F435979

General Info

Members Datasets Scaffolds Average Seq Length
405 214 810 546

Family's Representative Sequence

Representative Sequence 3300031614|Ga0310103_102621|Ga0310103_1026211
Length 622
Sequence MYKHSRSRMVANPCLNMLGRTANFSLRRAKAVESVEGFTHANMSIALPFLARSKQLTNFHSISPDYILRNTRPMASLANFKIPRVDNESMKHYSPGSPERKSLEDAIVSLEQRVPLNIPLVVGGKEVKGSSTQTQLDPSAYRTPLATYSNAGTADVKAAIDAALSAKQSWASTPFADRASIFLKAADLVATKYRYDIMAMTMCGQGKNAWQAEIDAAAELCDFFRFGVKYAEDLYSQQPAHNSPGVWNRVEYRPLEGFVYAISPFNFTAIGGNLPGAPALMGNVVVWKPSPSAIASNWLVHKILLEAGLPPNVIQFVPGDAEEVTTTVLNHPEFAALHFTGSTSVFRMLYGKIASGVAEGKYRNYPRIVGETGGKNFHLIDKSADVKNAVVQTVRGAFEYQGQKCSATSRAYVASSIAEEFQTQLVDEVRKIKIGPPSDFSNFCGPVIHEAAFKKLSTTIDEAKNDKELRLLTGGSYDSSEGWYIHPTVYHTSNPNHPLLSRELFGPILVIHVYDDAAESALSNICETIERTGEYGLTGAVFAQDRGAVRLAEDALRNAAGNFYINCKSTGAVVGQQPFGGSRASGTNDKAGSSNLLSRFVSLRSIKEEFVPTYSVTYPSNA

Samples

Sample ID Description Type Environment
1 3300031614 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
84 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
85 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
86 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
87 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
88 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
89 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
90 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
91 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
92 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
93 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
94 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
95 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
96 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
97 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
98 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
99 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
100 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
101 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
107 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
108 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
109 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
110 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
117 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
118 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
119 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
120 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
121 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
122 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
123 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
124 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
125 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
130 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
131 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
132 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
133 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
134 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
138 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
139 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
140 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
141 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
142 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
145 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
146 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
147 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
148 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
149 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
179 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
180 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
183 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
184 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
185 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
186 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
187 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
188 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
189 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
192 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
193 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
194 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
197 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
200 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
203 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
204 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
207 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
212 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
213 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
214 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 98.02
Metatranscriptomes 1.48
Isolates 0.49

Biome Distribution

Category Percentage (%)
Aerial Root 0.25
Bulb 0
Endosphere 0.99
Nodule 0
Rhizoplane 10.12
Rhizosphere 88.4
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0310103_102621 3300031614 Eukaryota 2180
2 SwRhRL2b_contig_3704442 2162886007 Eukaryota 36617
3 Ga0065704_10070223 3300005289 Eukaryota 62295
4 Ga0065707_10081902 3300005295 Eukaryota 30108
5 Ga0070658_10007076 3300005327 Bacteria 9053
6 Ga0070658_10049260 3300005327 Bacteria 3412
7 Ga0070683_100001124 3300005329 Bacteria 20214
8 Ga0070683_100001149 3300005329 Bacteria 20016
9 Ga0070683_100059676 3300005329 Bacteria 3544
10 Ga0070683_100063697 3300005329 Bacteria 3430
11 Ga0070683_100079101 3300005329 Bacteria 3077
12 Ga0070683_100129912 3300005329 Bacteria 2384
13 Ga0070683_100157716 3300005329 Bacteria 2153
14 Ga0070670_100002716 3300005331 Bacteria 14613
15 Ga0070666_10024089 3300005335 Bacteria 3964
16 Ga0070680_100016402 3300005336 Bacteria 5830
17 Ga0070680_100051504 3300005336 Bacteria 3359
18 Ga0070680_100105222 3300005336 Bacteria 2346
19 Ga0070682_100027774 3300005337 Bacteria 3398
20 Ga0070660_100026350 3300005339 Bacteria 4327
21 Ga0070660_100096035 3300005339 Bacteria 2343
22 Ga0070660_100105511 3300005339 Bacteria 2236
23 Ga0070689_100055142 3300005340 Bacteria 3079
24 Ga0070669_100012013 3300005353 Bacteria 6146
25 Ga0070659_100017321 3300005366 Bacteria 5419
26 Ga0070703_10003786 3300005406 Bacteria 4280
27 Ga0070714_100005039 3300005435 Bacteria 10044
28 Ga0070714_100072791 3300005435 Bacteria 2976
29 Ga0070713_100109083 3300005436 Bacteria 2411
30 Ga0070701_10036691 3300005438 Bacteria 2471
31 Ga0070705_100014141 3300005440 Bacteria 4099
32 Ga0070681_10001242 3300005458 Bacteria 22193
33 Ga0070681_10014000 3300005458 Bacteria 7983
34 Ga0070681_10140953 3300005458 Bacteria 2340
35 Ga0070681_10196717 3300005458 Bacteria 1935
36 Ga0070681_10198734 3300005458 Bacteria 1923
37 Ga0070706_100057742 3300005467 Bacteria 3581
38 Ga0070706_100086067 3300005467 Bacteria 2912
39 Ga0070707_100002227 3300005468 Bacteria 18519
40 Ga0070707_100038570 3300005468 Bacteria 4563
41 Ga0070699_100010657 3300005518 Bacteria 7957
42 Ga0070679_100002714 3300005530 Bacteria 16116
43 Ga0070679_100007897 3300005530 Bacteria 9984
44 Ga0070679_100011419 3300005530 Bacteria 8464
45 Ga0070684_100001095 3300005535 Bacteria 19436
46 Ga0070697_100063306 3300005536 Bacteria 3020
47 Ga0070704_100006252 3300005549 Bacteria 7006
48 Ga0068855_100013886 3300005563 Bacteria 9713
49 Ga0068855_100031365 3300005563 Bacteria 6346
50 Ga0068855_100054270 3300005563 Bacteria 4710
51 Ga0068855_100085798 3300005563 Bacteria 3642
52 Ga0068855_100105026 3300005563 Bacteria 3248
53 Ga0068855_100151846 3300005563 Bacteria 2633
54 Ga0068855_100246905 3300005563 Eukaryota 1992
55 Ga0068857_100045605 3300005577 Bacteria 3890
56 Ga0068857_100089527 3300005577 Bacteria 2754
57 Ga0068857_100098608 3300005577 Bacteria 2621
58 Ga0068852_100115574 3300005616 Bacteria 2446
59 Ga0068864_100104421 3300005618 Bacteria 2517
60 Ga0081455_10026433 3300005937 Bacteria 5337
61 Ga0081455_10046774 3300005937 Bacteria 3751
62 Ga0081455_10052858 3300005937 Bacteria 3474
63 Ga0081455_10084320 3300005937 Bacteria 2593
64 Ga0081538_10000080 3300005981 Bacteria 92392
65 Ga0081538_10000615 3300005981 Bacteria 39511
66 Ga0081539_10031574 3300005985 Bacteria 3262
67 Ga0070717_10132332 3300006028 Bacteria 2146
68 Ga0075364_10126061 3300006051 Bacteria 1716
69 Ga0070715_10009390 3300006163 Bacteria 3446
70 Ga0070715_10018675 3300006163 Bacteria 2647
71 Ga0070712_100065611 3300006175 Bacteria 2577
72 Ga0075428_100004219 3300006844 Bacteria 15835
73 Ga0075430_100003085 3300006846 Bacteria 13918
74 Ga0075430_100038668 3300006846 Bacteria 4041
75 Ga0075431_100016373 3300006847 Bacteria 7523
76 Ga0075431_100050946 3300006847 Bacteria 4269
77 Ga0075434_100016154 3300006871 Bacteria 7174
78 Ga0075434_100018935 3300006871 Bacteria 6654
79 Ga0075434_100030245 3300006871 Bacteria 5332
80 Ga0075436_100002273 3300006914 Bacteria 13258
81 Ga0075435_100001957 3300007076 Bacteria 13443
82 Ga0075435_100081398 3300007076 Bacteria 2660
83 Ga0105240_10036152 3300009093 Bacteria 6356
84 Ga0105240_10101237 3300009093 Bacteria 3505
85 Ga0114129_10056473 3300009147 Bacteria 5498
86 Ga0114129_10101251 3300009147 Bacteria 3986
87 Ga0114129_10120318 3300009147 Bacteria 3616
88 Ga0105237_10042969 3300009545 Eukaryota 4555
89 Ga0105238_10056873 3300009551 Bacteria 3923
90 Ga0105239_10030451 3300010375 Eukaryota 5934
91 Ga0157370_10029465 3300013104 Bacteria 5385
92 Ga0157370_10116111 3300013104 Bacteria 2500
93 Ga0157370_10182373 3300013104 Bacteria 1950
94 Ga0157369_10005342 3300013105 Bacteria 14966
95 Ga0157369_10075304 3300013105 Bacteria 3619
96 Ga0163162_10014028 3300013306 Bacteria 7832
97 Ga0157372_10259620 3300013307 Bacteria 2017
98 Ga0157380_10039946 3300014326 Bacteria 3652
99 Ga0157380_10044160 3300014326 Bacteria 3491
100 Ga0206356_11608139 3300020070 Bacteria 6623
101 Ga0206354_10864821 3300020081 Bacteria 3291
102 Ga0206354_11265696 3300020081 Bacteria 2580
103 Ga0207685_10007534 3300025905 Bacteria 3039
104 Ga0207685_10022946 3300025905 Bacteria 2117
105 Ga0207705_10008139 3300025909 Bacteria 7677
106 Ga0207684_10081497 3300025910 Bacteria 2754
107 Ga0207707_10001645 3300025912 Bacteria 20606
108 Ga0207707_10011438 3300025912 Bacteria 7731
109 Ga0207707_10157122 3300025912 Bacteria 1988
110 Ga0207707_10168569 3300025912 Bacteria 1913
111 Ga0207695_10010109 3300025913 Bacteria 11578
112 Ga0207695_10076179 3300025913 Bacteria 3411
113 Ga0207695_10227804 3300025913 Bacteria 1769
114 Ga0207693_10002153 3300025915 Bacteria 17189
115 Ga0207660_10008859 3300025917 Bacteria 6504
116 Ga0207657_10002763 3300025919 Bacteria 18897
117 Ga0207657_10003801 3300025919 Bacteria 16051
118 Ga0207657_10046412 3300025919 Bacteria 3805
119 Ga0207652_10019052 3300025921 Bacteria 5636
120 Ga0207652_10069598 3300025921 Bacteria 3055
121 Ga0207646_10005106 3300025922 Bacteria 13926
122 Ga0207646_10181810 3300025922 Bacteria 1899
123 Ga0207694_10065852 3300025924 Bacteria 2825
124 Ga0207650_10007568 3300025925 Bacteria 7403
125 Ga0207664_10105767 3300025929 Bacteria 2333
126 Ga0207670_10055201 3300025936 Bacteria 2684
127 Ga0207669_10004946 3300025937 Bacteria 5930
128 Ga0207665_10024261 3300025939 Bacteria 3998
129 Ga0207661_10023238 3300025944 Bacteria 4683
130 Ga0207661_10065818 3300025944 Bacteria 2943
131 Ga0207667_10032447 3300025949 Bacteria 5628
132 Ga0207667_10054736 3300025949 Bacteria 4196
133 Ga0207667_10146683 3300025949 Bacteria 2429
134 Ga0207667_10147243 3300025949 Bacteria 2424
135 Ga0207667_10173979 3300025949 Bacteria 2212
136 Ga0207712_10106228 3300025961 Bacteria 2097
137 Ga0207708_10009232 3300026075 Bacteria 7299
138 Ga0207702_10064067 3300026078 Bacteria 3145
139 Ga0207648_10177618 3300026089 Bacteria 1883
140 Ga0207674_10008270 3300026116 Bacteria 12050
141 Ga0207674_10050366 3300026116 Bacteria 4255
142 Ga0207674_10080201 3300026116 Bacteria 3267
143 Ga0207698_10043225 3300026142 Bacteria 3374
144 Ga0207698_10049433 3300026142 Bacteria 3200
145 Ga0209813_10010673 3300027866 Bacteria 2383
146 Ga0207428_10035913 3300027907 Bacteria 4047
147 Ga0265319_1002564 3300028563 Bacteria 9829
148 Ga0265334_10003298 3300028573 Bacteria 7360
149 Ga0265318_10000657 3300028577 Bacteria 23614
150 Ga0265323_10028921 3300028653 Bacteria 2076
151 Ga0265338_10003688 3300028800 Bacteria 21332
152 Ga0265338_10011683 3300028800 Bacteria 10110
153 Ga0265330_10000672 3300031235 Bacteria 21962
154 Ga0265332_10003872 3300031238 Bacteria 7146
155 Ga0265328_10001789 3300031239 Bacteria 9800
156 Ga0265325_10001475 3300031241 Bacteria 16573
157 Ga0265329_10003122 3300031242 Bacteria 7306
158 Ga0265340_10001171 3300031247 Bacteria 15016
159 Ga0265339_10006260 3300031249 Bacteria 7834
160 Ga0265331_10002439 3300031250 Bacteria 12593
161 Ga0265327_10004284 3300031251 Bacteria 12759
162 Ga0265327_10006306 3300031251 Bacteria 9541
163 Ga0265316_10004219 3300031344 Bacteria 14355
164 Ga0265316_10010516 3300031344 Bacteria 8428
165 Ga0265313_10003136 3300031595 Bacteria 13647
166 Ga0265313_10004332 3300031595 Bacteria 10980
167 Ga0265314_10003360 3300031711 Bacteria 15527
168 Ga0265314_10007017 3300031711 Bacteria 9842
169 Ga0265342_10002099 3300031712 Bacteria 17590
170 Ga0316576_10002175 3300031727 Bacteria 11063
171 Ga0316576_10041998 3300031727 Bacteria 3294
172 Ga0307405_10055099 3300031731 Bacteria 2487
173 Ga0307406_10008238 3300031901 Bacteria 5810
174 Ga0307409_100009875 3300031995 Bacteria 5892
175 Ga0307415_100108166 3300032126 Bacteria 2056
176 Ga0316583_10000417 3300032133 Bacteria 12485
177 Ga0373959_0003813 3300034820 Bacteria 2412
178 Ga0373949_0004494 3300035090 Bacteria 3193
179 Ga0373951_0003407 3300035091 Bacteria 3859
180 Ga0373945_0014528 3300035116 Bacteria 2640
181 Ga0395899_0010352 3300037312 Bacteria 7148
182 Ga0395900_0022511 3300037418 Bacteria 6446
183 Ga0395900_0140822 3300037418 Bacteria 2470
184 Ga0395900_0155498 3300037418 Bacteria 2335
185 Ga0395898_0002583 3300037466 Bacteria 21154
186 Ga0395898_0004648 3300037466 Bacteria 14966
187 Ga0395898_0008715 3300037466 Bacteria 10700
188 Ga0395898_0016838 3300037466 Bacteria 7467
189 Ga0395898_0035931 3300037466 Bacteria 4924
190 Ga0395898_0051293 3300037466 Bacteria 4035
191 Ga0395898_0052986 3300037466 Bacteria 3962
192 Ga0395898_0117788 3300037466 Bacteria 2544
193 Ga0395898_0200521 3300037466 Bacteria 1905
194 Ga0395905_0006944 3300037471 Bacteria 11316
195 Ga0395905_0042637 3300037471 Bacteria 4257
196 Ga0395905_0077005 3300037471 Bacteria 3125
197 Ga0395905_0090212 3300037471 Bacteria 2873
198 Ga0395905_0253246 3300037471 Bacteria 1645
199 Ga0395901_0007318 3300038443 Bacteria 11142
200 Ga0395901_0014699 3300038443 Bacteria 7955
201 Ga0395901_0016681 3300038443 Bacteria 7483
202 Ga0395901_0021357 3300038443 Bacteria 6633
203 Ga0395901_0105653 3300038443 Bacteria 2955
204 Ga0395901_0127919 3300038443 Bacteria 2670
205 Ga0451791_1892005 3300041451 Bacteria 2073
206 Ga0451793_1120119 3300041452 Bacteria 1952
207 Ga0451800_1184596 3300041459 Bacteria 2531
208 Ga0451804_0588630 3300041463 Bacteria 2470
209 Ga0466961_0007490 3300044693 Bacteria 6943
210 Ga0466961_0017410 3300044693 Bacteria 4616
211 Ga0466963_0000496 3300044694 Bacteria 18307
212 Ga0466963_0017118 3300044694 Bacteria 4514
213 Ga0466963_0025274 3300044694 Bacteria 3786
214 Ga0466963_0028451 3300044694 Bacteria 3588
215 Ga0466964_0007934 3300044706 Bacteria 3974
216 Ga0466971_0000165 3300044719 Bacteria 24707
217 Ga0466957_0002554 3300044842 Bacteria 9795
218 Ga0466957_0077605 3300044842 Bacteria 2064
219 Ga0466959_0027983 3300045049 Bacteria 4180
220 Ga0451576_0025332 3300045051 Bacteria 6391
221 Ga0451576_0029196 3300045051 Bacteria 5902
222 Ga0466958_0000198 3300045836 Bacteria 22183
223 Ga0466967_0000189 3300045976 Bacteria 25578
224 Ga0466967_0001769 3300045976 Bacteria 12923
225 Ga0466967_0003540 3300045976 Bacteria 10223
226 Ga0466967_0007738 3300045976 Bacteria 7791
227 Ga0466967_0018142 3300045976 Bacteria 5614
228 Ga0466967_0022484 3300045976 Bacteria 5146
229 Ga0466967_0085351 3300045976 Bacteria 2858
230 Ga0466967_0205229 3300045976 Bacteria 1868
231 Ga0466967_0244534 3300045976 Bacteria 1712
232 Ga0495592_0026326 3300046454 Bacteria 4411
233 Ga0495641_0015740 3300046461 Eukaryota 4017
234 Ga0495651_0027078 3300046462 Bacteria 4465
235 Ga0495651_0041733 3300046462 Eukaryota 3563
236 Ga0495664_0009804 3300046477 Bacteria 5369
237 Ga0495608_0009796 3300046511 Bacteria 6688
238 Ga0495618_0041069 3300046514 Bacteria 2912
239 Ga0495628_0010159 3300046516 Eukaryota 8005
240 Ga0495630_0044688 3300046517 Bacteria 3310
241 Ga0495652_0002895 3300046529 Eukaryota 17276
242 Ga0495652_0022382 3300046529 Eukaryota 5607
243 Ga0495635_0002564 3300046663 Eukaryota 12435
244 Ga0495613_0035226 3300046689 Bacteria 3716
245 Ga0495624_0004878 3300046690 Eukaryota 9750
246 Ga0495624_0064555 3300046690 Eukaryota 2288
247 Ga0495600_0004390 3300046809 Eukaryota 8438
248 Ga0495636_0039465 3300047318 Bacteria 1955
249 Ga0495674_0069936 3300047319 Bacteria 3034
250 Ga0495674_0120661 3300047319 Bacteria 2215
251 Ga0495676_0008020 3300047321 Eukaryota 9680
252 Ga0495680_0001425 3300047322 Bacteria 25755
253 Ga0495680_0038093 3300047322 Eukaryota 3846
254 Ga0495602_0000258 3300048088 Eukaryota 49044
255 Ga0495602_0024791 3300048088 Eukaryota 5815
256 Ga0495614_0051470 3300048089 Eukaryota 1765
257 Ga0496100_0002124 3300048903 Bacteria 9985
258 Ga0496100_0011012 3300048903 Bacteria 5130
259 Ga0496100_0019584 3300048903 Bacteria 4040
260 Ga0496100_0024066 3300048903 Bacteria 3709
261 Ga0496100_0063869 3300048903 Bacteria 2434
262 Ga0496101_0001841 3300048904 Bacteria 12790
263 Ga0496101_0026451 3300048904 Bacteria 4034
264 Ga0496101_0074250 3300048904 Bacteria 2500
265 Ga0496101_0090895 3300048904 Bacteria 2271
266 Ga0496102_0003961 3300048905 Bacteria 12558
267 Ga0496102_0048925 3300048905 Bacteria 3845
268 Ga0496102_0136610 3300048905 Bacteria 2298
269 Ga0496104_0055873 3300048907 Bacteria 3732
270 Ga0496104_0086858 3300048907 Bacteria 2986
271 Ga0496105_0006238 3300048908 Bacteria 9152
272 Ga0496105_0017644 3300048908 Bacteria 5726
273 Ga0496105_0021061 3300048908 Bacteria 5273
274 Ga0496106_0006827 3300048909 Bacteria 8449
275 Ga0496106_0016814 3300048909 Bacteria 5411
276 Ga0496106_0111817 3300048909 Bacteria 2128
277 Ga0496106_0141093 3300048909 Bacteria 1895
278 Ga0496107_0000589 3300048910 Bacteria 20289
279 Ga0496107_0002408 3300048910 Bacteria 12114
280 Ga0496107_0018863 3300048910 Bacteria 4862
281 Ga0496107_0018896 3300048910 Bacteria 4858
282 Ga0496108_0021687 3300048911 Bacteria 5280
283 Ga0496108_0037789 3300048911 Bacteria 4023
284 Ga0496109_0006713 3300048912 Bacteria 9687
285 Ga0496109_0008179 3300048912 Bacteria 8873
286 Ga0496110_0007513 3300048913 Bacteria 8708
287 Ga0496110_0081480 3300048913 Bacteria 2885
288 Ga0496110_0138546 3300048913 Bacteria 2200
289 Ga0496112_0070850 3300048915 Bacteria 3445
290 Ga0496112_0125354 3300048915 Bacteria 2539
291 Ga0496114_0001310 3300048917 Bacteria 18849
292 Ga0496114_0007374 3300048917 Bacteria 8689
293 Ga0496115_0002558 3300048918 Bacteria 13065
294 Ga0501307_002354 3300049162 Eukaryota 1752
295 Ga0501315_002122 3300049531 Eukaryota 1821
296 Ga0501031_0036009 3300049568 Bacteria 3227
297 Ga0501031_0044519 3300049568 Bacteria 2896
298 Ga0501032_0001481 3300049569 Bacteria 18719
299 Ga0501032_0032363 3300049569 Bacteria 3584
300 Ga0501033_0000208 3300049570 Bacteria 56046
301 Ga0501033_0135308 3300049570 Bacteria 1783
302 Ga0501034_0016738 3300049571 Bacteria 7518
303 Ga0501036_0000195 3300049572 Bacteria 40369
304 Ga0501036_0060321 3300049572 Bacteria 3213
305 Ga0501037_0000878 3300049573 Bacteria 22466
306 Ga0501038_0001148 3300049574 Bacteria 23997
307 Ga0501038_0055423 3300049574 Bacteria 3405
308 Ga0501039_0000171 3300049575 Bacteria 45473
309 Ga0501039_0001294 3300049575 Bacteria 18277
310 Ga0501040_0000094 3300049576 Bacteria 44554
311 Ga0501040_0001618 3300049576 Bacteria 14350
312 Ga0501040_0026369 3300049576 Bacteria 3908
313 Ga0501041_0000319 3300049577 Bacteria 23508
314 Ga0501041_0011515 3300049577 Bacteria 5230
315 Ga0501042_0000315 3300049578 Bacteria 24225
316 Ga0501042_0014292 3300049578 Bacteria 5417
317 Ga0501042_0034416 3300049578 Bacteria 3592
318 Ga0501043_0000295 3300049579 Bacteria 45082
319 Ga0501046_0000999 3300049580 Bacteria 27627
320 Ga0501046_0003469 3300049580 Bacteria 14475
321 Ga0501046_0067391 3300049580 Bacteria 2788
322 Ga0501047_0001126 3300049581 Bacteria 26549
323 Ga0501047_0005665 3300049581 Bacteria 11758
324 Ga0501048_0001207 3300049582 Bacteria 19578
325 Ga0501048_0005525 3300049582 Bacteria 9618
326 Ga0501048_0066872 3300049582 Bacteria 2540
327 Ga0501067_0000236 3300049583 Bacteria 30606
328 Ga0501067_0000880 3300049583 Bacteria 16149
329 Ga0501067_0045947 3300049583 Bacteria 2423
330 Ga0501068_0000052 3300049584 Bacteria 45484
331 Ga0501068_0000202 3300049584 Bacteria 28454
332 Ga0501069_0000102 3300049585 Bacteria 39947
333 Ga0501069_0020789 3300049585 Bacteria 3559
334 Ga0501069_0081130 3300049585 Bacteria 1827
335 Ga0501070_0000402 3300049586 Bacteria 39380
336 Ga0501070_0079273 3300049586 Bacteria 2718
337 Ga0501070_0082491 3300049586 Bacteria 2661
338 Ga0501071_0001321 3300049587 Bacteria 14134
339 Ga0501071_0008286 3300049587 Bacteria 6864
340 Ga0501072_0000942 3300049588 Bacteria 21417
341 Ga0501072_0029232 3300049588 Bacteria 4303
342 Ga0501072_0055358 3300049588 Bacteria 3126
343 Ga0501073_0001135 3300049589 Bacteria 19358
344 Ga0501073_0003540 3300049589 Bacteria 11724
345 Ga0501074_0000118 3300049590 Bacteria 40043
346 Ga0501074_0007043 3300049590 Bacteria 8121
347 Ga0501074_0034195 3300049590 Bacteria 3685
348 Ga0501074_0047279 3300049590 Bacteria 3111
349 Ga0501074_0060185 3300049590 Bacteria 2736
350 Ga0501075_0000109 3300049591 Bacteria 38985
351 Ga0501075_0003818 3300049591 Bacteria 10142
352 Ga0501075_0066473 3300049591 Bacteria 2720
353 Ga0501076_0000940 3300049592 Bacteria 18997
354 Ga0501076_0028540 3300049592 Bacteria 4333
355 Ga0501076_0090954 3300049592 Bacteria 2454
356 Ga0501077_0001444 3300049593 Bacteria 14302
357 Ga0501077_0001852 3300049593 Bacteria 12782
358 Ga0501077_0041701 3300049593 Bacteria 2920
359 Ga0501079_0000086 3300049741 Bacteria 44783
360 Ga0501079_0000099 3300049741 Bacteria 43513
361 Ga0501079_0067014 3300049741 Bacteria 2770
362 Ga0501080_0000768 3300049742 Bacteria 26067
363 Ga0501081_0000235 3300049743 Bacteria 28089
364 Ga0501081_0000839 3300049743 Bacteria 18170
365 Ga0501081_0010109 3300049743 Bacteria 6156
366 Ga0501083_0000227 3300049744 Bacteria 36195
367 Ga0501083_0090707 3300049744 Bacteria 2018
368 Ga0501241_004362 3300049758 Bacteria 2653
369 Ga0501035_0001709 3300049822 Bacteria 22177
370 Ga0501035_0062744 3300049822 Bacteria 3306
371 Ga0501044_0000984 3300049823 Bacteria 34240
372 Ga0501045_0001187 3300049824 Bacteria 17323
373 Ga0501045_0002734 3300049824 Bacteria 12046
374 Ga0501045_0046960 3300049824 Bacteria 3144
375 Ga0501045_0079949 3300049824 Bacteria 2410
376 nmdc:mga0k408_31065_c1 3300050493 Bacteria 3048
377 nmdc:mga05p37_86198_c1 3300050507 Bacteria 3871
378 nmdc:mga0qj67_44280_c1 3300050509 Bacteria 3507
379 nmdc:mga06r32_12993_c1 3300050510 Bacteria 7531
380 nmdc:mga06r32_130413_c1 3300050510 Bacteria 2486
381 nmdc:mga06r32_308811_c1 3300050510 Bacteria 1567
382 nmdc:mga08y16_83247_c1 3300050511 Bacteria 3334
383 nmdc:mga0n895_16254_c1 3300050512 Bacteria 6823
384 nmdc:mga0n895_21274_c1 3300050512 Bacteria 6061
385 nmdc:mga0rr50_16219_c1 3300050513 Bacteria 4941
386 nmdc:mga0rr50_70800_c1 3300050513 Bacteria 2658
387 nmdc:mga0rr50_92369_c1 3300050513 Bacteria 2359
388 nmdc:mga08x19_2194_c1 3300050514 Bacteria 11940
389 nmdc:mga0a205_191314_c1 3300050515 Bacteria 1938
390 Ga0495601_0074830 3300053077 Bacteria 2167
391 Ga0500643_000852 3300053087 Bacteria 19498
392 Ga0501084_0001163 3300054114 Bacteria 20525
393 Ga0590075_001090 3300059424 Bacteria 7005
394 Ga0501082_0000563 3300060353 Bacteria 32925
395 Ga0501082_0000584 3300060353 Bacteria 32310
396 Ga0501082_0042886 3300060353 Bacteria 3899
397 Ga0501082_0053534 3300060353 Bacteria 3479
398 Ga0466962_0001902 3300061719 Bacteria 9828
399 Ga0466962_0014950 3300061719 Bacteria 3742
400 Ga0530510_0001857 3300061734 Bacteria 14439
401 Ga0530510_0007980 3300061734 Bacteria 7386
402 Ga0530510_0021940 3300061734 Bacteria 4545
403 Ga0530510_0034116 3300061734 Bacteria 3665
404 2890806604 2890804823 Bacteria 3717572
405 2984527087 2984523437 Bacteria 4508481
406 Ga0310103_102621
407 SwRhRL2b_contig_3704442
408 Ga0065704_10070223
409 Ga0065707_10081902
410 Ga0070658_10007076
411 Ga0070658_10049260
412 Ga0070683_100001124
413 Ga0070683_100001149
414 Ga0070683_100059676
415 Ga0070683_100063697
416 Ga0070683_100079101
417 Ga0070683_100129912
418 Ga0070683_100157716
419 Ga0070670_100002716
420 Ga0070666_10024089
421 Ga0070680_100016402
422 Ga0070680_100051504
423 Ga0070680_100105222
424 Ga0070682_100027774
425 Ga0070660_100026350
426 Ga0070660_100096035
427 Ga0070660_100105511
428 Ga0070689_100055142
429 Ga0070669_100012013
430 Ga0070659_100017321
431 Ga0070703_10003786
432 Ga0070714_100005039
433 Ga0070714_100072791
434 Ga0070713_100109083
435 Ga0070701_10036691
436 Ga0070705_100014141
437 Ga0070681_10001242
438 Ga0070681_10014000
439 Ga0070681_10140953
440 Ga0070681_10196717
441 Ga0070681_10198734
442 Ga0070706_100057742
443 Ga0070706_100086067
444 Ga0070707_100002227
445 Ga0070707_100038570
446 Ga0070699_100010657
447 Ga0070679_100002714
448 Ga0070679_100007897
449 Ga0070679_100011419
450 Ga0070684_100001095
451 Ga0070697_100063306
452 Ga0070704_100006252
453 Ga0068855_100013886
454 Ga0068855_100031365
455 Ga0068855_100054270
456 Ga0068855_100085798
457 Ga0068855_100105026
458 Ga0068855_100151846
459 Ga0068855_100246905
460 Ga0068857_100045605
461 Ga0068857_100089527
462 Ga0068857_100098608
463 Ga0068852_100115574
464 Ga0068864_100104421
465 Ga0081455_10026433
466 Ga0081455_10046774
467 Ga0081455_10052858
468 Ga0081455_10084320
469 Ga0081538_10000080
470 Ga0081538_10000615
471 Ga0081539_10031574
472 Ga0070717_10132332
473 Ga0075364_10126061
474 Ga0070715_10009390
475 Ga0070715_10018675
476 Ga0070712_100065611
477 Ga0075428_100004219
478 Ga0075430_100003085
479 Ga0075430_100038668
480 Ga0075431_100016373
481 Ga0075431_100050946
482 Ga0075434_100016154
483 Ga0075434_100018935
484 Ga0075434_100030245
485 Ga0075436_100002273
486 Ga0075435_100001957
487 Ga0075435_100081398
488 Ga0105240_10036152
489 Ga0105240_10101237
490 Ga0114129_10056473
491 Ga0114129_10101251
492 Ga0114129_10120318
493 Ga0105237_10042969
494 Ga0105238_10056873
495 Ga0105239_10030451
496 Ga0157370_10029465
497 Ga0157370_10116111
498 Ga0157370_10182373
499 Ga0157369_10005342
500 Ga0157369_10075304
501 Ga0163162_10014028
502 Ga0157372_10259620
503 Ga0157380_10039946
504 Ga0157380_10044160
505 Ga0206356_11608139
506 Ga0206354_10864821
507 Ga0206354_11265696
508 Ga0207685_10007534
509 Ga0207685_10022946
510 Ga0207705_10008139
511 Ga0207684_10081497
512 Ga0207707_10001645
513 Ga0207707_10011438
514 Ga0207707_10157122
515 Ga0207707_10168569
516 Ga0207695_10010109
517 Ga0207695_10076179
518 Ga0207695_10227804
519 Ga0207693_10002153
520 Ga0207660_10008859
521 Ga0207657_10002763
522 Ga0207657_10003801
523 Ga0207657_10046412
524 Ga0207652_10019052
525 Ga0207652_10069598
526 Ga0207646_10005106
527 Ga0207646_10181810
528 Ga0207694_10065852
529 Ga0207650_10007568
530 Ga0207664_10105767
531 Ga0207670_10055201
532 Ga0207669_10004946
533 Ga0207665_10024261
534 Ga0207661_10023238
535 Ga0207661_10065818
536 Ga0207667_10032447
537 Ga0207667_10054736
538 Ga0207667_10146683
539 Ga0207667_10147243
540 Ga0207667_10173979
541 Ga0207712_10106228
542 Ga0207708_10009232
543 Ga0207702_10064067
544 Ga0207648_10177618
545 Ga0207674_10008270
546 Ga0207674_10050366
547 Ga0207674_10080201
548 Ga0207698_10043225
549 Ga0207698_10049433
550 Ga0209813_10010673
551 Ga0207428_10035913
552 Ga0265319_1002564
553 Ga0265334_10003298
554 Ga0265318_10000657
555 Ga0265323_10028921
556 Ga0265338_10003688
557 Ga0265338_10011683
558 Ga0265330_10000672
559 Ga0265332_10003872
560 Ga0265328_10001789
561 Ga0265325_10001475
562 Ga0265329_10003122
563 Ga0265340_10001171
564 Ga0265339_10006260
565 Ga0265331_10002439
566 Ga0265327_10004284
567 Ga0265327_10006306
568 Ga0265316_10004219
569 Ga0265316_10010516
570 Ga0265313_10003136
571 Ga0265313_10004332
572 Ga0265314_10003360
573 Ga0265314_10007017
574 Ga0265342_10002099
575 Ga0316576_10002175
576 Ga0316576_10041998
577 Ga0307405_10055099
578 Ga0307406_10008238
579 Ga0307409_100009875
580 Ga0307415_100108166
581 Ga0316583_10000417
582 Ga0373959_0003813
583 Ga0373949_0004494
584 Ga0373951_0003407
585 Ga0373945_0014528
586 Ga0395899_0010352
587 Ga0395900_0022511
588 Ga0395900_0140822
589 Ga0395900_0155498
590 Ga0395898_0002583
591 Ga0395898_0004648
592 Ga0395898_0008715
593 Ga0395898_0016838
594 Ga0395898_0035931
595 Ga0395898_0051293
596 Ga0395898_0052986
597 Ga0395898_0117788
598 Ga0395898_0200521
599 Ga0395905_0006944
600 Ga0395905_0042637
601 Ga0395905_0077005
602 Ga0395905_0090212
603 Ga0395905_0253246
604 Ga0395901_0007318
605 Ga0395901_0014699
606 Ga0395901_0016681
607 Ga0395901_0021357
608 Ga0395901_0105653
609 Ga0395901_0127919
610 Ga0451791_1892005
611 Ga0451793_1120119
612 Ga0451800_1184596
613 Ga0451804_0588630
614 Ga0466961_0007490
615 Ga0466961_0017410
616 Ga0466963_0000496
617 Ga0466963_0017118
618 Ga0466963_0025274
619 Ga0466963_0028451
620 Ga0466964_0007934
621 Ga0466971_0000165
622 Ga0466957_0002554
623 Ga0466957_0077605
624 Ga0466959_0027983
625 Ga0451576_0025332
626 Ga0451576_0029196
627 Ga0466958_0000198
628 Ga0466967_0000189
629 Ga0466967_0001769
630 Ga0466967_0003540
631 Ga0466967_0007738
632 Ga0466967_0018142
633 Ga0466967_0022484
634 Ga0466967_0085351
635 Ga0466967_0205229
636 Ga0466967_0244534
637 Ga0495592_0026326
638 Ga0495641_0015740
639 Ga0495651_0027078
640 Ga0495651_0041733
641 Ga0495664_0009804
642 Ga0495608_0009796
643 Ga0495618_0041069
644 Ga0495628_0010159
645 Ga0495630_0044688
646 Ga0495652_0002895
647 Ga0495652_0022382
648 Ga0495635_0002564
649 Ga0495613_0035226
650 Ga0495624_0004878
651 Ga0495624_0064555
652 Ga0495600_0004390
653 Ga0495636_0039465
654 Ga0495674_0069936
655 Ga0495674_0120661
656 Ga0495676_0008020
657 Ga0495680_0001425
658 Ga0495680_0038093
659 Ga0495602_0000258
660 Ga0495602_0024791
661 Ga0495614_0051470
662 Ga0496100_0002124
663 Ga0496100_0011012
664 Ga0496100_0019584
665 Ga0496100_0024066
666 Ga0496100_0063869
667 Ga0496101_0001841
668 Ga0496101_0026451
669 Ga0496101_0074250
670 Ga0496101_0090895
671 Ga0496102_0003961
672 Ga0496102_0048925
673 Ga0496102_0136610
674 Ga0496104_0055873
675 Ga0496104_0086858
676 Ga0496105_0006238
677 Ga0496105_0017644
678 Ga0496105_0021061
679 Ga0496106_0006827
680 Ga0496106_0016814
681 Ga0496106_0111817
682 Ga0496106_0141093
683 Ga0496107_0000589
684 Ga0496107_0002408
685 Ga0496107_0018863
686 Ga0496107_0018896
687 Ga0496108_0021687
688 Ga0496108_0037789
689 Ga0496109_0006713
690 Ga0496109_0008179
691 Ga0496110_0007513
692 Ga0496110_0081480
693 Ga0496110_0138546
694 Ga0496112_0070850
695 Ga0496112_0125354
696 Ga0496114_0001310
697 Ga0496114_0007374
698 Ga0496115_0002558
699 Ga0501307_002354
700 Ga0501315_002122
701 Ga0501031_0036009
702 Ga0501031_0044519
703 Ga0501032_0001481
704 Ga0501032_0032363
705 Ga0501033_0000208
706 Ga0501033_0135308
707 Ga0501034_0016738
708 Ga0501036_0000195
709 Ga0501036_0060321
710 Ga0501037_0000878
711 Ga0501038_0001148
712 Ga0501038_0055423
713 Ga0501039_0000171
714 Ga0501039_0001294
715 Ga0501040_0000094
716 Ga0501040_0001618
717 Ga0501040_0026369
718 Ga0501041_0000319
719 Ga0501041_0011515
720 Ga0501042_0000315
721 Ga0501042_0014292
722 Ga0501042_0034416
723 Ga0501043_0000295
724 Ga0501046_0000999
725 Ga0501046_0003469
726 Ga0501046_0067391
727 Ga0501047_0001126
728 Ga0501047_0005665
729 Ga0501048_0001207
730 Ga0501048_0005525
731 Ga0501048_0066872
732 Ga0501067_0000236
733 Ga0501067_0000880
734 Ga0501067_0045947
735 Ga0501068_0000052
736 Ga0501068_0000202
737 Ga0501069_0000102
738 Ga0501069_0020789
739 Ga0501069_0081130
740 Ga0501070_0000402
741 Ga0501070_0079273
742 Ga0501070_0082491
743 Ga0501071_0001321
744 Ga0501071_0008286
745 Ga0501072_0000942
746 Ga0501072_0029232
747 Ga0501072_0055358
748 Ga0501073_0001135
749 Ga0501073_0003540
750 Ga0501074_0000118
751 Ga0501074_0007043
752 Ga0501074_0034195
753 Ga0501074_0047279
754 Ga0501074_0060185
755 Ga0501075_0000109
756 Ga0501075_0003818
757 Ga0501075_0066473
758 Ga0501076_0000940
759 Ga0501076_0028540
760 Ga0501076_0090954
761 Ga0501077_0001444
762 Ga0501077_0001852
763 Ga0501077_0041701
764 Ga0501079_0000086
765 Ga0501079_0000099
766 Ga0501079_0067014
767 Ga0501080_0000768
768 Ga0501081_0000235
769 Ga0501081_0000839
770 Ga0501081_0010109
771 Ga0501083_0000227
772 Ga0501083_0090707
773 Ga0501241_004362
774 Ga0501035_0001709
775 Ga0501035_0062744
776 Ga0501044_0000984
777 Ga0501045_0001187
778 Ga0501045_0002734
779 Ga0501045_0046960
780 Ga0501045_0079949
781 nmdc:mga0k408_31065_c1
782 nmdc:mga05p37_86198_c1
783 nmdc:mga0qj67_44280_c1
784 nmdc:mga06r32_12993_c1
785 nmdc:mga06r32_130413_c1
786 nmdc:mga06r32_308811_c1
787 nmdc:mga08y16_83247_c1
788 nmdc:mga0n895_16254_c1
789 nmdc:mga0n895_21274_c1
790 nmdc:mga0rr50_16219_c1
791 nmdc:mga0rr50_70800_c1
792 nmdc:mga0rr50_92369_c1
793 nmdc:mga08x19_2194_c1
794 nmdc:mga0a205_191314_c1
795 Ga0495601_0074830
796 Ga0500643_000852
797 Ga0501084_0001163
798 Ga0590075_001090
799 Ga0501082_0000563
800 Ga0501082_0000584
801 Ga0501082_0042886
802 Ga0501082_0053534
803 Ga0466962_0001902
804 Ga0466962_0014950
805 Ga0530510_0001857
806 Ga0530510_0007980
807 Ga0530510_0021940
808 Ga0530510_0034116
809 2890806604
810 2984527087

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00171

Aldedh

Aldehyde dehydrogenase family

126

606

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v9g-assembly1.cif.gz_B crystal structure of human 1-pyrroline-5-carboxylate dehydrogenase 0.9195 16 531
3v9l-assembly1.cif.gz_A crystal structure of mouse 1-pyrroline-5-carboxylate dehydrogenase complexed with nad+ 0.9172 21 531
4q72-assembly1.cif.gz_B-2 crystal structure of bradyrhizobium japonicum proline utilization a (puta) mutant d779y 0.9156 76 521
3v9h-assembly1.cif.gz_B crystal structure of human 1-pyrroline-5-carboxylate dehydrogenase mutant s352a 0.913 16 531
4oe5-assembly1.cif.gz_B structure of human aldh4a1 crystallized in space group p21 0.9109 16 520
ID Description Score Start End Superfamily
3v9gA02 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.9727 284 484 3.40.309.10
3v9gA02 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.9679 284 484 3.40.309.10
4ns3E02 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.9479 284 483 3.40.309.10
4oe6A02 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.9451 284 482 3.40.309.10
2impA02 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.9437 285 479 3.40.309.10
ID Description Score Start End GO Terms
AF-A0A821K5T7-F1-model_v4 L-glutamate gamma-semialdehyde dehydrogenase (EC 1.2.1.88) 0.9618 253 487 GO:0003842
GO:0005759
GO:0010133
AF-T1AJY2-F1-model_v4 L-glutamate gamma-semialdehyde dehydrogenase (EC 1.2.1.88) 0.9463 196 429 GO:0003842
GO:0009898
GO:0010133
AF-A0A7V9BPZ2-F1-model_v4 L-glutamate gamma-semialdehyde dehydrogenase (EC 1.2.1.88) (L-glutamate gamma-semialdehyde dehydrogenase) 0.942 126 531 GO:0003842
GO:0009898
GO:0010133
AF-M1EDY0-F1-model_v4 Aldehyde dehydrogenase 4 family, member A1 0.9396 281 495 GO:0003842
AF-A0A158CYQ3-F1-model_v4 Phenylacetaldehyde dehydrogenase 0.9358 220 478 GO:0016620

Map