F435906

General Info

Members Datasets Scaffolds Average Seq Length
405 181 405 215

Family's Representative Sequence

Representative Sequence 3300006237|Ga0097621_100601752|Ga0097621_1006017522
Length 227
Sequence VSPPIFDSFGTLLARDIRLAARSGGGAALALSFFALVATLVPLGVGPDLHLLTRVAGGVLWVAAVLAALLSLDRLFQGDFEDGSLDVIALSPLPLELTALAKIAAHWLSTGLPLTLLSPLLALLFNLPPSATRVLFLSLLIGTPAVSAVGAIGASLTLSLKRGGLILPLIILPLLAPVVIFGAGAVALCLDGLASGNALGLLAAFAFAAVLLSPFAAAAGVRLNLGS

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
65 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
67 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
108 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
111 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
112 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
113 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
114 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
115 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
116 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
117 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
118 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
119 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
120 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
121 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
122 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
123 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
124 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
125 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
126 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
132 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
133 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
136 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
139 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
140 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
141 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
142 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
143 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
147 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
148 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
162 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
163 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
164 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
165 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
166 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
167 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
168 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
171 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
174 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
175 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
176 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
177 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
178 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
179 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.96
Nodule 0
Rhizoplane 0.25
Rhizosphere 94.07
Stem 0
Stem Tuber 0
Unclassified 2.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000496 3300003215 Bacteria 25002
2 rootL2_10246191 3300003322 Bacteria 1045
3 Ga0070658_10354265 3300005327 Bacteria 1256
4 Ga0070658_10354557 3300005327 Bacteria 1256
5 Ga0070658_10576299 3300005327 Unclassified 975
6 Ga0070658_10583154 3300005327 Unclassified 968
7 Ga0070676_10035035 3300005328 Bacteria 2885
8 Ga0070676_10276518 3300005328 Bacteria 1130
9 Ga0068869_100019761 3300005334 Bacteria 4609
10 Ga0068869_100112368 3300005334 Bacteria 2074
11 Ga0070666_10081711 3300005335 Bacteria 2209
12 Ga0070680_100124973 3300005336 Bacteria 2149
13 Ga0068868_100043658 3300005338 Bacteria 3502
14 Ga0070661_100065364 3300005344 Bacteria 2673
15 Ga0070668_100338898 3300005347 Bacteria 1270
16 Ga0070659_100922489 3300005366 Bacteria 764
17 Ga0070667_100132586 3300005367 Bacteria 2176
18 Ga0070667_100356749 3300005367 Bacteria 1324
19 Ga0070709_10108312 3300005434 Bacteria 1863
20 Ga0070711_100015575 3300005439 Bacteria 4812
21 Ga0070700_100448698 3300005441 Bacteria 981
22 Ga0070663_100397922 3300005455 Bacteria 1125
23 Ga0070678_100022274 3300005456 Bacteria 4194
24 Ga0070678_100356827 3300005456 Bacteria 1258
25 Ga0070681_10000001 3300005458 Bacteria 946857
26 Ga0070681_10121845 3300005458 Bacteria 2542
27 Ga0068867_100013659 3300005459 Bacteria 5750
28 Ga0068867_100044583 3300005459 Bacteria 3250
29 Ga0070679_100004777 3300005530 Bacteria 12494
30 Ga0070679_100013355 3300005530 Bacteria 7864
31 Ga0070679_100070023 3300005530 Bacteria 3499
32 Ga0068853_100001272 3300005539 Bacteria 18075
33 Ga0068853_100145098 3300005539 Bacteria 2133
34 Ga0068853_100267601 3300005539 Bacteria 1573
35 Ga0068853_100375559 3300005539 Bacteria 1327
36 Ga0070696_100094988 3300005546 Bacteria 2128
37 Ga0070665_100024687 3300005548 Bacteria 6056
38 Ga0070665_100058997 3300005548 Bacteria 3846
39 Ga0070665_100060257 3300005548 Bacteria 3804
40 Ga0070665_100123565 3300005548 Bacteria 2590
41 Ga0070665_100150680 3300005548 Bacteria 2329
42 Ga0068855_100000034 3300005563 Bacteria 166436
43 Ga0068857_100106633 3300005577 Bacteria 2516
44 Ga0068856_100175276 3300005614 Bacteria 2157
45 Ga0068852_100086793 3300005616 Bacteria 2790
46 Ga0068852_100356806 3300005616 Unclassified 1429
47 Ga0068859_100716315 3300005617 Bacteria 1091
48 Ga0068866_10209766 3300005718 Unclassified 1169
49 Ga0068870_10051655 3300005840 Bacteria 2177
50 Ga0068863_100358328 3300005841 Bacteria 1421
51 Ga0068858_100032901 3300005842 Bacteria 4815
52 Ga0068858_100124873 3300005842 Bacteria 2409
53 Ga0068860_100235877 3300005843 Bacteria 1778
54 Ga0068862_100277397 3300005844 Bacteria 1535
55 Ga0081455_10388606 3300005937 Unclassified 972
56 Ga0070712_100001632 3300006175 Bacteria 13719
57 Ga0097621_100000164 3300006237 Bacteria 41441
58 Ga0097621_100209755 3300006237 Bacteria 1694
59 Ga0097621_100212192 3300006237 Bacteria 1684
60 Ga0097621_100601752 3300006237 Bacteria 1005
61 Ga0068871_100000453 3300006358 Bacteria 28117
62 Ga0068871_100106221 3300006358 Bacteria 2356
63 Ga0068871_100216337 3300006358 Bacteria 1659
64 Ga0068871_100400046 3300006358 Bacteria 1223
65 Ga0068865_100046641 3300006881 Bacteria 2974
66 Ga0097620_100716328 3300006931 Bacteria 1091
67 Ga0105240_10000596 3300009093 Bacteria 67093
68 Ga0105240_10021716 3300009093 Bacteria 8532
69 Ga0105240_10262327 3300009093 Bacteria 1992
70 Ga0105240_11028891 3300009093 Unclassified 879
71 Ga0105245_10020016 3300009098 Bacteria 5866
72 Ga0105245_10761488 3300009098 Bacteria 1005
73 Ga0105247_10227389 3300009101 Bacteria 1265
74 Ga0105243_10001795 3300009148 Bacteria 18418
75 Ga0105241_10244215 3300009174 Bacteria 1519
76 Ga0105241_10259333 3300009174 Bacteria 1477
77 Ga0105241_10512691 3300009174 Bacteria 1071
78 Ga0105242_10010441 3300009176 Bacteria 7126
79 Ga0105242_10262217 3300009176 Unclassified 1561
80 Ga0105242_10288862 3300009176 Bacteria 1492
81 Ga0105242_10454457 3300009176 Unclassified 1208
82 Ga0105242_10879588 3300009176 Unclassified 894
83 Ga0105248_10000001 3300009177 Bacteria 1881304
84 Ga0105248_10295503 3300009177 Bacteria 1824
85 Ga0105248_10338067 3300009177 Bacteria 1695
86 Ga0105237_10099401 3300009545 Bacteria 2901
87 Ga0105237_10547881 3300009545 Bacteria 1163
88 Ga0105237_10736664 3300009545 Bacteria 992
89 Ga0105237_10887435 3300009545 Bacteria 899
90 Ga0105237_11017678 3300009545 Bacteria 835
91 Ga0105238_10076148 3300009551 Bacteria 3346
92 Ga0105238_10157255 3300009551 Bacteria 2248
93 Ga0105238_10188890 3300009551 Bacteria 2037
94 Ga0105238_10269153 3300009551 Bacteria 1684
95 Ga0105238_10500307 3300009551 Bacteria 1216
96 Ga0105238_10557764 3300009551 Bacteria 1150
97 Ga0105249_10328763 3300009553 Bacteria 1542
98 Ga0105239_10003096 3300010375 Bacteria 20643
99 Ga0105239_10015532 3300010375 Bacteria 8433
100 Ga0105239_10117542 3300010375 Bacteria 2951
101 Ga0105239_10160054 3300010375 Bacteria 2515
102 Ga0105239_10168400 3300010375 Bacteria 2450
103 Ga0105239_10610352 3300010375 Bacteria 1245
104 Ga0105239_10675861 3300010375 Unclassified 1180
105 Ga0105239_10925232 3300010375 Bacteria 1001
106 Ga0105239_10932938 3300010375 Unclassified 997
107 Ga0105246_10088661 3300011119 Bacteria 2223
108 Ga0105246_10446026 3300011119 Bacteria 1086
109 Ga0157369_10019514 3300013105 Bacteria 7587
110 Ga0157369_10229319 3300013105 Bacteria 1942
111 Ga0157369_10274294 3300013105 Bacteria 1757
112 Ga0157369_10742889 3300013105 Unclassified 1010
113 Ga0157374_10060280 3300013296 Bacteria 3551
114 Ga0157374_10657980 3300013296 Unclassified 1060
115 Ga0157378_10047842 3300013297 Bacteria 3803
116 Ga0157378_10066780 3300013297 Bacteria 3222
117 Ga0157378_10163614 3300013297 Bacteria 2082
118 Ga0157378_10246637 3300013297 Bacteria 1708
119 Ga0157378_10294444 3300013297 Unclassified 1569
120 Ga0157378_10619565 3300013297 Bacteria 1095
121 Ga0163162_10017352 3300013306 Bacteria 7042
122 Ga0163162_10061210 3300013306 Bacteria 3802
123 Ga0163162_10291578 3300013306 Bacteria 1763
124 Ga0163162_10298466 3300013306 Bacteria 1743
125 Ga0157375_10666428 3300013308 Unclassified 1196
126 Ga0157375_11278949 3300013308 Bacteria 862
127 Ga0163163_10000252 3300014325 Bacteria 54262
128 Ga0163163_10140766 3300014325 Bacteria 2455
129 Ga0163163_10239287 3300014325 Bacteria 1865
130 Ga0163163_10259525 3300014325 Bacteria 1788
131 Ga0157380_10430367 3300014326 Bacteria 1261
132 Ga0157379_10043324 3300014968 Bacteria 4018
133 Ga0157379_10157836 3300014968 Bacteria 2047
134 Ga0157379_10523440 3300014968 Unclassified 1101
135 Ga0157376_10128874 3300014969 Bacteria 2255
136 Ga0157376_10285702 3300014969 Bacteria 1556
137 Ga0163161_10031127 3300017792 Bacteria 3800
138 Ga0163161_10298238 3300017792 Bacteria 1269
139 Ga0213876_10000342 3300021384 Bacteria 40552
140 Ga0213876_10021934 3300021384 Bacteria 3378
141 Ga0209233_1001753 3300025261 Bacteria 8362
142 Ga0209455_1002914 3300025272 Bacteria 6310
143 Ga0209758_1000008 3300025297 Bacteria 1215263
144 Ga0207642_10195784 3300025899 Bacteria 1112
145 Ga0207688_10101591 3300025901 Bacteria 1661
146 Ga0207680_10109170 3300025903 Bacteria 1791
147 Ga0207645_10035039 3300025907 Bacteria 3223
148 Ga0207645_10120810 3300025907 Bacteria 1700
149 Ga0207643_10490889 3300025908 Bacteria 784
150 Ga0207705_10077897 3300025909 Bacteria 2412
151 Ga0207705_10118213 3300025909 Bacteria 1964
152 Ga0207705_10185396 3300025909 Bacteria 1572
153 Ga0207705_10525281 3300025909 Unclassified 920
154 Ga0207705_10532188 3300025909 Unclassified 913
155 Ga0207654_10152098 3300025911 Bacteria 1486
156 Ga0207654_10164154 3300025911 Bacteria 1437
157 Ga0207707_10000001 3300025912 Bacteria 1212482
158 Ga0207707_10079656 3300025912 Bacteria 2860
159 Ga0207695_10000004 3300025913 Bacteria 1288665
160 Ga0207695_10043159 3300025913 Bacteria 4808
161 Ga0207695_10095990 3300025913 Bacteria 2967
162 Ga0207695_10246917 3300025913 Bacteria 1685
163 Ga0207695_10560761 3300025913 Unclassified 1024
164 Ga0207671_10155252 3300025914 Bacteria 1770
165 Ga0207671_10162452 3300025914 Bacteria 1730
166 Ga0207671_10216383 3300025914 Bacteria 1500
167 Ga0207693_10001208 3300025915 Bacteria 23029
168 Ga0207693_10128716 3300025915 Bacteria 1990
169 Ga0207663_10122453 3300025916 Bacteria 1783
170 Ga0207660_10094610 3300025917 Bacteria 2221
171 Ga0207657_10269741 3300025919 Bacteria 1353
172 Ga0207657_10341634 3300025919 Bacteria 1181
173 Ga0207657_10728144 3300025919 Unclassified 769
174 Ga0207649_10000109 3300025920 Bacteria 69042
175 Ga0207649_10068470 3300025920 Bacteria 2257
176 Ga0207652_10000506 3300025921 Bacteria 39607
177 Ga0207652_10045043 3300025921 Bacteria 3760
178 Ga0207652_10453231 3300025921 Bacteria 1156
179 Ga0207694_10000010 3300025924 Bacteria 439722
180 Ga0207694_10044668 3300025924 Bacteria 3421
181 Ga0207694_10190877 3300025924 Bacteria 1664
182 Ga0207659_10316190 3300025926 Bacteria 1287
183 Ga0207687_10366011 3300025927 Unclassified 1178
184 Ga0207664_10749154 3300025929 Unclassified 878
185 Ga0207686_10043721 3300025934 Bacteria 2746
186 Ga0207686_10056112 3300025934 Bacteria 2475
187 Ga0207709_10068497 3300025935 Bacteria 2243
188 Ga0207691_10195761 3300025940 Bacteria 1761
189 Ga0207711_10000001 3300025941 Bacteria 1325674
190 Ga0207711_10143514 3300025941 Bacteria 2149
191 Ga0207711_10372863 3300025941 Bacteria 1324
192 Ga0207689_10031599 3300025942 Bacteria 4406
193 Ga0207689_10212762 3300025942 Bacteria 1597
194 Ga0207667_10084426 3300025949 Bacteria 3287
195 Ga0207658_10163264 3300025986 Bacteria 1827
196 Ga0207703_10250067 3300026035 Bacteria 1597
197 Ga0207703_11204168 3300026035 Bacteria 728
198 Ga0207639_10001814 3300026041 Bacteria 14361
199 Ga0207639_10014368 3300026041 Bacteria 5567
200 Ga0207639_10905598 3300026041 Unclassified 824
201 Ga0207678_10699647 3300026067 Bacteria 892
202 Ga0207708_10459511 3300026075 Bacteria 1062
203 Ga0207702_10224187 3300026078 Bacteria 1753
204 Ga0207702_11081720 3300026078 Bacteria 796
205 Ga0207641_10159909 3300026088 Bacteria 2047
206 Ga0207648_10011967 3300026089 Bacteria 8146
207 Ga0207648_10046179 3300026089 Bacteria 3819
208 Ga0207648_10209992 3300026089 Bacteria 1728
209 Ga0207674_10119835 3300026116 Bacteria 2600
210 Ga0207674_10123708 3300026116 Bacteria 2553
211 Ga0207674_10445915 3300026116 Bacteria 1251
212 Ga0207675_100048360 3300026118 Bacteria 3970
213 Ga0207683_10054645 3300026121 Bacteria 3501
214 Ga0207698_10007800 3300026142 Bacteria 6727
215 Ga0207698_10060299 3300026142 Bacteria 2950
216 Ga0207698_10107435 3300026142 Bacteria 2330
217 Ga0268266_10074659 3300028379 Bacteria 2944
218 Ga0268266_10088516 3300028379 Bacteria 2709
219 Ga0268266_10342132 3300028379 Bacteria 1404
220 Ga0268266_10766473 3300028379 Bacteria 931
221 Ga0268266_11040234 3300028379 Bacteria 792
222 Ga0268264_10350666 3300028381 Bacteria 1405
223 Ga0268264_10620777 3300028381 Bacteria 1067
224 Ga0265318_10000225 3300028577 Bacteria 48793
225 Ga0307517_10216287 3300028786 Bacteria 1172
226 Ga0265338_10000006 3300028800 Bacteria 570804
227 Ga0265338_10004936 3300028800 Bacteria 17688
228 Ga0265338_10176296 3300028800 Bacteria 1634
229 Ga0265338_10577858 3300028800 Bacteria 784
230 Ga0265330_10017337 3300031235 Bacteria 3317
231 Ga0265330_10067055 3300031235 Bacteria 1556
232 Ga0265330_10082321 3300031235 Bacteria 1386
233 Ga0265332_10084134 3300031238 Unclassified 1349
234 Ga0265328_10121314 3300031239 Bacteria 975
235 Ga0265325_10000007 3300031241 Bacteria 208874
236 Ga0265325_10001182 3300031241 Bacteria 18613
237 Ga0265325_10002832 3300031241 Bacteria 11567
238 Ga0265325_10039839 3300031241 Bacteria 2471
239 Ga0265329_10033977 3300031242 Bacteria 1648
240 Ga0265340_10012783 3300031247 Bacteria 4430
241 Ga0265340_10025500 3300031247 Bacteria 2993
242 Ga0265339_10005068 3300031249 Bacteria 8848
243 Ga0265339_10005858 3300031249 Bacteria 8150
244 Ga0265339_10019623 3300031249 Bacteria 3966
245 Ga0265331_10000002 3300031250 Bacteria 511481
246 Ga0265331_10000668 3300031250 Bacteria 29543
247 Ga0265331_10015098 3300031250 Bacteria 4089
248 Ga0265331_10024809 3300031250 Bacteria 3030
249 Ga0265331_10034832 3300031250 Bacteria 2481
250 Ga0265327_10000052 3300031251 Bacteria 256602
251 Ga0265316_10001878 3300031344 Bacteria 22055
252 Ga0265316_10083380 3300031344 Bacteria 2449
253 Ga0265316_10151813 3300031344 Bacteria 1735
254 Ga0265316_10356988 3300031344 Bacteria 1057
255 Ga0307513_10326384 3300031456 Bacteria 1291
256 Ga0265313_10001337 3300031595 Bacteria 23225
257 Ga0265313_10009062 3300031595 Bacteria 6515
258 Ga0265313_10015252 3300031595 Bacteria 4489
259 Ga0265313_10174319 3300031595 Bacteria 907
260 Ga0265313_10205373 3300031595 Bacteria 818
261 Ga0265314_10000193 3300031711 Bacteria 90595
262 Ga0265314_10019054 3300031711 Bacteria 5325
263 Ga0265314_10065712 3300031711 Unclassified 2449
264 Ga0265314_10068688 3300031711 Bacteria 2382
265 Ga0265342_10002997 3300031712 Bacteria 14168
266 Ga0265342_10008436 3300031712 Bacteria 7381
267 Ga0265342_10059340 3300031712 Bacteria 2260
268 Ga0265342_10071637 3300031712 Bacteria 2019
269 Ga0307516_10033238 3300031730 Bacteria 5189
270 Ga0307516_10038357 3300031730 Bacteria 4782
271 Ga0373955_0057056 3300035172 Bacteria 2144
272 Ga0373927_0509543 3300035695 Unclassified 795
273 Ga0373937_0010939 3300036401 Bacteria 7946
274 Ga0373937_0420405 3300036401 Bacteria 1269
275 Ga0373925_0008834 3300037068 Bacteria 7340
276 Ga0395901_0370119 3300038443 Bacteria 1476
277 Ga0436365_0173869 3300039437 Bacteria 89108
278 Ga0436365_0513265 3300039437 Bacteria 33844
279 Ga0436363_1442548 3300039450 Bacteria 5217
280 Ga0495664_0005304 3300046477 Bacteria 7070
281 Ga0495628_0261444 3300046516 Bacteria 1290
282 Ga0495628_0352495 3300046516 Unclassified 1082
283 Ga0495652_0150273 3300046529 Bacteria 1821
284 Ga0495652_0158315 3300046529 Bacteria 1761
285 Ga0495587_0092170 3300046536 Bacteria 1750
286 Ga0495587_0112741 3300046536 Bacteria 1561
287 Ga0495609_0099998 3300046538 Bacteria 1257
288 Ga0495645_0027081 3300046543 Bacteria 4163
289 Ga0495645_0273000 3300046543 Unclassified 1115
290 Ga0495622_0001870 3300046557 Bacteria 10378
291 Ga0495611_0059391 3300046648 Bacteria 1736
292 Ga0495599_0242113 3300046678 Bacteria 1099
293 Ga0495624_0398210 3300046690 Bacteria 827
294 Ga0495672_0250853 3300047320 Unclassified 859
295 Ga0495675_0193836 3300047444 Bacteria 1239
296 Ga0495602_0048721 3300048088 Bacteria 3804
297 Ga0495602_0208712 3300048088 Bacteria 1485
298 Ga0496100_0730721 3300048903 Unclassified 774
299 Ga0496121_0005062 3300048924 Bacteria 17204
300 Ga0495682_0000512 3300049460 Bacteria 26836
301 Ga0501031_0002282 3300049568 Bacteria 12147
302 Ga0501032_0017960 3300049569 Bacteria 4961
303 Ga0501032_0030484 3300049569 Bacteria 3702
304 Ga0501032_0166158 3300049569 Bacteria 1448
305 Ga0501032_0316528 3300049569 Bacteria 1008
306 Ga0501033_0001777 3300049570 Bacteria 18831
307 Ga0501033_0004123 3300049570 Bacteria 11711
308 Ga0501033_0030362 3300049570 Bacteria 4062
309 Ga0501033_0066804 3300049570 Bacteria 2644
310 Ga0501033_0073464 3300049570 Bacteria 2511
311 Ga0501033_0268076 3300049570 Bacteria 1207
312 Ga0501033_0343864 3300049570 Bacteria 1045
313 Ga0501033_0429829 3300049570 Bacteria 919
314 Ga0501034_0010501 3300049571 Bacteria 9643
315 Ga0501034_0115738 3300049571 Bacteria 2670
316 Ga0501034_0144047 3300049571 Bacteria 2361
317 Ga0501034_0200676 3300049571 Bacteria 1953
318 Ga0501034_0211264 3300049571 Bacteria 1896
319 Ga0501034_0228576 3300049571 Bacteria 1810
320 Ga0501036_0161885 3300049572 Bacteria 1886
321 Ga0501036_0248734 3300049572 Bacteria 1490
322 Ga0501036_0253269 3300049572 Bacteria 1475
323 Ga0501037_0010179 3300049573 Bacteria 6899
324 Ga0501037_0173024 3300049573 Bacteria 1534
325 Ga0501038_0029191 3300049574 Bacteria 4890
326 Ga0501038_0033605 3300049574 Bacteria 4517
327 Ga0501038_0081669 3300049574 Bacteria 2723
328 Ga0501038_0133925 3300049574 Bacteria 2032
329 Ga0501038_0265632 3300049574 Unclassified 1355
330 Ga0501038_0311052 3300049574 Bacteria 1234
331 Ga0501039_0011053 3300049575 Bacteria 6881
332 Ga0501042_0046021 3300049578 Bacteria 3110
333 Ga0501043_0011178 3300049579 Bacteria 7030
334 Ga0501043_0025232 3300049579 Bacteria 4662
335 Ga0501043_0184381 3300049579 Bacteria 1625
336 Ga0501043_0229767 3300049579 Bacteria 1433
337 Ga0501043_0252154 3300049579 Bacteria 1359
338 Ga0501046_0002140 3300049580 Bacteria 18667
339 Ga0501046_0061575 3300049580 Bacteria 2933
340 Ga0501047_0001999 3300049581 Bacteria 19548
341 Ga0501047_0002100 3300049581 Bacteria 19058
342 Ga0501047_0028007 3300049581 Bacteria 5429
343 Ga0501047_0062805 3300049581 Bacteria 3583
344 Ga0501047_0106078 3300049581 Bacteria 2690
345 Ga0501047_0197956 3300049581 Bacteria 1871
346 Ga0501047_0328233 3300049581 Bacteria 1369
347 Ga0501047_0328744 3300049581 Bacteria 1367
348 Ga0501047_0366167 3300049581 Bacteria 1277
349 Ga0501047_0522019 3300049581 Bacteria 1013
350 Ga0501047_0719113 3300049581 Bacteria 815
351 Ga0501048_0005388 3300049582 Bacteria 9728
352 Ga0501067_0004375 3300049583 Bacteria 7784
353 Ga0501067_0183445 3300049583 Bacteria 1165
354 Ga0501067_0311861 3300049583 Bacteria 876
355 Ga0501068_0015874 3300049584 Bacteria 4336
356 Ga0501068_0249129 3300049584 Bacteria 1132
357 Ga0501069_0003031 3300049585 Bacteria 8634
358 Ga0501070_0013975 3300049586 Bacteria 6759
359 Ga0501070_0044749 3300049586 Bacteria 3682
360 Ga0501070_0111922 3300049586 Bacteria 2256
361 Ga0501072_0039852 3300049588 Bacteria 3688
362 Ga0501072_0043052 3300049588 Bacteria 3548
363 Ga0501073_0017863 3300049589 Bacteria 5133
364 Ga0501073_0127948 3300049589 Bacteria 1760
365 Ga0501074_0000320 3300049590 Bacteria 27784
366 Ga0501074_0147797 3300049590 Bacteria 1681
367 Ga0501079_0001127 3300049741 Bacteria 18624
368 Ga0501079_0272579 3300049741 Bacteria 1323
369 Ga0501080_0058500 3300049742 Bacteria 3587
370 Ga0501080_0088660 3300049742 Bacteria 2874
371 Ga0501080_0170921 3300049742 Bacteria 2004
372 Ga0501080_0175861 3300049742 Bacteria 1972
373 Ga0501080_0284895 3300049742 Bacteria 1501
374 Ga0501083_0000466 3300049744 Bacteria 26013
375 Ga0501083_0041476 3300049744 Bacteria 3121
376 Ga0501035_0011938 3300049822 Bacteria 8039
377 Ga0501035_0039161 3300049822 Bacteria 4290
378 Ga0501035_0043590 3300049822 Bacteria 4042
379 Ga0501035_0061682 3300049822 Bacteria 3337
380 Ga0501035_0452794 3300049822 Bacteria 1061
381 Ga0501044_0053359 3300049823 Bacteria 4159
382 Ga0501044_0120076 3300049823 Bacteria 2630
383 Ga0501044_0135580 3300049823 Bacteria 2453
384 Ga0501044_0191668 3300049823 Bacteria 2006
385 Ga0501044_0247646 3300049823 Bacteria 1724
386 Ga0501044_0324668 3300049823 Bacteria 1463
387 Ga0501044_0330354 3300049823 Bacteria 1447
388 Ga0501044_0515795 3300049823 Bacteria 1095
389 Ga0501044_0565812 3300049823 Bacteria 1032
390 Ga0501044_0658374 3300049823 Bacteria 936
391 Ga0500643_000006 3300053087 Bacteria 479605
392 Ga0500646_0065747 3300053090 Bacteria 1077
393 Ga0500595_001244 3300053119 Bacteria 14031
394 Ga0500595_009546 3300053119 Bacteria 3911
395 Ga0500597_189358 3300053120 Bacteria 869
396 Ga0500655_006284 3300053133 Bacteria 2139
397 Ga0500559_0106516 3300053136 Bacteria 1296
398 Ga0500573_0000520 3300053140 Bacteria 16721
399 Ga0501084_0003150 3300054114 Bacteria 13341
400 Ga0501084_0006883 3300054114 Bacteria 9358
401 Ga0501084_0260872 3300054114 Bacteria 1463
402 Ga0501082_0003591 3300060353 Bacteria 13551
403 Ga0501082_0018496 3300060353 Bacteria 6003
404 Ga0501082_0262254 3300060353 Bacteria 1503
405 Ga0501082_0266987 3300060353 Bacteria 1489

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048903 Ga0496100_0730721 Ga0496100_0730721_160_753 183
2 3300036401 Ga0373937_0420405 Ga0373937_0420405_356_955 185
3 3300046477 Ga0495664_0005304 Ga0495664_0005304_5781_6380 185
4 3300046529 Ga0495652_0150273 Ga0495652_0150273_268_867 185
5 3300046536 Ga0495587_0092170 Ga0495587_0092170_1105_1704 185
6 3300046543 Ga0495645_0027081 Ga0495645_0027081_2760_3359 185
7 3300046678 Ga0495599_0242113 Ga0495599_0242113_172_771 185
8 3300047444 Ga0495675_0193836 Ga0495675_0193836_172_771 185
9 3300049572 Ga0501036_0253269 Ga0501036_0253269_852_1451 185
10 3300049579 Ga0501043_0229767 Ga0501043_0229767_33_632 185
11 3300049581 Ga0501047_0001999 Ga0501047_0001999_8497_9096 185
12 3300049581 Ga0501047_0328233 Ga0501047_0328233_15_614 185
13 3300049581 Ga0501047_0719113 Ga0501047_0719113_195_794 185
14 3300049583 Ga0501067_0183445 Ga0501067_0183445_442_1041 185
15 3300049588 Ga0501072_0043052 Ga0501072_0043052_1478_2077 185
16 3300049589 Ga0501073_0017863 Ga0501073_0017863_665_1264 185
17 3300049590 Ga0501074_0147797 Ga0501074_0147797_643_1242 185
18 3300049741 Ga0501079_0272579 Ga0501079_0272579_108_707 185
19 3300049742 Ga0501080_0058500 Ga0501080_0058500_2696_3295 185
20 3300005546 Ga0070696_100094988 Ga0070696_1000949881 187
21 3300009098 Ga0105245_10020016 Ga0105245_100200167 189
22 3300010375 Ga0105239_10160054 Ga0105239_101600542 189
23 3300011119 Ga0105246_10446026 Ga0105246_104460261 189
24 3300013308 Ga0157375_10666428 Ga0157375_106664282 189
25 3300025942 Ga0207689_10212762 Ga0207689_102127622 189
26 3300031241 Ga0265325_10001182 Ga0265325_100011829 189
27 3300031249 Ga0265339_10005858 Ga0265339_100058589 189
28 3300031595 Ga0265313_10205373 Ga0265313_102053732 189
29 3300031712 Ga0265342_10002997 Ga0265342_1000299714 189
30 3300048088 Ga0495602_0208712 Ga0495602_0208712_660_1304 190
31 3300005344 Ga0070661_100065364 Ga0070661_1000653643 191
32 3300005539 Ga0068853_100145098 Ga0068853_1001450983 191
33 3300005563 Ga0068855_100000034 Ga0068855_10000003446 191
34 3300005616 Ga0068852_100086793 Ga0068852_1000867932 191
35 3300009093 Ga0105240_10000596 Ga0105240_1000059635 191
36 3300009174 Ga0105241_10512691 Ga0105241_105126912 191
37 3300009545 Ga0105237_11017678 Ga0105237_110176781 191
38 3300009551 Ga0105238_10157255 Ga0105238_101572551 191
39 3300009551 Ga0105238_10269153 Ga0105238_102691533 191
40 3300010375 Ga0105239_10003096 Ga0105239_1000309619 191
41 3300025913 Ga0207695_10000004 Ga0207695_100000041025 191
42 3300025914 Ga0207671_10216383 Ga0207671_102163832 191
43 3300025920 Ga0207649_10068470 Ga0207649_100684703 191
44 3300025924 Ga0207694_10000010 Ga0207694_1000001062 191
45 3300026041 Ga0207639_10014368 Ga0207639_100143683 191
46 3300026142 Ga0207698_10007800 Ga0207698_100078002 191
47 3300026142 Ga0207698_10060299 Ga0207698_100602995 191
48 3300031730 Ga0307516_10033238 Ga0307516_100332388 191
49 3300049460 Ga0495682_0000512 Ga0495682_0000512_8398_9054 191
50 3300053133 Ga0500655_006284 Ga0500655_006284_1004_1660 191
51 3300013105 Ga0157369_10019514 Ga0157369_1001951410 193
52 3300031241 Ga0265325_10039839 Ga0265325_100398392 193
53 3300005539 Ga0068853_100267601 Ga0068853_1002676012 194
54 3300005548 Ga0070665_100123565 Ga0070665_1001235653 194
55 3300005577 Ga0068857_100106633 Ga0068857_1001066333 194
56 3300006881 Ga0068865_100046641 Ga0068865_1000466412 194
57 3300009174 Ga0105241_10259333 Ga0105241_102593331 194
58 3300009545 Ga0105237_10099401 Ga0105237_100994015 194
59 3300009551 Ga0105238_10076148 Ga0105238_100761482 194
60 3300010375 Ga0105239_10117542 Ga0105239_101175423 194
61 3300014969 Ga0157376_10285702 Ga0157376_102857023 194
62 3300025913 Ga0207695_10560761 Ga0207695_105607612 194
63 3300025914 Ga0207671_10155252 Ga0207671_101552523 194
64 3300025924 Ga0207694_10044668 Ga0207694_100446682 194
65 3300026116 Ga0207674_10119835 Ga0207674_101198353 194
66 3300028379 Ga0268266_10074659 Ga0268266_100746596 194
67 3300028379 Ga0268266_10766473 Ga0268266_107664732 194
68 3300031239 Ga0265328_10121314 Ga0265328_101213142 194
69 3300031344 Ga0265316_10151813 Ga0265316_101518132 194
70 3300038443 Ga0395901_0370119 Ga0395901_0370119_400_1068 194
71 3300049569 Ga0501032_0030484 Ga0501032_0030484_847_1515 194
72 3300049570 Ga0501033_0073464 Ga0501033_0073464_588_1256 194
73 3300049574 Ga0501038_0265632 Ga0501038_0265632_497_1165 194
74 3300049579 Ga0501043_0252154 Ga0501043_0252154_633_1301 194
75 3300049742 Ga0501080_0088660 Ga0501080_0088660_202_870 194
76 3300049822 Ga0501035_0043590 Ga0501035_0043590_529_1197 194
77 3300049823 Ga0501044_0135580 Ga0501044_0135580_1195_1863 194
78 3300025901 Ga0207688_10101591 Ga0207688_101015912 195
79 3300028800 Ga0265338_10004936 Ga0265338_1000493611 195
80 3300049823 Ga0501044_0658374 Ga0501044_0658374_144_812 195
81 3300005327 Ga0070658_10583154 Ga0070658_105831541 196
82 3300005434 Ga0070709_10108312 Ga0070709_101083121 196
83 3300005439 Ga0070711_100015575 Ga0070711_1000155756 196
84 3300006175 Ga0070712_100001632 Ga0070712_1000016327 196
85 3300009174 Ga0105241_10244215 Ga0105241_102442152 196
86 3300010375 Ga0105239_10015532 Ga0105239_1001553210 196
87 3300013105 Ga0157369_10742889 Ga0157369_107428892 196
88 3300025261 Ga0209233_1001753 Ga0209233_10017538 196
89 3300025909 Ga0207705_10077897 Ga0207705_100778974 196
90 3300025915 Ga0207693_10001208 Ga0207693_1000120811 196
91 3300031235 Ga0265330_10017337 Ga0265330_100173376 196
92 3300031235 Ga0265330_10082321 Ga0265330_100823212 196
93 3300031247 Ga0265340_10012783 Ga0265340_100127834 196
94 3300031247 Ga0265340_10025500 Ga0265340_100255003 196
95 3300031250 Ga0265331_10034832 Ga0265331_100348323 196
96 3300031344 Ga0265316_10001878 Ga0265316_1000187818 196
97 3300031595 Ga0265313_10009062 Ga0265313_100090628 196
98 3300031712 Ga0265342_10008436 Ga0265342_100084363 196
99 3300035172 Ga0373955_0057056 Ga0373955_0057056_1195_1854 196
100 3300035695 Ga0373927_0509543 Ga0373927_0509543_56_715 196
101 3300036401 Ga0373937_0010939 Ga0373937_0010939_5815_6474 196
102 3300037068 Ga0373925_0008834 Ga0373925_0008834_6364_7023 196
103 3300005616 Ga0068852_100356806 Ga0068852_1003568062 197
104 3300009545 Ga0105237_10887435 Ga0105237_108874352 197
105 3300009551 Ga0105238_10188890 Ga0105238_101888903 197
106 3300013105 Ga0157369_10274294 Ga0157369_102742944 197
107 3300021384 Ga0213876_10000342 Ga0213876_1000034210 197
108 3300025913 Ga0207695_10043159 Ga0207695_100431592 197
109 3300025914 Ga0207671_10162452 Ga0207671_101624521 197
110 3300025919 Ga0207657_10341634 Ga0207657_103416342 197
111 3300025924 Ga0207694_10190877 Ga0207694_101908773 197
112 3300025949 Ga0207667_10084426 Ga0207667_100844263 197
113 3300026116 Ga0207674_10445915 Ga0207674_104459152 197
114 3300028577 Ga0265318_10000225 Ga0265318_1000022528 197
115 3300039437 Ga0436365_0173869 Ga0436365_0173869_4681_5316 197
116 3300049569 Ga0501032_0316528 Ga0501032_0316528_93_746 197
117 3300049570 Ga0501033_0268076 Ga0501033_0268076_330_965 197
118 3300049574 Ga0501038_0033605 Ga0501038_0033605_406_1041 197
119 3300049579 Ga0501043_0011178 Ga0501043_0011178_2872_3507 197
120 3300049823 Ga0501044_0565812 Ga0501044_0565812_256_891 197
121 3300053087 Ga0500643_000006 Ga0500643_000006_18602_19270 197
122 3300053090 Ga0500646_0065747 Ga0500646_0065747_322_990 197
123 3300054114 Ga0501084_0006883 Ga0501084_0006883_7660_8295 197
124 3300060353 Ga0501082_0018496 Ga0501082_0018496_659_1294 197
125 3300005366 Ga0070659_100922489 Ga0070659_1009224891 198
126 3300009545 Ga0105237_10736664 Ga0105237_107366641 198
127 3300049573 Ga0501037_0173024 Ga0501037_0173024_589_1242 198
128 3300049822 Ga0501035_0452794 Ga0501035_0452794_127_780 198
129 3300005548 Ga0070665_100058997 Ga0070665_1000589976 200
130 3300005937 Ga0081455_10388606 Ga0081455_103886061 200
131 3300009098 Ga0105245_10761488 Ga0105245_107614882 200
132 3300014325 Ga0163163_10259525 Ga0163163_102595253 200
133 3300025913 Ga0207695_10246917 Ga0207695_102469172 200
134 3300025927 Ga0207687_10366011 Ga0207687_103660113 200
135 3300049581 Ga0501047_0366167 Ga0501047_0366167_404_1048 200
136 3300049584 Ga0501068_0249129 Ga0501068_0249129_28_696 200
137 3300049744 Ga0501083_0041476 Ga0501083_0041476_1911_2579 200
138 3300053140 Ga0500573_0000520 Ga0500573_0000520_4529_5173 200
139 3300054114 Ga0501084_0260872 Ga0501084_0260872_432_1100 200
140 3300060353 Ga0501082_0262254 Ga0501082_0262254_389_1057 200
141 3300013297 Ga0157378_10066780 Ga0157378_100667804 201
142 3300046648 Ga0495611_0059391 Ga0495611_0059391_713_1360 201
143 3300046690 Ga0495624_0398210 Ga0495624_0398210_90_737 201
144 3300049570 Ga0501033_0429829 Ga0501033_0429829_187_849 201
145 3300049574 Ga0501038_0133925 Ga0501038_0133925_1037_1699 201
146 3300049581 Ga0501047_0106078 Ga0501047_0106078_1400_2065 201
147 3300049581 Ga0501047_0522019 Ga0501047_0522019_289_936 201
148 3300049822 Ga0501035_0061682 Ga0501035_0061682_1541_2203 201
149 3300049823 Ga0501044_0191668 Ga0501044_0191668_59_724 201
150 3300049823 Ga0501044_0515795 Ga0501044_0515795_89_751 201
151 3300009176 Ga0105242_10010441 Ga0105242_1001044111 202
152 3300021384 Ga0213876_10021934 Ga0213876_100219343 202
153 3300025934 Ga0207686_10056112 Ga0207686_100561124 202
154 3300039437 Ga0436365_0513265 Ga0436365_0513265_4037_4702 202
155 3300005327 Ga0070658_10354557 Ga0070658_103545572 203
156 3300025909 Ga0207705_10185396 Ga0207705_101853962 203
157 3300047320 Ga0495672_0250853 Ga0495672_0250853_165_833 203
158 3300005458 Ga0070681_10000001 Ga0070681_10000001935 204
159 3300005530 Ga0070679_100004777 Ga0070679_1000047775 204
160 3300005539 Ga0068853_100001272 Ga0068853_1000012729 204
161 3300009093 Ga0105240_10262327 Ga0105240_102623271 204
162 3300009177 Ga0105248_10000001 Ga0105248_10000001566 204
163 3300013297 Ga0157378_10619565 Ga0157378_106195652 204
164 3300025912 Ga0207707_10000001 Ga0207707_10000001614 204
165 3300025913 Ga0207695_10095990 Ga0207695_100959903 204
166 3300025920 Ga0207649_10000109 Ga0207649_1000010920 204
167 3300025921 Ga0207652_10000506 Ga0207652_1000050621 204
168 3300025941 Ga0207711_10000001 Ga0207711_100000011304 204
169 3300026041 Ga0207639_10001814 Ga0207639_1000181413 204
170 3300028800 Ga0265338_10000006 Ga0265338_10000006165 204
171 3300031238 Ga0265332_10084134 Ga0265332_100841342 204
172 3300031241 Ga0265325_10000007 Ga0265325_10000007165 204
173 3300031249 Ga0265339_10005068 Ga0265339_1000506812 204
174 3300031250 Ga0265331_10000002 Ga0265331_10000002343 204
175 3300031250 Ga0265331_10000668 Ga0265331_100006686 204
176 3300031250 Ga0265331_10015098 Ga0265331_100150984 204
177 3300031251 Ga0265327_10000052 Ga0265327_1000005254 204
178 3300031595 Ga0265313_10015252 Ga0265313_100152524 204
179 3300031595 Ga0265313_10174319 Ga0265313_101743191 204
180 3300031711 Ga0265314_10065712 Ga0265314_100657122 204
181 3300031711 Ga0265314_10068688 Ga0265314_100686883 204
182 3300039450 Ga0436363_1442548 Ga0436363_1442548_2384_3040 204
183 3300046516 Ga0495628_0261444 Ga0495628_0261444_47_703 204
184 3300046529 Ga0495652_0158315 Ga0495652_0158315_418_1074 204
185 3300049570 Ga0501033_0030362 Ga0501033_0030362_40_696 204
186 3300049574 Ga0501038_0081669 Ga0501038_0081669_455_1111 204
187 3300049579 Ga0501043_0184381 Ga0501043_0184381_96_752 204
188 3300049581 Ga0501047_0197956 Ga0501047_0197956_425_1081 204
189 3300049583 Ga0501067_0311861 Ga0501067_0311861_22_678 204
190 3300049586 Ga0501070_0044749 Ga0501070_0044749_2979_3635 204
191 3300049586 Ga0501070_0111922 Ga0501070_0111922_1474_2130 204
192 3300049742 Ga0501080_0284895 Ga0501080_0284895_248_904 204
193 3300049822 Ga0501035_0039161 Ga0501035_0039161_191_847 204
194 3300049823 Ga0501044_0120076 Ga0501044_0120076_244_900 204
195 3300060353 Ga0501082_0266987 Ga0501082_0266987_564_1220 204
196 3300025929 Ga0207664_10749154 Ga0207664_107491542 206
197 3300031241 Ga0265325_10002832 Ga0265325_1000283211 206
198 3300031242 Ga0265329_10033977 Ga0265329_100339772 206
199 3300031249 Ga0265339_10019623 Ga0265339_100196236 206
200 3300031344 Ga0265316_10356988 Ga0265316_103569882 206
201 3300031595 Ga0265313_10001337 Ga0265313_1000133715 206
202 3300031711 Ga0265314_10019054 Ga0265314_100190542 206
203 3300046543 Ga0495645_0273000 Ga0495645_0273000_331_993 206
204 3300005336 Ga0070680_100124973 Ga0070680_1001249734 207
205 3300005458 Ga0070681_10121845 Ga0070681_101218452 207
206 3300005530 Ga0070679_100013355 Ga0070679_10001335510 207
207 3300013105 Ga0157369_10229319 Ga0157369_102293193 207
208 3300025909 Ga0207705_10525281 Ga0207705_105252811 207
209 3300025912 Ga0207707_10079656 Ga0207707_100796564 207
210 3300025915 Ga0207693_10128716 Ga0207693_101287162 207
211 3300025917 Ga0207660_10094610 Ga0207660_100946102 207
212 3300025921 Ga0207652_10045043 Ga0207652_100450433 207
213 3300026078 Ga0207702_11081720 Ga0207702_110817201 207
214 3300028800 Ga0265338_10176296 Ga0265338_101762962 207
215 3300028800 Ga0265338_10577858 Ga0265338_105778581 207
216 3300031235 Ga0265330_10067055 Ga0265330_100670552 207
217 3300031250 Ga0265331_10024809 Ga0265331_100248094 207
218 3300031344 Ga0265316_10083380 Ga0265316_100833804 207
219 3300031711 Ga0265314_10000193 Ga0265314_1000019364 207
220 3300031712 Ga0265342_10059340 Ga0265342_100593402 207
221 3300031712 Ga0265342_10071637 Ga0265342_100716372 207
222 3300046516 Ga0495628_0352495 Ga0495628_0352495_401_1069 207
223 3300046536 Ga0495587_0112741 Ga0495587_0112741_870_1538 207
224 3300048088 Ga0495602_0048721 Ga0495602_0048721_1305_1973 207
225 3300049570 Ga0501033_0001777 Ga0501033_0001777_8606_9271 207
226 3300049570 Ga0501033_0066804 Ga0501033_0066804_327_995 207
227 3300049570 Ga0501033_0343864 Ga0501033_0343864_186_851 207
228 3300049571 Ga0501034_0200676 Ga0501034_0200676_595_1260 207
229 3300049571 Ga0501034_0228576 Ga0501034_0228576_1047_1712 207
230 3300049572 Ga0501036_0248734 Ga0501036_0248734_274_939 207
231 3300049574 Ga0501038_0311052 Ga0501038_0311052_145_810 207
232 3300049580 Ga0501046_0061575 Ga0501046_0061575_522_1187 207
233 3300049581 Ga0501047_0002100 Ga0501047_0002100_5740_6405 207
234 3300049822 Ga0501035_0011938 Ga0501035_0011938_5546_6211 207
235 3300049823 Ga0501044_0053359 Ga0501044_0053359_2819_3484 207
236 3300049823 Ga0501044_0247646 Ga0501044_0247646_671_1336 207
237 3300003215 JGI25153J46596_10000496 JGI25153J46596_1000049620 208
238 3300003322 rootL2_10246191 rootL2_102461911 208
239 3300005327 Ga0070658_10354265 Ga0070658_103542652 208
240 3300005327 Ga0070658_10576299 Ga0070658_105762991 208
241 3300005328 Ga0070676_10035035 Ga0070676_100350353 208
242 3300005328 Ga0070676_10276518 Ga0070676_102765182 208
243 3300005334 Ga0068869_100019761 Ga0068869_1000197615 208
244 3300005334 Ga0068869_100112368 Ga0068869_1001123683 208
245 3300005335 Ga0070666_10081711 Ga0070666_100817112 208
246 3300005338 Ga0068868_100043658 Ga0068868_1000436584 208
247 3300005347 Ga0070668_100338898 Ga0070668_1003388982 208
248 3300005367 Ga0070667_100132586 Ga0070667_1001325862 208
249 3300005367 Ga0070667_100356749 Ga0070667_1003567491 208
250 3300005441 Ga0070700_100448698 Ga0070700_1004486981 208
251 3300005455 Ga0070663_100397922 Ga0070663_1003979221 208
252 3300005456 Ga0070678_100022274 Ga0070678_1000222748 208
253 3300005456 Ga0070678_100356827 Ga0070678_1003568271 208
254 3300005459 Ga0068867_100013659 Ga0068867_1000136592 208
255 3300005459 Ga0068867_100044583 Ga0068867_1000445834 208
256 3300005530 Ga0070679_100070023 Ga0070679_1000700234 208
257 3300005539 Ga0068853_100375559 Ga0068853_1003755592 208
258 3300005548 Ga0070665_100024687 Ga0070665_1000246873 208
259 3300005548 Ga0070665_100060257 Ga0070665_1000602575 208
260 3300005548 Ga0070665_100150680 Ga0070665_1001506805 208
261 3300005614 Ga0068856_100175276 Ga0068856_1001752761 208
262 3300005617 Ga0068859_100716315 Ga0068859_1007163152 208
263 3300005718 Ga0068866_10209766 Ga0068866_102097662 208
264 3300005840 Ga0068870_10051655 Ga0068870_100516551 208
265 3300005841 Ga0068863_100358328 Ga0068863_1003583282 208
266 3300005842 Ga0068858_100032901 Ga0068858_1000329018 208
267 3300005842 Ga0068858_100124873 Ga0068858_1001248734 208
268 3300005843 Ga0068860_100235877 Ga0068860_1002358771 208
269 3300005844 Ga0068862_100277397 Ga0068862_1002773972 208
270 3300006237 Ga0097621_100000164 Ga0097621_10000016421 208
271 3300006237 Ga0097621_100209755 Ga0097621_1002097552 208
272 3300006237 Ga0097621_100212192 Ga0097621_1002121922 208
273 3300006237 Ga0097621_100601752 Ga0097621_1006017522 208
274 3300006358 Ga0068871_100000453 Ga0068871_1000004537 208
275 3300006358 Ga0068871_100106221 Ga0068871_1001062214 208
276 3300006358 Ga0068871_100216337 Ga0068871_1002163373 208
277 3300006358 Ga0068871_100400046 Ga0068871_1004000462 208
278 3300006931 Ga0097620_100716328 Ga0097620_1007163282 208
279 3300009093 Ga0105240_10021716 Ga0105240_1002171612 208
280 3300009093 Ga0105240_11028891 Ga0105240_110288912 208
281 3300009101 Ga0105247_10227389 Ga0105247_102273892 208
282 3300009148 Ga0105243_10001795 Ga0105243_100017957 208
283 3300009176 Ga0105242_10262217 Ga0105242_102622172 208
284 3300009176 Ga0105242_10288862 Ga0105242_102888622 208
285 3300009176 Ga0105242_10454457 Ga0105242_104544572 208
286 3300009176 Ga0105242_10879588 Ga0105242_108795882 208
287 3300009177 Ga0105248_10295503 Ga0105248_102955032 208
288 3300009177 Ga0105248_10338067 Ga0105248_103380672 208
289 3300009545 Ga0105237_10547881 Ga0105237_105478811 208
290 3300009551 Ga0105238_10500307 Ga0105238_105003072 208
291 3300009551 Ga0105238_10557764 Ga0105238_105577642 208
292 3300009553 Ga0105249_10328763 Ga0105249_103287632 208
293 3300010375 Ga0105239_10168400 Ga0105239_101684002 208
294 3300010375 Ga0105239_10610352 Ga0105239_106103522 208
295 3300010375 Ga0105239_10675861 Ga0105239_106758612 208
296 3300010375 Ga0105239_10925232 Ga0105239_109252322 208
297 3300010375 Ga0105239_10932938 Ga0105239_109329382 208
298 3300011119 Ga0105246_10088661 Ga0105246_100886612 208
299 3300013296 Ga0157374_10060280 Ga0157374_100602802 208
300 3300013296 Ga0157374_10657980 Ga0157374_106579802 208
301 3300013297 Ga0157378_10047842 Ga0157378_100478423 208
302 3300013297 Ga0157378_10163614 Ga0157378_101636143 208
303 3300013297 Ga0157378_10246637 Ga0157378_102466372 208
304 3300013297 Ga0157378_10294444 Ga0157378_102944442 208
305 3300013306 Ga0163162_10017352 Ga0163162_100173522 208
306 3300013306 Ga0163162_10061210 Ga0163162_100612104 208
307 3300013306 Ga0163162_10291578 Ga0163162_102915783 208
308 3300013306 Ga0163162_10298466 Ga0163162_102984662 208
309 3300013308 Ga0157375_11278949 Ga0157375_112789492 208
310 3300014325 Ga0163163_10000252 Ga0163163_1000025231 208
311 3300014325 Ga0163163_10140766 Ga0163163_101407664 208
312 3300014325 Ga0163163_10239287 Ga0163163_102392874 208
313 3300014326 Ga0157380_10430367 Ga0157380_104303672 208
314 3300014968 Ga0157379_10043324 Ga0157379_100433242 208
315 3300014968 Ga0157379_10157836 Ga0157379_101578362 208
316 3300014968 Ga0157379_10523440 Ga0157379_105234402 208
317 3300014969 Ga0157376_10128874 Ga0157376_101288744 208
318 3300017792 Ga0163161_10031127 Ga0163161_100311273 208
319 3300017792 Ga0163161_10298238 Ga0163161_102982382 208
320 3300025272 Ga0209455_1002914 Ga0209455_10029147 208
321 3300025297 Ga0209758_1000008 Ga0209758_10000081000 208
322 3300025899 Ga0207642_10195784 Ga0207642_101957842 208
323 3300025903 Ga0207680_10109170 Ga0207680_101091702 208
324 3300025907 Ga0207645_10035039 Ga0207645_100350393 208
325 3300025907 Ga0207645_10120810 Ga0207645_101208102 208
326 3300025908 Ga0207643_10490889 Ga0207643_104908891 208
327 3300025909 Ga0207705_10118213 Ga0207705_101182132 208
328 3300025909 Ga0207705_10532188 Ga0207705_105321882 208
329 3300025911 Ga0207654_10152098 Ga0207654_101520982 208
330 3300025911 Ga0207654_10164154 Ga0207654_101641542 208
331 3300025916 Ga0207663_10122453 Ga0207663_101224534 208
332 3300025919 Ga0207657_10269741 Ga0207657_102697412 208
333 3300025919 Ga0207657_10728144 Ga0207657_107281442 208
334 3300025921 Ga0207652_10453231 Ga0207652_104532312 208
335 3300025926 Ga0207659_10316190 Ga0207659_103161902 208
336 3300025934 Ga0207686_10043721 Ga0207686_100437214 208
337 3300025935 Ga0207709_10068497 Ga0207709_100684973 208
338 3300025940 Ga0207691_10195761 Ga0207691_101957613 208
339 3300025941 Ga0207711_10143514 Ga0207711_101435142 208
340 3300025941 Ga0207711_10372863 Ga0207711_103728632 208
341 3300025942 Ga0207689_10031599 Ga0207689_100315994 208
342 3300025986 Ga0207658_10163264 Ga0207658_101632644 208
343 3300026035 Ga0207703_10250067 Ga0207703_102500672 208
344 3300026035 Ga0207703_11204168 Ga0207703_112041681 208
345 3300026041 Ga0207639_10905598 Ga0207639_109055982 208
346 3300026067 Ga0207678_10699647 Ga0207678_106996472 208
347 3300026075 Ga0207708_10459511 Ga0207708_104595112 208
348 3300026078 Ga0207702_10224187 Ga0207702_102241873 208
349 3300026088 Ga0207641_10159909 Ga0207641_101599094 208
350 3300026089 Ga0207648_10011967 Ga0207648_100119672 208
351 3300026089 Ga0207648_10046179 Ga0207648_100461793 208
352 3300026089 Ga0207648_10209992 Ga0207648_102099923 208
353 3300026116 Ga0207674_10123708 Ga0207674_101237082 208
354 3300026118 Ga0207675_100048360 Ga0207675_1000483605 208
355 3300026121 Ga0207683_10054645 Ga0207683_100546452 208
356 3300026142 Ga0207698_10107435 Ga0207698_101074354 208
357 3300028379 Ga0268266_10088516 Ga0268266_100885163 208
358 3300028379 Ga0268266_10342132 Ga0268266_103421322 208
359 3300028379 Ga0268266_11040234 Ga0268266_110402341 208
360 3300028381 Ga0268264_10350666 Ga0268264_103506662 208
361 3300028381 Ga0268264_10620777 Ga0268264_106207772 208
362 3300028786 Ga0307517_10216287 Ga0307517_102162872 208
363 3300031456 Ga0307513_10326384 Ga0307513_103263841 208
364 3300031730 Ga0307516_10038357 Ga0307516_100383577 208
365 3300046538 Ga0495609_0099998 Ga0495609_0099998_153_821 208
366 3300046557 Ga0495622_0001870 Ga0495622_0001870_938_1621 208
367 3300048924 Ga0496121_0005062 Ga0496121_0005062_13170_13838 208
368 3300049568 Ga0501031_0002282 Ga0501031_0002282_4472_5140 208
369 3300049569 Ga0501032_0017960 Ga0501032_0017960_198_866 208
370 3300049569 Ga0501032_0166158 Ga0501032_0166158_32_700 208
371 3300049570 Ga0501033_0004123 Ga0501033_0004123_5239_5907 208
372 3300049571 Ga0501034_0010501 Ga0501034_0010501_5179_5847 208
373 3300049571 Ga0501034_0115738 Ga0501034_0115738_1788_2456 208
374 3300049571 Ga0501034_0144047 Ga0501034_0144047_896_1564 208
375 3300049571 Ga0501034_0211264 Ga0501034_0211264_142_810 208
376 3300049572 Ga0501036_0161885 Ga0501036_0161885_709_1377 208
377 3300049573 Ga0501037_0010179 Ga0501037_0010179_1442_2110 208
378 3300049574 Ga0501038_0029191 Ga0501038_0029191_366_1034 208
379 3300049575 Ga0501039_0011053 Ga0501039_0011053_2122_2790 208
380 3300049578 Ga0501042_0046021 Ga0501042_0046021_900_1568 208
381 3300049579 Ga0501043_0025232 Ga0501043_0025232_198_866 208
382 3300049580 Ga0501046_0002140 Ga0501046_0002140_13241_13909 208
383 3300049581 Ga0501047_0028007 Ga0501047_0028007_1371_2039 208
384 3300049581 Ga0501047_0062805 Ga0501047_0062805_1127_1795 208
385 3300049581 Ga0501047_0328744 Ga0501047_0328744_259_927 208
386 3300049582 Ga0501048_0005388 Ga0501048_0005388_4965_5633 208
387 3300049583 Ga0501067_0004375 Ga0501067_0004375_6919_7587 208
388 3300049584 Ga0501068_0015874 Ga0501068_0015874_3200_3868 208
389 3300049585 Ga0501069_0003031 Ga0501069_0003031_6460_7128 208
390 3300049586 Ga0501070_0013975 Ga0501070_0013975_913_1581 208
391 3300049588 Ga0501072_0039852 Ga0501072_0039852_207_875 208
392 3300049589 Ga0501073_0127948 Ga0501073_0127948_511_1179 208
393 3300049590 Ga0501074_0000320 Ga0501074_0000320_23288_23956 208
394 3300049741 Ga0501079_0001127 Ga0501079_0001127_12992_13660 208
395 3300049742 Ga0501080_0170921 Ga0501080_0170921_198_866 208
396 3300049742 Ga0501080_0175861 Ga0501080_0175861_301_969 208
397 3300049744 Ga0501083_0000466 Ga0501083_0000466_3140_3808 208
398 3300049823 Ga0501044_0324668 Ga0501044_0324668_780_1448 208
399 3300049823 Ga0501044_0330354 Ga0501044_0330354_198_866 208
400 3300053119 Ga0500595_001244 Ga0500595_001244_12321_13004 208
401 3300053119 Ga0500595_009546 Ga0500595_009546_665_1348 208
402 3300053120 Ga0500597_189358 Ga0500597_189358_97_765 208
403 3300053136 Ga0500559_0106516 Ga0500559_0106516_306_989 208
404 3300054114 Ga0501084_0003150 Ga0501084_0003150_211_879 208
405 3300060353 Ga0501082_0003591 Ga0501082_0003591_6631_7299 208

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03379

CcmB

CcmB protein

9

223

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7f02-assembly1.cif.gz_F cytochrome c-type biogenesis protein ccmabcd from e. coli 0.9175 2 204
8ce1-assembly1.cif.gz_B cytochrome c maturation complex ccmabcd 0.9011 4 204
7f02-assembly1.cif.gz_F cytochrome c-type biogenesis protein ccmabcd from e. coli 0.8927 2 204
7vfj-assembly1.cif.gz_B cytochrome c-type biogenesis protein ccmabcd 0.8784 2 206
8ce1-assembly1.cif.gz_B cytochrome c maturation complex ccmabcd 0.8687 4 204
ID Description Score Start End Superfamily
af_Q2G1V6_3_205_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.5473 4 203 1.10.3720.10
5d57D00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5427 83 176 1.10.287.3610
af_Q2G1V6_3_205_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.5349 4 203 1.10.3720.10
4brbD00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5029 83 176 1.10.287.3610
5d57D00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.4869 83 176 1.10.287.3610
ID Description Score Start End GO Terms
AF-A0A7W0RUS9-F1-model_v4 Heme exporter protein CcmB 0.9665 80 206 GO:0005886
GO:0015232
GO:0017004
GO:1903607
AF-A0A1J5QPM8-F1-model_v4 Heme exporter protein B 0.9613 42 206 GO:0005886
GO:0015232
GO:0017004
GO:1903607
AF-A0A645IA25-F1-model_v4 Heme exporter protein B 0.9608 81 206 GO:0005886
GO:0015232
GO:0017004
GO:1903607
AF-A0A655V7R0-F1-model_v4 Heme exporter protein B (Cytochrome c-type biogenesis protein CcmB) 0.9575 53 206 GO:0005886
GO:0015232
GO:0017004
GO:1903607
AF-V7EN13-F1-model_v4 Heme exporter protein B 0.957 54 206 GO:0005886
GO:0015232
GO:0017004
GO:1903607

Feature Viewer

pLDDT pTM Quality
80.99 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map