F435987

General Info

Members Datasets Scaffolds Average Seq Length
405 239 364 137

Family's Representative Sequence

Representative Sequence 3300033179|Ga0307507_10002432|Ga0307507_100024329
Length 160
Sequence MWDLAYRGLLRTLYNDGFKLYIMQLTIPSISNLPQAARSIIEHAGNNRIFLFYGDMGAGKTTLIKELCKALGTTDNITSPTFSIVNEYHTAKDKIYHFDFYRLKDQTEALDMGYEEYFYAGAWCFIEWPEKIPDLLPEHYSNITIKVLDDGTRQVSVENI

Samples

Sample ID Description Type Environment
1 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
2 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
5 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
6 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
7 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
8 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
9 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
10 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
11 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
12 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
13 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
14 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
15 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
16 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
17 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
18 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
19 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
20 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
21 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
22 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
23 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
24 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
25 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
26 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
27 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
28 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
29 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
30 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
31 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
32 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
33 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
34 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
35 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
36 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
37 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
38 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
39 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
40 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
41 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
42 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
43 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
44 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
45 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
46 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
47 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
48 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
49 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
50 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
51 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
52 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
53 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
69 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
70 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
71 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
94 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
97 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
100 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
101 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
102 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
103 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
132 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
133 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
136 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
137 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
138 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
139 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
140 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
141 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
142 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
143 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
144 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
145 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
156 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
157 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
158 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
159 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
165 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
166 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
167 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
168 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
169 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
170 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
171 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
174 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
175 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
176 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
177 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
178 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
179 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
180 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
181 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
182 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
183 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
184 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
185 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
186 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
187 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
188 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
189 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
190 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
191 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
192 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
193 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
194 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
197 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
200 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
201 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
202 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
203 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
204 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
205 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
206 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
207 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
208 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
209 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
210 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
211 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
212 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
213 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
214 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
215 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
216 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
217 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
218 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
219 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
220 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
221 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
222 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
223 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
224 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
225 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
226 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
227 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
228 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
229 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
230 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
231 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
232 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
233 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
234 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
235 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
236 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
237 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere
238 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
239 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.63
Metatranscriptomes 0.25
Isolates 10.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.9
Nodule 1.98
Rhizoplane 0.99
Rhizosphere 76.79
Stem 0
Stem Tuber 0
Unclassified 12.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000008 3300002737 Bacteria 397212
2 JGI25162J39368_1000097 3300002737 Bacteria 96520
3 JGI25162J39368_1001750 3300002737 Bacteria 10388
4 JGI25157J39369_1003537 3300002741 Bacteria 3147
5 JGI25164J39214_1001588 3300002772 Bacteria 4830
6 JGI25165J46597_1001806 3300003214 Bacteria 9076
7 rootH1_10066801 3300003316 Bacteria 4330
8 rootH2_10051724 3300003320 Bacteria 2188
9 rootH2_10129592 3300003320 Bacteria 2066
10 rootH1_10009825 3300003323 Bacteria 13487
11 rootH1_10137211 3300003323 Bacteria 6106
12 rootH1_10319162 3300003323 Bacteria 3312
13 Ga0006562J51391_1016914 3300003578 Bacteria 3395
14 Ga0065714_10006399 3300005288 Bacteria 3489
15 Ga0065714_10006458 3300005288 Bacteria 3496
16 Ga0065714_10304051 3300005288 Unclassified 690
17 Ga0065715_10374557 3300005293 Bacteria 883
18 Ga0065715_10863652 3300005293 Bacteria 533
19 Ga0070658_10000675 3300005327 Bacteria 29517
20 Ga0070658_10046496 3300005327 Bacteria 3512
21 Ga0068869_100322915 3300005334 Bacteria 1252
22 Ga0068868_100194034 3300005338 Bacteria 1690
23 Ga0070660_100055224 3300005339 Bacteria 3069
24 Ga0070660_100074243 3300005339 Bacteria 2661
25 Ga0070671_100031981 3300005355 Bacteria 4350
26 Ga0070674_100124537 3300005356 Bacteria 1912
27 Ga0070673_100078444 3300005364 Bacteria 2672
28 Ga0070678_100006070 3300005456 Bacteria 7048
29 Ga0070662_100002625 3300005457 Bacteria 11085
30 Ga0068867_100001804 3300005459 Bacteria 14902
31 Ga0070679_100927721 3300005530 Bacteria 814
32 Ga0068853_100196358 3300005539 Bacteria 1835
33 Ga0070665_100000017 3300005548 Bacteria 448013
34 Ga0070665_100624734 3300005548 Bacteria 1090
35 Ga0068855_100000021 3300005563 Bacteria 195708
36 Ga0068855_100001368 3300005563 Bacteria 30198
37 Ga0068855_100074101 3300005563 Bacteria 3954
38 Ga0068855_100220633 3300005563 Bacteria 2126
39 Ga0068855_100297046 3300005563 Bacteria 1789
40 Ga0068854_100263277 3300005578 Bacteria 1381
41 Ga0068852_100086651 3300005616 Bacteria 2792
42 Ga0068866_10106676 3300005718 Bacteria 1555
43 Ga0068866_10107297 3300005718 Bacteria 1551
44 Ga0068858_100552477 3300005842 Bacteria 1115
45 Ga0075366_10002552 3300006195 Bacteria 9361
46 Ga0068871_100003252 3300006358 Bacteria 11143
47 Ga0068871_101703170 3300006358 Unclassified 598
48 Ga0068865_100000070 3300006881 Bacteria 53670
49 Ga0099824_1005112 3300006942 Bacteria 18608
50 Ga0079104_1000005 3300006946 Bacteria 407099
51 Ga0079104_1066479 3300006946 Bacteria 765
52 Ga0099826_10037121 3300006948 Bacteria 3436
53 Ga0105244_10000004 3300009036 Bacteria 492478
54 Ga0105240_10002855 3300009093 Bacteria 27308
55 Ga0105240_10008396 3300009093 Bacteria 14776
56 Ga0105240_10042273 3300009093 Bacteria 5808
57 Ga0105240_10180434 3300009093 Bacteria 2492
58 Ga0105240_10369851 3300009093 Bacteria 1621
59 Ga0105240_10482774 3300009093 Bacteria 1381
60 Ga0105240_10888352 3300009093 Bacteria 959
61 Ga0105240_11234390 3300009093 Bacteria 790
62 Ga0105240_11836550 3300009093 Bacteria 631
63 Ga0111539_10464031 3300009094 Bacteria 1475
64 Ga0105241_10024488 3300009174 Bacteria 4482
65 Ga0105241_10066559 3300009174 Bacteria 2786
66 Ga0105241_10174680 3300009174 Bacteria 1777
67 Ga0105241_10747921 3300009174 Bacteria 896
68 Ga0105237_10001977 3300009545 Bacteria 26075
69 Ga0105237_10008458 3300009545 Bacteria 11136
70 Ga0105237_10058718 3300009545 Bacteria 3850
71 Ga0105237_10074118 3300009545 Bacteria 3395
72 Ga0105237_10205321 3300009545 Bacteria 1971
73 Ga0105237_10285138 3300009545 Bacteria 1654
74 Ga0105237_11189644 3300009545 Bacteria 769
75 Ga0105237_11195521 3300009545 Bacteria 767
76 Ga0105238_10064791 3300009551 Bacteria 3654
77 Ga0105249_10523851 3300009553 Bacteria 1233
78 Ga0105239_10006488 3300010375 Bacteria 13566
79 Ga0105239_10008634 3300010375 Bacteria 11549
80 Ga0105239_10046548 3300010375 Bacteria 4753
81 Ga0105239_10067803 3300010375 Bacteria 3920
82 Ga0105239_10389981 3300010375 Bacteria 1575
83 Ga0105239_11022545 3300010375 Bacteria 950
84 Ga0105246_10047403 3300011119 Bacteria 2934
85 Ga0105246_10118452 3300011119 Bacteria 1958
86 Ga0157373_10000002 3300013100 Bacteria 750094
87 Ga0157373_10000906 3300013100 Bacteria 22984
88 Ga0157373_10016236 3300013100 Bacteria 5433
89 Ga0157371_10001157 3300013102 Bacteria 28382
90 Ga0157371_10033359 3300013102 Bacteria 3699
91 Ga0157371_10228872 3300013102 Bacteria 1336
92 Ga0157370_10000061 3300013104 Bacteria 115933
93 Ga0157370_10032262 3300013104 Bacteria 5115
94 Ga0157370_10033744 3300013104 Bacteria 4988
95 Ga0157370_10037604 3300013104 Bacteria 4691
96 Ga0157370_10165325 3300013104 Bacteria 2058
97 Ga0157370_11012249 3300013104 Bacteria 752
98 Ga0157369_10000345 3300013105 Bacteria 61586
99 Ga0157369_10578184 3300013105 Bacteria 1160
100 Ga0157374_10002863 3300013296 Bacteria 14485
101 Ga0157374_10003120 3300013296 Bacteria 13919
102 Ga0157374_10008123 3300013296 Bacteria 8969
103 Ga0157374_10245678 3300013296 Bacteria 1761
104 Ga0157374_10607397 3300013296 Bacteria 1104
105 Ga0157374_12510162 3300013296 Bacteria 543
106 Ga0157378_10009763 3300013297 Bacteria 8366
107 Ga0157378_10014208 3300013297 Bacteria 6968
108 Ga0157378_12271010 3300013297 Bacteria 594
109 Ga0163162_10000026 3300013306 Bacteria 178701
110 Ga0163162_10008696 3300013306 Bacteria 9881
111 Ga0163162_11423914 3300013306 Bacteria 789
112 Ga0157372_10001857 3300013307 Bacteria 22903
113 Ga0157372_10002641 3300013307 Bacteria 19411
114 Ga0157372_10056349 3300013307 Bacteria 4391
115 Ga0157372_10240882 3300013307 Bacteria 2099
116 Ga0157375_10034707 3300013308 Bacteria 4808
117 Ga0157375_10044158 3300013308 Bacteria 4327
118 Ga0157375_10064534 3300013308 Bacteria 3646
119 Ga0182008_10802789 3300014497 Bacteria 546
120 Ga0157377_10321061 3300014745 Bacteria 1029
121 Ga0157377_10643888 3300014745 Bacteria 762
122 Ga0157379_12123963 3300014968 Bacteria 557
123 Ga0157376_10306754 3300014969 Bacteria 1504
124 Ga0157376_11439268 3300014969 Bacteria 721
125 Ga0182006_1011077 3300015261 Bacteria 3982
126 Ga0182006_1040406 3300015261 Bacteria 1836
127 Ga0182006_1095267 3300015261 Bacteria 1064
128 Ga0182007_10097771 3300015262 Bacteria 970
129 Ga0163161_10000012 3300017792 Bacteria 264639
130 Ga0163161_10046491 3300017792 Bacteria 3132
131 Ga0213872_10046148 3300021361 Bacteria 1983
132 Ga0209563_104415 3300025230 Bacteria 2693
133 Ga0207427_100083 3300025231 Bacteria 142745
134 Ga0209437_100021 3300025233 Bacteria 646400
135 Ga0209437_100030 3300025233 Bacteria 532466
136 Ga0209026_1000309 3300025250 Bacteria 53002
137 Ga0209026_1006044 3300025250 Bacteria 3077
138 Ga0209026_1019374 3300025250 Unclassified 1067
139 Ga0209129_1013484 3300025258 Bacteria 1798
140 Ga0209233_1000035 3300025261 Bacteria 568478
141 Ga0209455_1000911 3300025272 Bacteria 15402
142 Ga0207655_1000008 3300025728 Bacteria 734289
143 Ga0207642_10044150 3300025899 Bacteria 1971
144 Ga0207642_10077320 3300025899 Bacteria 1605
145 Ga0207647_10019818 3300025904 Bacteria 4517
146 Ga0207645_10002024 3300025907 Bacteria 16278
147 Ga0207705_10000035 3300025909 Bacteria 201649
148 Ga0207705_10196626 3300025909 Bacteria 1527
149 Ga0207654_10006104 3300025911 Bacteria 6056
150 Ga0207654_10121145 3300025911 Bacteria 1643
151 Ga0207654_10276768 3300025911 Bacteria 1134
152 Ga0207654_10410145 3300025911 Bacteria 944
153 Ga0207695_10002500 3300025913 Bacteria 27026
154 Ga0207695_10006085 3300025913 Bacteria 15745
155 Ga0207695_10061938 3300025913 Bacteria 3865
156 Ga0207695_10280019 3300025913 Bacteria 1562
157 Ga0207671_10004973 3300025914 Bacteria 12455
158 Ga0207671_10012109 3300025914 Bacteria 6965
159 Ga0207671_10035390 3300025914 Bacteria 3706
160 Ga0207671_10106473 3300025914 Bacteria 2129
161 Ga0207671_10247372 3300025914 Bacteria 1401
162 Ga0207671_10645925 3300025914 Bacteria 843
163 Ga0207657_10066004 3300025919 Bacteria 3082
164 Ga0207657_10098610 3300025919 Bacteria 2428
165 Ga0207657_10615632 3300025919 Bacteria 847
166 Ga0207652_10787157 3300025921 Bacteria 845
167 Ga0207694_10037432 3300025924 Bacteria 3727
168 Ga0207644_10032556 3300025931 Bacteria 3638
169 Ga0207690_10564898 3300025932 Bacteria 926
170 Ga0207706_10007385 3300025933 Bacteria 10160
171 Ga0207706_10120235 3300025933 Bacteria 2309
172 Ga0207669_10179689 3300025937 Bacteria 1515
173 Ga0207704_10008834 3300025938 Bacteria 4837
174 Ga0207689_10988841 3300025942 Bacteria 710
175 Ga0207661_10634830 3300025944 Unclassified 981
176 Ga0207667_10000014 3300025949 Bacteria 421261
177 Ga0207667_10004397 3300025949 Bacteria 17264
178 Ga0207667_10061379 3300025949 Bacteria 3932
179 Ga0207667_10116905 3300025949 Bacteria 2748
180 Ga0207667_10646475 3300025949 Bacteria 1063
181 Ga0207667_10677546 3300025949 Bacteria 1035
182 Ga0207651_10193964 3300025960 Bacteria 1622
183 Ga0207640_10191509 3300025981 Bacteria 1542
184 Ga0207677_10019700 3300026023 Bacteria 4080
185 Ga0207639_10011413 3300026041 Bacteria 6171
186 Ga0207639_10175504 3300026041 Bacteria 1819
187 Ga0207639_10390119 3300026041 Bacteria 1252
188 Ga0207702_10018346 3300026078 Bacteria 5788
189 Ga0207702_10143033 3300026078 Bacteria 2167
190 Ga0207648_10004191 3300026089 Bacteria 14900
191 Ga0207683_10008462 3300026121 Bacteria 8806
192 Ga0207698_10467715 3300026142 Bacteria 1220
193 Ga0207698_11205952 3300026142 Bacteria 771
194 Ga0209281_1000094 3300027111 Bacteria 238155
195 Ga0209281_1042301 3300027111 Bacteria 760
196 Ga0209489_111537 3300027361 Bacteria 8906
197 Ga0209282_1110587 3300027666 Bacteria 1395
198 Ga0268266_10000037 3300028379 Bacteria 342368
199 Ga0268266_10622869 3300028379 Bacteria 1037
200 Ga0265323_10000861 3300028653 Bacteria 16133
201 Ga0307517_10001130 3300028786 Bacteria 45094
202 Ga0307515_10000077 3300028794 Bacteria 228162
203 Ga0307515_10001268 3300028794 Bacteria 57400
204 Ga0316177_1191401 3300030731 Bacteria 3187
205 Ga0316176_1132212 3300030732 Bacteria 4964
206 Ga0316183_1121655 3300030742 Bacteria 30139
207 Ga0316181_1251786 3300030744 Bacteria 2564
208 Ga0316181_1251850 3300030744 Bacteria 897
209 Ga0265327_10203236 3300031251 Bacteria 896
210 Ga0265316_10000445 3300031344 Bacteria 47073
211 Ga0307513_10661981 3300031456 Bacteria 751
212 Ga0307509_10036898 3300031507 Bacteria 5347
213 Ga0307509_10580194 3300031507 Bacteria 796
214 Ga0307408_100004934 3300031548 Bacteria 8978
215 Ga0307413_10000721 3300031824 Bacteria 11357
216 Ga0307413_10158670 3300031824 Bacteria 1586
217 Ga0307410_10000794 3300031852 Bacteria 13343
218 Ga0307406_10000035 3300031901 Bacteria 82953
219 Ga0307407_10001839 3300031903 Bacteria 7976
220 Ga0307412_10085146 3300031911 Bacteria 2196
221 Ga0307412_10952705 3300031911 Bacteria 755
222 Ga0307416_100011766 3300032002 Bacteria 5859
223 Ga0307414_10003842 3300032004 Bacteria 8080
224 Ga0307414_10007351 3300032004 Bacteria 6190
225 Ga0307414_10010475 3300032004 Bacteria 5383
226 Ga0307414_10039458 3300032004 Bacteria 3180
227 Ga0307414_10094201 3300032004 Bacteria 2234
228 Ga0307414_10355868 3300032004 Bacteria 1258
229 Ga0307414_10899442 3300032004 Bacteria 811
230 Ga0307414_10929347 3300032004 Bacteria 798
231 Ga0307411_10000001 3300032005 Bacteria 931810
232 Ga0307411_10471737 3300032005 Bacteria 1055
233 Ga0307507_10002432 3300033179 Bacteria 39062
234 Ga0307510_10003117 3300033180 Bacteria 19187
235 Ga0307510_10008468 3300033180 Bacteria 12258
236 Ga0316574_0112984 3300035398 Bacteria 1741
237 Ga0316582_0221195 3300036647 Bacteria 1295
238 Ga0395899_0000793 3300037312 Bacteria 30923
239 Ga0395899_0432419 3300037312 Bacteria 865
240 Ga0395900_0001235 3300037418 Bacteria 31424
241 Ga0395900_0015395 3300037418 Bacteria 7795
242 Ga0395900_0832611 3300037418 Bacteria 849
243 Ga0395898_0002540 3300037466 Bacteria 21394
244 Ga0395898_0082490 3300037466 Bacteria 3099
245 Ga0395905_0000001 3300037471 Bacteria 2037079
246 Ga0395905_0001253 3300037471 Bacteria 31445
247 Ga0395905_0003224 3300037471 Bacteria 17546
248 Ga0395901_0000941 3300038443 Bacteria 31690
249 Ga0395901_0003465 3300038443 Bacteria 15886
250 Ga0436361_0693619 3300039447 Bacteria 8355
251 Ga0439447_021983 3300041407 Bacteria 1675
252 Ga0439466_0000900 3300041411 Bacteria 11313
253 Ga0451793_1641723 3300041452 Bacteria 593
254 Ga0451795_0104742 3300041456 Bacteria 1112
255 Ga0451795_1526939 3300041456 Bacteria 1042
256 Ga0451841_0590126 3300041498 Bacteria 557
257 Ga0451855_0585470 3300041511 Unclassified 848
258 Ga0451855_1682377 3300041511 Bacteria 671
259 Ga0439434_0192226 3300042435 Bacteria 686
260 Ga0466959_0129264 3300045049 Bacteria 1791
261 Ga0495590_0249564 3300046457 Bacteria 660
262 Ga0495629_0045785 3300046459 Bacteria 3069
263 Ga0495651_0513977 3300046462 Bacteria 765
264 Ga0495650_0000268 3300046471 Bacteria 99891
265 Ga0495650_0022329 3300046471 Bacteria 3038
266 Ga0495650_0084385 3300046471 Bacteria 1219
267 Ga0495605_0070906 3300046474 Bacteria 1647
268 Ga0495585_0000034 3300046492 Bacteria 143120
269 Ga0495585_0000092 3300046492 Bacteria 94819
270 Ga0495585_0065385 3300046492 Bacteria 1993
271 Ga0495583_0336281 3300046506 Bacteria 597
272 Ga0495606_0000009 3300046507 Bacteria 306313
273 Ga0495606_0017622 3300046507 Bacteria 5391
274 Ga0495606_0018340 3300046507 Bacteria 5252
275 Ga0495606_0018377 3300046507 Bacteria 5244
276 Ga0495606_0049051 3300046507 Bacteria 2772
277 Ga0495606_0164891 3300046507 Bacteria 1290
278 Ga0495606_0168909 3300046507 Bacteria 1270
279 Ga0495606_0405832 3300046507 Bacteria 708
280 Ga0495610_0003590 3300046512 Bacteria 11989
281 Ga0495610_0055033 3300046512 Bacteria 1920
282 Ga0495610_0168595 3300046512 Bacteria 920
283 Ga0495616_0000907 3300046513 Bacteria 21368
284 Ga0495618_0933301 3300046514 Bacteria 500
285 Ga0495631_0002726 3300046518 Bacteria 9795
286 Ga0495631_0079037 3300046518 Bacteria 1420
287 Ga0495631_0223107 3300046518 Bacteria 804
288 Ga0495632_0048095 3300046519 Bacteria 2113
289 Ga0495644_0006660 3300046523 Bacteria 4474
290 Ga0495648_0026374 3300046524 Bacteria 3913
291 Ga0495663_0029348 3300046525 Bacteria 1624
292 Ga0495652_0033146 3300046529 Bacteria 4513
293 Ga0495652_0316638 3300046529 Bacteria 1129
294 Ga0495654_0034393 3300046530 Bacteria 2557
295 Ga0495609_0003700 3300046538 Bacteria 8645
296 Ga0495622_0303254 3300046557 Bacteria 696
297 Ga0495633_0000004 3300046558 Bacteria 370781
298 Ga0495633_0002693 3300046558 Bacteria 12330
299 Ga0495668_0000058 3300046616 Bacteria 195501
300 Ga0495668_0014321 3300046616 Bacteria 4654
301 Ga0495668_0062609 3300046616 Bacteria 2050
302 Ga0495668_0312969 3300046616 Bacteria 861
303 Ga0495625_0000007 3300046660 Bacteria 565749
304 Ga0495625_0001150 3300046660 Bacteria 34053
305 Ga0495625_0003596 3300046660 Bacteria 15243
306 Ga0495625_0003990 3300046660 Bacteria 14143
307 Ga0495625_0025592 3300046660 Bacteria 4474
308 Ga0495625_0062263 3300046660 Bacteria 2638
309 Ga0495625_0101229 3300046660 Bacteria 1979
310 Ga0495625_0104406 3300046660 Bacteria 1943
311 Ga0495625_0200383 3300046660 Bacteria 1318
312 Ga0495625_0219855 3300046660 Bacteria 1245
313 Ga0495625_0808808 3300046660 Unclassified 544
314 Ga0495661_0014872 3300046665 Bacteria 5204
315 Ga0495661_0095328 3300046665 Bacteria 1685
316 Ga0495661_0173750 3300046665 Bacteria 1147
317 Ga0495588_0336877 3300046674 Bacteria 793
318 Ga0495658_0007035 3300046683 Bacteria 5551
319 Ga0495669_0388293 3300046684 Bacteria 676
320 Ga0495649_0000007 3300046694 Bacteria 518037
321 Ga0495683_0039499 3300047323 Bacteria 2385
322 Ga0495687_001260 3300047443 Bacteria 23990
323 Ga0495687_001497 3300047443 Bacteria 21340
324 Ga0495677_0022571 3300047445 Bacteria 2283
325 Ga0495677_0117690 3300047445 Bacteria 1012
326 Ga0495673_0013418 3300047469 Bacteria 4304
327 Ga0495686_0000965 3300047472 Bacteria 35434
328 Ga0495686_0111552 3300047472 Bacteria 1639
329 Ga0495686_0374474 3300047472 Bacteria 769
330 Ga0495602_0832509 3300048088 Bacteria 618
331 Ga0495614_0009240 3300048089 Bacteria 4365
332 Ga0496116_0000032 3300048919 Bacteria 419997
333 Ga0496121_0087421 3300048924 Bacteria 2447
334 Ga0496124_0025658 3300048927 Bacteria 5332
335 Ga0496124_0081715 3300048927 Bacteria 2655
336 Ga0496124_0085437 3300048927 Bacteria 2586
337 Ga0496125_0000059 3300048928 Bacteria 264149
338 Ga0496126_0034667 3300048929 Bacteria 4738
339 Ga0495678_008815 3300049459 Bacteria 5047
340 Ga0501238_000033 3300049671 Bacteria 24733
341 Ga0501249_000033 3300049679 Bacteria 73096
342 Ga0501249_015455 3300049679 Bacteria 1632
343 Ga0501249_019339 3300049679 Bacteria 1478
344 Ga0501266_000011 3300049763 Bacteria 197280
345 Ga0501280_000268 3300049776 Bacteria 13184
346 nmdc:mga0k408_1836_c1 3300050493 Bacteria 11401
347 nmdc:mga07m45_396675_c1 3300050496 Bacteria 801
348 Ga0500578_0190116 3300053086 Bacteria 1261
349 Ga0500644_0089100 3300053088 Bacteria 1151
350 Ga0500646_0000865 3300053090 Bacteria 8354
351 Ga0500641_0000017 3300053096 Bacteria 132678
352 Ga0500641_0000197 3300053096 Bacteria 22609
353 Ga0500594_0019976 3300053118 Bacteria 1666
354 Ga0500608_080987 3300053122 Bacteria 1532
355 Ga0500614_045512 3300053123 Bacteria 1133
356 Ga0500618_000006 3300053125 Bacteria 239188
357 Ga0500618_026620 3300053125 Bacteria 1380
358 Ga0500658_0000003 3300053134 Bacteria 512506
359 Ga0500559_0008593 3300053136 Bacteria 4468
360 Ga0500561_0043542 3300053137 Bacteria 1196
361 Ga0500568_0095945 3300053139 Bacteria 1115
362 Ga0500622_0000173 3300053156 Bacteria 69414
363 Ga0500624_000187 3300053157 Bacteria 24423
364 Ga0500587_019872 3300053739 Bacteria 873

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2513020052 2513235916 129
2 iso_pu_bacteria 2519899754 2520879379 129
3 iso_pu_bacteria 2643221600 2644013092 129
4 iso_pu_bacteria 2643221667 2644372409 129
5 iso_pu_bacteria 2643221716 2644642578 129
6 iso_pu_bacteria 2643221725 2644684881 129
7 iso_pu_bacteria 2738541279 2738732429 129
8 iso_pu_bacteria 2738541285 2738764994 129
9 iso_pu_bacteria 2738543007 2739214009 129
10 iso_pu_bacteria 2739367857 2740001292 129
11 iso_pu_bacteria 2739367858 2740006108 129
12 iso_pu_bacteria 2802428842 2802653803 129
13 iso_pu_bacteria 2816332280 2817416245 129
14 iso_pu_bacteria 2857613821 2857614923 129
15 iso_pu_bacteria 2857618242 2857618629 129
16 iso_pu_bacteria 2881359912 2881363082 129
17 iso_pu_bacteria 2903895155 2903896921 129
18 iso_pu_bacteria 2904419702 2904422763 129
19 iso_pu_bacteria 2904555929 2904557040 129
20 iso_pu_bacteria 2919191525 2919195340 129
21 iso_pu_bacteria 2919683626 2919687696 129
22 iso_pu_bacteria 2929150217 2929153532 129
23 iso_pu_bacteria 2958458903 2958461085 129
24 iso_pu_bacteria 2977268062 2977270199 129
25 iso_pu_bacteria 8054307821 8054310111 129
26 iso_pu_bacteria 8055419101 8055421904 129
27 iso_pu_bacteria 8055592153 8055593459 129
28 iso_pu_bacteria 8056440228 8056442930 129
29 3300047443 Ga0495687_001497 Ga0495687_001497_18126_18521 131
30 iso_pu_bacteria 3003233435 3003236481 132
31 3300003578 Ga0006562J51391_1016914 Ga0006562J51391_10169141 133
32 3300005288 Ga0065714_10006399 Ga0065714_100063993 133
33 3300005288 Ga0065714_10006458 Ga0065714_100064582 133
34 3300005293 Ga0065715_10374557 Ga0065715_103745572 133
35 3300005293 Ga0065715_10863652 Ga0065715_108636521 133
36 3300006942 Ga0099824_1005112 Ga0099824_10051128 133
37 3300006946 Ga0079104_1000005 Ga0079104_100000539 133
38 3300006946 Ga0079104_1066479 Ga0079104_10664791 133
39 3300006948 Ga0099826_10037121 Ga0099826_100371212 133
40 3300009036 Ga0105244_10000004 Ga0105244_1000000410 133
41 3300013100 Ga0157373_10000002 Ga0157373_10000002499 133
42 3300013102 Ga0157371_10001157 Ga0157371_1000115711 133
43 3300013104 Ga0157370_10000061 Ga0157370_1000006193 133
44 3300013104 Ga0157370_10032262 Ga0157370_100322622 133
45 3300013104 Ga0157370_10033744 Ga0157370_100337442 133
46 3300013104 Ga0157370_10037604 Ga0157370_100376043 133
47 3300013105 Ga0157369_10000345 Ga0157369_1000034524 133
48 3300013308 Ga0157375_10064534 Ga0157375_100645342 133
49 3300014497 Ga0182008_10802789 Ga0182008_108027891 133
50 3300015261 Ga0182006_1011077 Ga0182006_10110772 133
51 3300015261 Ga0182006_1040406 Ga0182006_10404062 133
52 3300015261 Ga0182006_1095267 Ga0182006_10952672 133
53 3300017792 Ga0163161_10000012 Ga0163161_1000001280 133
54 3300025728 Ga0207655_1000008 Ga0207655_1000008578 133
55 3300027111 Ga0209281_1000094 Ga0209281_100009439 133
56 3300027111 Ga0209281_1042301 Ga0209281_10423012 133
57 3300027361 Ga0209489_111537 Ga0209489_1115373 133
58 3300027666 Ga0209282_1110587 Ga0209282_11105871 133
59 3300031824 Ga0307413_10000721 Ga0307413_100007212 133
60 3300031824 Ga0307413_10158670 Ga0307413_101586702 133
61 3300031852 Ga0307410_10000794 Ga0307410_100007948 133
62 3300031911 Ga0307412_10952705 Ga0307412_109527052 133
63 3300032002 Ga0307416_100011766 Ga0307416_1000117666 133
64 3300032004 Ga0307414_10003842 Ga0307414_100038421 133
65 3300032004 Ga0307414_10094201 Ga0307414_100942011 133
66 3300032004 Ga0307414_10899442 Ga0307414_108994421 133
67 3300032004 Ga0307414_10929347 Ga0307414_109293472 133
68 3300032005 Ga0307411_10000001 Ga0307411_10000001480 133
69 3300032005 Ga0307411_10471737 Ga0307411_104717372 133
70 3300033180 Ga0307510_10008468 Ga0307510_100084683 133
71 3300041407 Ga0439447_021983 Ga0439447_021983_181_588 133
72 3300041411 Ga0439466_0000900 Ga0439466_0000900_585_992 133
73 3300041456 Ga0451795_0104742 Ga0451795_0104742_244_663 133
74 3300041498 Ga0451841_0590126 Ga0451841_0590126_140_547 133
75 3300042435 Ga0439434_0192226 Ga0439434_0192226_256_663 133
76 3300046512 Ga0495610_0168595 Ga0495610_0168595_494_901 133
77 3300046660 Ga0495625_0200383 Ga0495625_0200383_146_553 133
78 3300046660 Ga0495625_0219855 Ga0495625_0219855_561_968 133
79 3300048919 Ga0496116_0000032 Ga0496116_0000032_182202_182609 133
80 3300048924 Ga0496121_0087421 Ga0496121_0087421_1220_1627 133
81 3300048927 Ga0496124_0025658 Ga0496124_0025658_4558_4965 133
82 3300048927 Ga0496124_0081715 Ga0496124_0081715_1600_2007 133
83 3300048927 Ga0496124_0085437 Ga0496124_0085437_842_1249 133
84 3300048928 Ga0496125_0000059 Ga0496125_0000059_180868_181275 133
85 3300048929 Ga0496126_0034667 Ga0496126_0034667_1901_2308 133
86 3300049671 Ga0501238_000033 Ga0501238_000033_19711_20118 133
87 3300049679 Ga0501249_000033 Ga0501249_000033_11805_12212 133
88 3300049679 Ga0501249_015455 Ga0501249_015455_973_1380 133
89 3300049679 Ga0501249_019339 Ga0501249_019339_237_644 133
90 3300049763 Ga0501266_000011 Ga0501266_000011_149458_149865 133
91 3300049776 Ga0501280_000268 Ga0501280_000268_10861_11268 133
92 3300053088 Ga0500644_0089100 Ga0500644_0089100_316_723 133
93 3300053090 Ga0500646_0000865 Ga0500646_0000865_3375_3782 133
94 3300053096 Ga0500641_0000017 Ga0500641_0000017_78176_78583 133
95 3300053096 Ga0500641_0000197 Ga0500641_0000197_18311_18718 133
96 3300053118 Ga0500594_0019976 Ga0500594_0019976_392_799 133
97 3300053134 Ga0500658_0000003 Ga0500658_0000003_129144_129578 133
98 3300053136 Ga0500559_0008593 Ga0500559_0008593_3328_3735 133
99 3300053739 Ga0500587_019872 Ga0500587_019872_100_507 133
100 3300037471 Ga0395905_0000001 Ga0395905_0000001_182334_182744 134
101 iso_pu_bacteria 2599185184 2599480752 134
102 iso_pu_bacteria 2842903701 2842904853 134
103 iso_pu_bacteria 2852623160 2852626391 134
104 iso_pu_bacteria 2884933994 2884934843 134
105 iso_pu_bacteria 2890737413 2890740307 134
106 iso_pu_bacteria 2896344016 2896347110 134
107 iso_pu_bacteria 2898713307 2898716021 134
108 iso_pu_bacteria 2919437846 2919439941 134
109 iso_pu_bacteria 2928078545 2928081645 134
110 iso_pu_bacteria 2932082852 2932085150 134
111 iso_pu_bacteria 8055588893 8055590130 134
112 3300003320 rootH2_10129592 rootH2_101295923 135
113 3300003323 rootH1_10137211 rootH1_101372113 135
114 3300013100 Ga0157373_10000906 Ga0157373_1000090612 135
115 3300013307 Ga0157372_10001857 Ga0157372_1000185714 135
116 3300025944 Ga0207661_10634830 Ga0207661_106348303 135
117 3300031548 Ga0307408_100004934 Ga0307408_1000049345 135
118 3300031901 Ga0307406_10000035 Ga0307406_1000003514 135
119 3300031903 Ga0307407_10001839 Ga0307407_100018392 135
120 3300032004 Ga0307414_10039458 Ga0307414_100394582 135
121 3300035398 Ga0316574_0112984 Ga0316574_0112984_45_458 135
122 3300036647 Ga0316582_0221195 Ga0316582_0221195_74_487 135
123 3300041511 Ga0451855_0585470 Ga0451855_0585470_404_814 135
124 3300041511 Ga0451855_1682377 Ga0451855_1682377_11_433 135
125 3300009545 Ga0105237_10205321 Ga0105237_102053214 136
126 3300021361 Ga0213872_10046148 Ga0213872_100461482 136
127 3300025914 Ga0207671_10247372 Ga0207671_102473722 136
128 3300025933 Ga0207706_10120235 Ga0207706_101202352 136
129 3300041456 Ga0451795_1526939 Ga0451795_1526939_168_581 136
130 3300048088 Ga0495602_0832509 Ga0495602_0832509_126_551 136
131 3300005327 Ga0070658_10000675 Ga0070658_1000067515 137
132 3300009094 Ga0111539_10464031 Ga0111539_104640312 137
133 3300010375 Ga0105239_11022545 Ga0105239_110225452 137
134 3300013297 Ga0157378_10014208 Ga0157378_100142082 137
135 3300013308 Ga0157375_10044158 Ga0157375_100441584 137
136 3300025909 Ga0207705_10000035 Ga0207705_10000035190 137
137 3300028653 Ga0265323_10000861 Ga0265323_100008616 137
138 3300031344 Ga0265316_10000445 Ga0265316_1000044534 137
139 3300002737 JGI25162J39368_1000008 JGI25162J39368_1000008347 138
140 3300002737 JGI25162J39368_1000097 JGI25162J39368_10000972 138
141 3300002737 JGI25162J39368_1001750 JGI25162J39368_100175010 138
142 3300002741 JGI25157J39369_1003537 JGI25157J39369_10035374 138
143 3300002772 JGI25164J39214_1001588 JGI25164J39214_10015882 138
144 3300003214 JGI25165J46597_1001806 JGI25165J46597_10018067 138
145 3300003316 rootH1_10066801 rootH1_100668015 138
146 3300003320 rootH2_10051724 rootH2_100517241 138
147 3300003323 rootH1_10009825 rootH1_1000982516 138
148 3300003323 rootH1_10319162 rootH1_103191624 138
149 3300005288 Ga0065714_10304051 Ga0065714_103040511 138
150 3300005327 Ga0070658_10046496 Ga0070658_100464964 138
151 3300005334 Ga0068869_100322915 Ga0068869_1003229152 138
152 3300005338 Ga0068868_100194034 Ga0068868_1001940342 138
153 3300005339 Ga0070660_100055224 Ga0070660_1000552243 138
154 3300005339 Ga0070660_100074243 Ga0070660_1000742432 138
155 3300005355 Ga0070671_100031981 Ga0070671_1000319812 138
156 3300005356 Ga0070674_100124537 Ga0070674_1001245372 138
157 3300005364 Ga0070673_100078444 Ga0070673_1000784442 138
158 3300005456 Ga0070678_100006070 Ga0070678_1000060701 138
159 3300005457 Ga0070662_100002625 Ga0070662_1000026258 138
160 3300005459 Ga0068867_100001804 Ga0068867_1000018046 138
161 3300005530 Ga0070679_100927721 Ga0070679_1009277212 138
162 3300005539 Ga0068853_100196358 Ga0068853_1001963581 138
163 3300005548 Ga0070665_100000017 Ga0070665_10000001768 138
164 3300005548 Ga0070665_100624734 Ga0070665_1006247342 138
165 3300005563 Ga0068855_100000021 Ga0068855_100000021166 138
166 3300005563 Ga0068855_100001368 Ga0068855_10000136816 138
167 3300005563 Ga0068855_100074101 Ga0068855_1000741012 138
168 3300005563 Ga0068855_100220633 Ga0068855_1002206333 138
169 3300005563 Ga0068855_100297046 Ga0068855_1002970462 138
170 3300005578 Ga0068854_100263277 Ga0068854_1002632771 138
171 3300005616 Ga0068852_100086651 Ga0068852_1000866512 138
172 3300005718 Ga0068866_10106676 Ga0068866_101066762 138
173 3300005718 Ga0068866_10107297 Ga0068866_101072972 138
174 3300005842 Ga0068858_100552477 Ga0068858_1005524772 138
175 3300006195 Ga0075366_10002552 Ga0075366_100025522 138
176 3300006358 Ga0068871_100003252 Ga0068871_1000032525 138
177 3300006358 Ga0068871_101703170 Ga0068871_1017031702 138
178 3300006881 Ga0068865_100000070 Ga0068865_10000007031 138
179 3300009093 Ga0105240_10002855 Ga0105240_1000285525 138
180 3300009093 Ga0105240_10008396 Ga0105240_100083962 138
181 3300009093 Ga0105240_10042273 Ga0105240_100422733 138
182 3300009093 Ga0105240_10180434 Ga0105240_101804342 138
183 3300009093 Ga0105240_10369851 Ga0105240_103698512 138
184 3300009093 Ga0105240_10482774 Ga0105240_104827742 138
185 3300009093 Ga0105240_10888352 Ga0105240_108883522 138
186 3300009093 Ga0105240_11234390 Ga0105240_112343902 138
187 3300009093 Ga0105240_11836550 Ga0105240_118365501 138
188 3300009174 Ga0105241_10024488 Ga0105241_100244884 138
189 3300009174 Ga0105241_10066559 Ga0105241_100665592 138
190 3300009174 Ga0105241_10174680 Ga0105241_101746802 138
191 3300009174 Ga0105241_10747921 Ga0105241_107479212 138
192 3300009545 Ga0105237_10001977 Ga0105237_1000197720 138
193 3300009545 Ga0105237_10008458 Ga0105237_100084584 138
194 3300009545 Ga0105237_10058718 Ga0105237_100587182 138
195 3300009545 Ga0105237_10074118 Ga0105237_100741183 138
196 3300009545 Ga0105237_10285138 Ga0105237_102851382 138
197 3300009545 Ga0105237_11189644 Ga0105237_111896441 138
198 3300009545 Ga0105237_11195521 Ga0105237_111955211 138
199 3300009551 Ga0105238_10064791 Ga0105238_100647914 138
200 3300009553 Ga0105249_10523851 Ga0105249_105238513 138
201 3300010375 Ga0105239_10006488 Ga0105239_100064887 138
202 3300010375 Ga0105239_10008634 Ga0105239_100086345 138
203 3300010375 Ga0105239_10046548 Ga0105239_100465484 138
204 3300010375 Ga0105239_10067803 Ga0105239_100678032 138
205 3300010375 Ga0105239_10389981 Ga0105239_103899812 138
206 3300011119 Ga0105246_10047403 Ga0105246_100474032 138
207 3300011119 Ga0105246_10118452 Ga0105246_101184522 138
208 3300013100 Ga0157373_10016236 Ga0157373_100162365 138
209 3300013102 Ga0157371_10033359 Ga0157371_100333592 138
210 3300013102 Ga0157371_10228872 Ga0157371_102288722 138
211 3300013104 Ga0157370_10165325 Ga0157370_101653252 138
212 3300013104 Ga0157370_11012249 Ga0157370_110122492 138
213 3300013105 Ga0157369_10578184 Ga0157369_105781842 138
214 3300013296 Ga0157374_10002863 Ga0157374_100028632 138
215 3300013296 Ga0157374_10003120 Ga0157374_100031202 138
216 3300013296 Ga0157374_10008123 Ga0157374_100081238 138
217 3300013296 Ga0157374_10245678 Ga0157374_102456782 138
218 3300013296 Ga0157374_10607397 Ga0157374_106073972 138
219 3300013296 Ga0157374_12510162 Ga0157374_125101621 138
220 3300013297 Ga0157378_10009763 Ga0157378_100097636 138
221 3300013297 Ga0157378_12271010 Ga0157378_122710102 138
222 3300013306 Ga0163162_10000026 Ga0163162_1000002695 138
223 3300013306 Ga0163162_10008696 Ga0163162_100086962 138
224 3300013306 Ga0163162_11423914 Ga0163162_114239142 138
225 3300013307 Ga0157372_10002641 Ga0157372_100026417 138
226 3300013307 Ga0157372_10056349 Ga0157372_100563493 138
227 3300013307 Ga0157372_10240882 Ga0157372_102408821 138
228 3300013308 Ga0157375_10034707 Ga0157375_100347073 138
229 3300014745 Ga0157377_10321061 Ga0157377_103210611 138
230 3300014745 Ga0157377_10643888 Ga0157377_106438881 138
231 3300014968 Ga0157379_12123963 Ga0157379_121239631 138
232 3300014969 Ga0157376_10306754 Ga0157376_103067542 138
233 3300014969 Ga0157376_11439268 Ga0157376_114392682 138
234 3300015262 Ga0182007_10097771 Ga0182007_100977712 138
235 3300017792 Ga0163161_10046491 Ga0163161_100464913 138
236 3300025230 Ga0209563_104415 Ga0209563_1044153 138
237 3300025231 Ga0207427_100083 Ga0207427_100083110 138
238 3300025233 Ga0209437_100021 Ga0209437_100021369 138
239 3300025233 Ga0209437_100030 Ga0209437_10003098 138
240 3300025250 Ga0209026_1000309 Ga0209026_10003097 138
241 3300025250 Ga0209026_1006044 Ga0209026_10060443 138
242 3300025250 Ga0209026_1019374 Ga0209026_10193742 138
243 3300025258 Ga0209129_1013484 Ga0209129_10134842 138
244 3300025261 Ga0209233_1000035 Ga0209233_1000035269 138
245 3300025272 Ga0209455_1000911 Ga0209455_10009119 138
246 3300025899 Ga0207642_10044150 Ga0207642_100441502 138
247 3300025899 Ga0207642_10077320 Ga0207642_100773202 138
248 3300025904 Ga0207647_10019818 Ga0207647_100198186 138
249 3300025907 Ga0207645_10002024 Ga0207645_1000202416 138
250 3300025909 Ga0207705_10196626 Ga0207705_101966262 138
251 3300025911 Ga0207654_10006104 Ga0207654_100061045 138
252 3300025911 Ga0207654_10121145 Ga0207654_101211452 138
253 3300025911 Ga0207654_10276768 Ga0207654_102767681 138
254 3300025911 Ga0207654_10410145 Ga0207654_104101452 138
255 3300025913 Ga0207695_10002500 Ga0207695_1000250021 138
256 3300025913 Ga0207695_10006085 Ga0207695_1000608517 138
257 3300025913 Ga0207695_10061938 Ga0207695_100619384 138
258 3300025913 Ga0207695_10280019 Ga0207695_102800192 138
259 3300025914 Ga0207671_10004973 Ga0207671_1000497314 138
260 3300025914 Ga0207671_10012109 Ga0207671_100121091 138
261 3300025914 Ga0207671_10035390 Ga0207671_100353903 138
262 3300025914 Ga0207671_10106473 Ga0207671_101064733 138
263 3300025914 Ga0207671_10645925 Ga0207671_106459252 138
264 3300025919 Ga0207657_10066004 Ga0207657_100660043 138
265 3300025919 Ga0207657_10098610 Ga0207657_100986103 138
266 3300025919 Ga0207657_10615632 Ga0207657_106156321 138
267 3300025921 Ga0207652_10787157 Ga0207652_107871572 138
268 3300025924 Ga0207694_10037432 Ga0207694_100374323 138
269 3300025931 Ga0207644_10032556 Ga0207644_100325562 138
270 3300025932 Ga0207690_10564898 Ga0207690_105648981 138
271 3300025933 Ga0207706_10007385 Ga0207706_100073856 138
272 3300025937 Ga0207669_10179689 Ga0207669_101796891 138
273 3300025938 Ga0207704_10008834 Ga0207704_100088343 138
274 3300025942 Ga0207689_10988841 Ga0207689_109888411 138
275 3300025949 Ga0207667_10000014 Ga0207667_10000014375 138
276 3300025949 Ga0207667_10004397 Ga0207667_100043974 138
277 3300025949 Ga0207667_10061379 Ga0207667_100613794 138
278 3300025949 Ga0207667_10116905 Ga0207667_101169053 138
279 3300025949 Ga0207667_10646475 Ga0207667_106464752 138
280 3300025949 Ga0207667_10677546 Ga0207667_106775461 138
281 3300025960 Ga0207651_10193964 Ga0207651_101939642 138
282 3300025981 Ga0207640_10191509 Ga0207640_101915091 138
283 3300026023 Ga0207677_10019700 Ga0207677_100197004 138
284 3300026041 Ga0207639_10011413 Ga0207639_100114136 138
285 3300026041 Ga0207639_10175504 Ga0207639_101755041 138
286 3300026041 Ga0207639_10390119 Ga0207639_103901192 138
287 3300026078 Ga0207702_10018346 Ga0207702_100183465 138
288 3300026078 Ga0207702_10143033 Ga0207702_101430332 138
289 3300026089 Ga0207648_10004191 Ga0207648_100041918 138
290 3300026121 Ga0207683_10008462 Ga0207683_100084629 138
291 3300026142 Ga0207698_10467715 Ga0207698_104677152 138
292 3300026142 Ga0207698_11205952 Ga0207698_112059521 138
293 3300028379 Ga0268266_10000037 Ga0268266_10000037246 138
294 3300028379 Ga0268266_10622869 Ga0268266_106228691 138
295 3300028786 Ga0307517_10001130 Ga0307517_1000113045 138
296 3300028794 Ga0307515_10000077 Ga0307515_100000776 138
297 3300028794 Ga0307515_10001268 Ga0307515_100012685 138
298 3300030731 Ga0316177_1191401 Ga0316177_11914012 138
299 3300030732 Ga0316176_1132212 Ga0316176_11322123 138
300 3300030742 Ga0316183_1121655 Ga0316183_11216552 138
301 3300030744 Ga0316181_1251786 Ga0316181_12517862 138
302 3300030744 Ga0316181_1251850 Ga0316181_12518501 138
303 3300031251 Ga0265327_10203236 Ga0265327_102032361 138
304 3300031456 Ga0307513_10661981 Ga0307513_106619811 138
305 3300031507 Ga0307509_10036898 Ga0307509_100368986 138
306 3300031507 Ga0307509_10580194 Ga0307509_105801942 138
307 3300031911 Ga0307412_10085146 Ga0307412_100851463 138
308 3300032004 Ga0307414_10007351 Ga0307414_100073516 138
309 3300032004 Ga0307414_10010475 Ga0307414_100104752 138
310 3300032004 Ga0307414_10355868 Ga0307414_103558681 138
311 3300033179 Ga0307507_10002432 Ga0307507_100024329 138
312 3300033180 Ga0307510_10003117 Ga0307510_1000311711 138
313 3300037312 Ga0395899_0000793 Ga0395899_0000793_12752_13168 138
314 3300037312 Ga0395899_0432419 Ga0395899_0432419_266_682 138
315 3300037418 Ga0395900_0001235 Ga0395900_0001235_17795_18211 138
316 3300037418 Ga0395900_0015395 Ga0395900_0015395_293_709 138
317 3300037418 Ga0395900_0832611 Ga0395900_0832611_222_638 138
318 3300037466 Ga0395898_0002540 Ga0395898_0002540_3212_3628 138
319 3300037466 Ga0395898_0082490 Ga0395898_0082490_226_642 138
320 3300037471 Ga0395905_0001253 Ga0395905_0001253_17795_18211 138
321 3300037471 Ga0395905_0003224 Ga0395905_0003224_2458_2874 138
322 3300038443 Ga0395901_0000941 Ga0395901_0000941_17795_18211 138
323 3300038443 Ga0395901_0003465 Ga0395901_0003465_1458_1874 138
324 3300039447 Ga0436361_0693619 Ga0436361_0693619_575_991 138
325 3300041452 Ga0451793_1641723 Ga0451793_1641723_16_432 138
326 3300045049 Ga0466959_0129264 Ga0466959_0129264_163_579 138
327 3300046457 Ga0495590_0249564 Ga0495590_0249564_83_514 138
328 3300046459 Ga0495629_0045785 Ga0495629_0045785_2431_2847 138
329 3300046462 Ga0495651_0513977 Ga0495651_0513977_20_436 138
330 3300046471 Ga0495650_0000268 Ga0495650_0000268_12916_13332 138
331 3300046471 Ga0495650_0022329 Ga0495650_0022329_628_1044 138
332 3300046471 Ga0495650_0084385 Ga0495650_0084385_686_1102 138
333 3300046474 Ga0495605_0070906 Ga0495605_0070906_1203_1619 138
334 3300046492 Ga0495585_0000034 Ga0495585_0000034_84568_84984 138
335 3300046492 Ga0495585_0000092 Ga0495585_0000092_53843_54259 138
336 3300046492 Ga0495585_0065385 Ga0495585_0065385_649_1065 138
337 3300046506 Ga0495583_0336281 Ga0495583_0336281_111_527 138
338 3300046507 Ga0495606_0000009 Ga0495606_0000009_15624_16040 138
339 3300046507 Ga0495606_0017622 Ga0495606_0017622_743_1159 138
340 3300046507 Ga0495606_0018340 Ga0495606_0018340_3132_3548 138
341 3300046507 Ga0495606_0018377 Ga0495606_0018377_427_858 138
342 3300046507 Ga0495606_0049051 Ga0495606_0049051_1948_2364 138
343 3300046507 Ga0495606_0164891 Ga0495606_0164891_466_882 138
344 3300046507 Ga0495606_0168909 Ga0495606_0168909_666_1082 138
345 3300046507 Ga0495606_0405832 Ga0495606_0405832_32_448 138
346 3300046512 Ga0495610_0003590 Ga0495610_0003590_6528_6944 138
347 3300046512 Ga0495610_0055033 Ga0495610_0055033_49_465 138
348 3300046513 Ga0495616_0000907 Ga0495616_0000907_10197_10619 138
349 3300046514 Ga0495618_0933301 Ga0495618_0933301_28_444 138
350 3300046518 Ga0495631_0002726 Ga0495631_0002726_3531_3947 138
351 3300046518 Ga0495631_0079037 Ga0495631_0079037_971_1387 138
352 3300046518 Ga0495631_0223107 Ga0495631_0223107_216_632 138
353 3300046519 Ga0495632_0048095 Ga0495632_0048095_413_829 138
354 3300046523 Ga0495644_0006660 Ga0495644_0006660_173_589 138
355 3300046524 Ga0495648_0026374 Ga0495648_0026374_1641_2057 138
356 3300046525 Ga0495663_0029348 Ga0495663_0029348_784_1200 138
357 3300046529 Ga0495652_0033146 Ga0495652_0033146_3203_3619 138
358 3300046529 Ga0495652_0316638 Ga0495652_0316638_494_910 138
359 3300046530 Ga0495654_0034393 Ga0495654_0034393_745_1161 138
360 3300046538 Ga0495609_0003700 Ga0495609_0003700_144_560 138
361 3300046557 Ga0495622_0303254 Ga0495622_0303254_120_536 138
362 3300046558 Ga0495633_0000004 Ga0495633_0000004_98067_98483 138
363 3300046558 Ga0495633_0002693 Ga0495633_0002693_5236_5652 138
364 3300046616 Ga0495668_0000058 Ga0495668_0000058_168550_168966 138
365 3300046616 Ga0495668_0014321 Ga0495668_0014321_3994_4410 138
366 3300046616 Ga0495668_0062609 Ga0495668_0062609_1614_2030 138
367 3300046616 Ga0495668_0312969 Ga0495668_0312969_391_807 138
368 3300046660 Ga0495625_0000007 Ga0495625_0000007_342748_343164 138
369 3300046660 Ga0495625_0001150 Ga0495625_0001150_27565_28044 138
370 3300046660 Ga0495625_0003596 Ga0495625_0003596_7957_8373 138
371 3300046660 Ga0495625_0003990 Ga0495625_0003990_9560_9976 138
372 3300046660 Ga0495625_0025592 Ga0495625_0025592_2878_3294 138
373 3300046660 Ga0495625_0062263 Ga0495625_0062263_506_922 138
374 3300046660 Ga0495625_0101229 Ga0495625_0101229_292_723 138
375 3300046660 Ga0495625_0104406 Ga0495625_0104406_1444_1860 138
376 3300046660 Ga0495625_0808808 Ga0495625_0808808_99_515 138
377 3300046665 Ga0495661_0014872 Ga0495661_0014872_3503_3919 138
378 3300046665 Ga0495661_0095328 Ga0495661_0095328_107_523 138
379 3300046665 Ga0495661_0173750 Ga0495661_0173750_266_682 138
380 3300046674 Ga0495588_0336877 Ga0495588_0336877_292_708 138
381 3300046683 Ga0495658_0007035 Ga0495658_0007035_4764_5180 138
382 3300046684 Ga0495669_0388293 Ga0495669_0388293_179_595 138
383 3300046694 Ga0495649_0000007 Ga0495649_0000007_94434_94850 138
384 3300047323 Ga0495683_0039499 Ga0495683_0039499_834_1250 138
385 3300047443 Ga0495687_001260 Ga0495687_001260_21888_22304 138
386 3300047445 Ga0495677_0022571 Ga0495677_0022571_1573_1989 138
387 3300047445 Ga0495677_0117690 Ga0495677_0117690_24_464 138
388 3300047469 Ga0495673_0013418 Ga0495673_0013418_1845_2261 138
389 3300047472 Ga0495686_0000965 Ga0495686_0000965_13113_13529 138
390 3300047472 Ga0495686_0111552 Ga0495686_0111552_188_604 138
391 3300047472 Ga0495686_0374474 Ga0495686_0374474_304_720 138
392 3300048089 Ga0495614_0009240 Ga0495614_0009240_1634_2050 138
393 3300049459 Ga0495678_008815 Ga0495678_008815_2874_3296 138
394 3300050493 nmdc:mga0k408_1836_c1 nmdc:mga0k408_1836_c1_10696_11112 138
395 3300050496 nmdc:mga07m45_396675_c1 nmdc:mga07m45_396675_c1_310_750 138
396 3300053086 Ga0500578_0190116 Ga0500578_0190116_238_654 138
397 3300053122 Ga0500608_080987 Ga0500608_080987_86_502 138
398 3300053123 Ga0500614_045512 Ga0500614_045512_49_465 138
399 3300053125 Ga0500618_000006 Ga0500618_000006_170578_170994 138
400 3300053125 Ga0500618_026620 Ga0500618_026620_594_1010 138
401 3300053137 Ga0500561_0043542 Ga0500561_0043542_333_749 138
402 3300053139 Ga0500568_0095945 Ga0500568_0095945_431_847 138
403 3300053156 Ga0500622_0000173 Ga0500622_0000173_60208_60624 138
404 3300053157 Ga0500624_000187 Ga0500624_000187_815_1231 138
405 iso_pu_bacteria 2928147474 2928150327 138

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02367

TsaE

Threonylcarbamoyl adenosine biosynthesis protein TsaE

27

155

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5np9-assembly1.cif.gz_A crystal structure of bacillus subtilis ydib in complex with adp 0.8742 1 138
6s84-assembly1.cif.gz_E tsabde complex from thermotoga maritima 0.8477 1 135
5np9-assembly1.cif.gz_A crystal structure of bacillus subtilis ydib in complex with adp 0.8449 1 138
5mvr-assembly1.cif.gz_A crystal structure of bacillus subtilus ydib 0.838 1 138
6s84-assembly1.cif.gz_E tsabde complex from thermotoga maritima 0.8254 1 135
ID Description Score Start End Superfamily
af_P0AF67_2_153_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8629 1 138 3.40.50.300
af_P0AF67_2_153_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8572 1 138 3.40.50.300
af_Q2FWK9_1_139_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8527 7 137 3.40.50.300
af_P9WFS7_20_166_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8212 1 138 3.40.50.300
af_P9WFS7_20_166_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8159 1 138 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3B0U9P2-F1-model_v4 tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) 0.9735 1 137 GO:0002949
GO:0005524
GO:0005737
AF-A0A1M7KR79-F1-model_v4 tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) 0.9727 1 138 GO:0002949
GO:0005524
GO:0005737
AF-A0A1T5C791-F1-model_v4 tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) 0.9727 1 138 GO:0002949
GO:0005524
GO:0005737
AF-A0A2P8G3Q5-F1-model_v4 tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) 0.97 1 138 GO:0002949
GO:0005524
GO:0005737
AF-A0A5E7Y938-F1-model_v4 tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) 0.9697 1 137 GO:0002949
GO:0005524
GO:0005737

Feature Viewer

pLDDT pTM Quality
93.88 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map