_149_562 137
283 3300039447 Ga0436361_0827053 Ga0436361_0827053_63_476 137
284 3300039447 Ga0436361_1117670 Ga0436361_1117670_145_558 137
285 3300039450 Ga0436363_1214298 Ga0436363_1214298_100_513 137
286 3300041507 Ga0451851_0949180 Ga0451851_0949180_238_651 137
287 3300041512 Ga0451853_2679832 Ga0451853_2679832_204_617 137
288 3300042876 Ga0451577_0002478 Ga0451577_0002478_15251_15664 137
289 3300042876 Ga0451577_0073828 Ga0451577_0073828_587_1000 137
290 3300042876 Ga0451577_0172382 Ga0451577_0172382_525_938 137
291 3300042876 Ga0451577_0923505 Ga0451577_0923505_96_509 137
292 3300042876 Ga0451577_1429046 Ga0451577_1429046_109_522 137
293 3300044673 Ga0453683_0020215 Ga0453683_0020215_296_709 137
294 3300044673 Ga0453683_0157451 Ga0453683_0157451_804_1217 137
295 3300044684 Ga0466966_0212325 Ga0466966_0212325_350_763 137
296 3300044694 Ga0466963_0605331 Ga0466963_0605331_242_655 137
297 3300044712 Ga0453684_0000576 Ga0453684_0000576_18567_18980 137
298 3300044712 Ga0453684_0069845 Ga0453684_0069845_2079_2492 137
299 3300044712 Ga0453684_0858917 Ga0453684_0858917_498_911 137
300 3300044712 Ga0453684_2406073 Ga0453684_2406073_34_447 137
301 3300045049 Ga0466959_0104440 Ga0466959_0104440_192_605 137
302 3300045049 Ga0466959_0163869 Ga0466959_0163869_156_569 137
303 3300045051 Ga0451576_0000398 Ga0451576_0000398_1116_1529 137
304 3300045051 Ga0451576_0105494 Ga0451576_0105494_32_445 137
305 3300045051 Ga0451576_0230633 Ga0451576_0230633_171_599 137
306 3300045051 Ga0451576_1456996 Ga0451576_1456996_249_665 137
307 3300045836 Ga0466958_0989858 Ga0466958_0989858_25_438 137
308 3300045976 Ga0466967_0004589 Ga0466967_0004589_7518_7931 137
309 3300045976 Ga0466967_0063618 Ga0466967_0063618_573_986 137
310 3300045976 Ga0466967_1527496 Ga0466967_1527496_178_642 137
311 3300046462 Ga0495651_0057826 Ga0495651_0057826_1352_1765 137
312 3300046462 Ga0495651_0224693 Ga0495651_0224693_674_1087 137
313 3300046463 Ga0495653_0927264 Ga0495653_0927264_24_437 137
314 3300046472 Ga0495580_0003381 Ga0495580_0003381_12114_12527 137
315 3300046472 Ga0495580_0003528 Ga0495580_0003528_11838_12251 137
316 3300046472 Ga0495580_0004230 Ga0495580_0004230_2828_3241 137
317 3300046472 Ga0495580_0696844 Ga0495580_0696844_168_581 137
318 3300046472 Ga0495580_0791305 Ga0495580_0791305_52_465 137
319 3300046475 Ga0495639_0456638 Ga0495639_0456638_167_580 137
320 3300046475 Ga0495639_0503182 Ga0495639_0503182_126_539 137
321 3300046476 Ga0495662_0027587 Ga0495662_0027587_1247_1660 137
322 3300046499 Ga0495594_0065631 Ga0495594_0065631_69_482 137
323 3300046511 Ga0495608_0308779 Ga0495608_0308779_538_951 137
324 3300046516 Ga0495628_0069478 Ga0495628_0069478_1682_2095 137
325 3300046517 Ga0495630_0009826 Ga0495630_0009826_4350_4763 137
326 3300046517 Ga0495630_0588184 Ga0495630_0588184_160_573 137
327 3300046529 Ga0495652_0172799 Ga0495652_0172799_812_1225 137
328 3300046531 Ga0495665_0047302 Ga0495665_0047302_949_1362 137
329 3300046531 Ga0495665_0178317 Ga0495665_0178317_440_853 137
330 3300046533 Ga0495640_0050697 Ga0495640_0050697_1154_1567 137
331 3300046535 Ga0495586_0357941 Ga0495586_0357941_279_692 137
332 3300046536 Ga0495587_0037519 Ga0495587_0037519_1324_1737 137
333 3300046543 Ga0495645_0006266 Ga0495645_0006266_7295_7708 137
334 3300046543 Ga0495645_0056821 Ga0495645_0056821_1684_2097 137
335 3300046559 Ga0495667_0092634 Ga0495667_0092634_777_1190 137
336 3300046642 Ga0495634_0200386 Ga0495634_0200386_176_589 137
337 3300046663 Ga0495635_0009511 Ga0495635_0009511_5138_5551 137
338 3300046663 Ga0495635_0165272 Ga0495635_0165272_260_673 137
339 3300046678 Ga0495599_0058586 Ga0495599_0058586_1077_1490 137
340 3300046679 Ga0495623_0080375 Ga0495623_0080375_1564_1977 137
341 3300046679 Ga0495623_0105369 Ga0495623_0105369_43_456 137
342 3300046689 Ga0495613_0064487 Ga0495613_0064487_1430_1843 137
343 3300046689 Ga0495613_0427127 Ga0495613_0427127_426_839 137
344 3300046809 Ga0495600_0032361 Ga0495600_0032361_1959_2372 137
345 3300046809 Ga0495600_0308395 Ga0495600_0308395_434_847 137
346 3300047317 Ga0495604_0084977 Ga0495604_0084977_1431_1844 137
347 3300047317 Ga0495604_0139779 Ga0495604_0139779_340_753 137
348 3300047319 Ga0495674_0022192 Ga0495674_0022192_3522_3935 137
349 3300047319 Ga0495674_0110244 Ga0495674_0110244_1373_1786 137
350 3300047319 Ga0495674_0749383 Ga0495674_0749383_217_630 137
351 3300047319 Ga0495674_1442145 Ga0495674_1442145_73_486 137
352 3300047322 Ga0495680_0109767 Ga0495680_0109767_893_1306 137
353 3300047444 Ga0495675_0083603 Ga0495675_0083603_827_1240 137
354 3300047444 Ga0495675_0177334 Ga0495675_0177334_538_951 137
355 3300047471 Ga0495684_0008686 Ga0495684_0008686_5516_5929 137
356 3300047471 Ga0495684_0070305 Ga0495684_0070305_1779_2192 137
357 3300047471 Ga0495684_0363960 Ga0495684_0363960_450_863 137
358 3300048088 Ga0495602_0122822 Ga0495602_0122822_1183_1596 137
359 3300048906 Ga0496103_0010417 Ga0496103_0010417_144_557 137
360 3300048907 Ga0496104_1812451 Ga0496104_1812451_37_450 137
361 3300048918 Ga0496115_0347118 Ga0496115_0347118_659_1072 137
362 3300049568 Ga0501031_0000820 Ga0501031_0000820_6210_6623 137
363 3300049569 Ga0501032_0012728 Ga0501032_0012728_5207_5620 137
364 3300049570 Ga0501033_0045384 Ga0501033_0045384_359_772 137
365 3300049571 Ga0501034_0014266 Ga0501034_0014266_5988_6401 137
366 3300049572 Ga0501036_0000321 Ga0501036_0000321_28879_29292 137
367 3300049573 Ga0501037_0012059 Ga0501037_0012059_2673_3086 137
368 3300049574 Ga0501038_0000944 Ga0501038_0000944_6664_7077 137
369 3300049575 Ga0501039_0036874 Ga0501039_0036874_2716_3129 137
370 3300049576 Ga0501040_0331736 Ga0501040_0331736_115_528 137
371 3300049579 Ga0501043_0002091 Ga0501043_0002091_12371_12784 137
372 3300049580 Ga0501046_0000237 Ga0501046_0000237_35401_35814 137
373 3300049580 Ga0501046_0688452 Ga0501046_0688452_34_447 137
374 3300049581 Ga0501047_0018911 Ga0501047_0018911_4407_4820 137
375 3300049582 Ga0501048_0037201 Ga0501048_0037201_1403_1816 137
376 3300049583 Ga0501067_0008866 Ga0501067_0008866_784_1197 137
377 3300049584 Ga0501068_0000434 Ga0501068_0000434_1794_2207 137
378 3300049585 Ga0501069_0000529 Ga0501069_0000529_16090_16503 137
379 3300049586 Ga0501070_0065138 Ga0501070_0065138_1535_1948 137
380 3300049588 Ga0501072_0000682 Ga0501072_0000682_11728_12141 137
381 3300049588 Ga0501072_1089610 Ga0501072_1089610_150_563 137
382 3300049589 Ga0501073_0004338 Ga0501073_0004338_9667_10080 137
383 3300049589 Ga0501073_0113144 Ga0501073_0113144_320_733 137
384 3300049590 Ga0501074_0026358 Ga0501074_0026358_3618_4031 137
385 3300049592 Ga0501076_0109220 Ga0501076_0109220_1662_2075 137
386 3300049593 Ga0501077_0011585 Ga0501077_0011585_724_1137 137
387 3300049741 Ga0501079_0056245 Ga0501079_0056245_2244_2657 137
388 3300049742 Ga0501080_0179891 Ga0501080_0179891_622_1035 137
389 3300049744 Ga0501083_0245170 Ga0501083_0245170_570_983 137
390 3300049822 Ga0501035_0024577 Ga0501035_0024577_1071_1484 137
391 3300049823 Ga0501044_0036883 Ga0501044_0036883_2244_2657 137
392 3300049824 Ga0501045_0442825 Ga0501045_0442825_449_862 137
393 3300050512 nmdc:mga0n895_1322972_c1 nmdc:mga0n895_1322972_c1_162_575 137
394 3300050512 nmdc:mga0n895_237_c1 nmdc:mga0n895_237_c1_11416_11829 137
395 3300050513 nmdc:mga0rr50_23282_c1 nmdc:mga0rr50_23282_c1_2112_2525 137
396 3300050514 nmdc:mga08x19_2272_c1 nmdc:mga08x19_2272_c1_5242_5655 137
397 3300050514 nmdc:mga08x19_68357_c1 nmdc:mga08x19_68357_c1_114_527 137
398 3300050515 nmdc:mga0a205_1502_c1 nmdc:mga0a205_1502_c1_12134_12547 137
399 3300053077 Ga0495601_0410596 Ga0495601_0410596_66_479 137
400 3300053077 Ga0495601_0850670 Ga0495601_0850670_26_439 137
401 3300053085 Ga0495619_0311226 Ga0495619_0311226_220_633 137
402 3300053085 Ga0495619_1040012 Ga0495619_1040012_33_446 137
403 3300054114 Ga0501084_0001239 Ga0501084_0001239_11840_12253 137
404 3300054114 Ga0501084_0020535 Ga0501084_0020535_1092_1505 137
405 3300060353 Ga0501082_0012443 Ga0501082_0012443_5988_6401 137

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01894

UPF0047

Uncharacterised protein family UPF0047

20

133

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p6c-assembly1.cif.gz_A crystal structure of hypothetical protein aq_2013 from aquifex aeolicus vf5. 0.9918 1 137
1vmj-assembly1.cif.gz_A crystal structure of a putative thiamin phosphate synthase (tm0723) from thermotoga maritima msb8 at 1.52 a resolution 0.9861 1 137
1vmj-assembly1.cif.gz_A crystal structure of a putative thiamin phosphate synthase (tm0723) from thermotoga maritima msb8 at 1.52 a resolution 0.9791 1 137
1xbf-assembly1.cif.gz_C x-ray structure northeast structural genomics consortium target car10 from c. acetobutylicum 0.9563 4 135
1vph-assembly2.cif.gz_E crystal structure of a ybjq-like protein of unknown function (sso2532) from sulfolobus solfataricus p2 at 1.76 a resolution 0.9485 2 137
ID Description Score Start End Superfamily
2p6cB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9919 1 137 2.60.120.460
1vphC00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9456 2 137 2.60.120.460
1xbfB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9403 6 135 2.60.120.460
2p6hB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9398 4 137 2.60.120.460
1ve0A00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9374 2 137 2.60.120.460
ID Description Score Start End GO Terms
AF-X1HWN3-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 1 27 137
AF-A0A212QTK1-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9977 3 136
AF-A0A521BIH3-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.996 1 137
AF-A0A7V8WEF2-F1-model_v4 YjbQ family protein 0.9958 3 137
AF-A0A2V8CDQ4-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9949 7 125

Feature Viewer

pLDDT pTM Quality
95.91 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map