F435893

General Info

Members Datasets Scaffolds Average Seq Length
405 211 810 320

Family's Representative Sequence

Representative Sequence 3300005549|Ga0070704_100039939|Ga0070704_1000399392
Length 372
Sequence VAVVFLDAVKEGYFTPAANGRKAAYTQTARRGGRRDGSAMVEGHRRQVLIVAGAFLAPRIVFAQVLKRKRRIGFLSVDTANSGTGEHIRKTFPAELEKLGYQQGANLEIEWRWADANPGRLPALAADLVHLQVDLIVARTTDPIVAAKKATQSIPIVMMNANFPVELGLVQSLARPDANVTGTSYISSETLGKGLQLLKEIAPSVRRVAVPIGRTSGATRIEQLILDSLTRAGGTLGMAIQHFPVPRLEDLPAALERIAASDADSLFYLGDPVLRSRQEDIATFVRARKLPAVASVFSFADQGGLAEYFADPSEWLQTTARFVDRILKGARPADLPVQQPSKFLLTINLKTAKAIGLTIPASILVRVDRVIE

Samples

Sample ID Description Type Environment
1 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
123 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
125 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
126 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
127 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
131 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
132 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
133 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
134 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
139 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
140 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
141 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
142 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
145 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
146 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
147 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
148 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
149 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
150 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
151 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
152 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
153 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
154 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
157 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
158 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
159 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
160 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
183 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
184 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
185 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
186 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
192 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
193 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
197 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
201 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
202 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
203 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
204 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
205 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
206 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
207 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
208 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
209 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
210 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
211 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.01
Metatranscriptomes 0
Isolates 0.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.99
Nodule 0.99
Rhizoplane 3.7
Rhizosphere 94.32
Stem 0
Stem Tuber 0
Unclassified 12.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070704_100039939 3300005549 Bacteria 3225
2 Ga0065712_10000663 3300005290 Bacteria 9864
3 Ga0065715_10011425 3300005293 Unclassified 2084
4 Ga0065707_10233635 3300005295 Bacteria 1180
5 Ga0070683_100309497 3300005329 Bacteria 1503
6 Ga0070670_100001548 3300005331 Bacteria 18546
7 Ga0070670_100003928 3300005331 Bacteria 12396
8 Ga0070670_100004009 3300005331 Bacteria 12288
9 Ga0070670_100005925 3300005331 Bacteria 10336
10 Ga0070670_100057350 3300005331 Unclassified 3343
11 Ga0070670_100264025 3300005331 Bacteria 1501
12 Ga0070670_100285064 3300005331 Unclassified 1442
13 Ga0070677_10070733 3300005333 Bacteria 1467
14 Ga0068869_100006797 3300005334 Bacteria 7272
15 Ga0070666_10173815 3300005335 Bacteria 1509
16 Ga0070661_100298228 3300005344 Bacteria 1254
17 Ga0070668_100016985 3300005347 Bacteria 5443
18 Ga0070668_100047919 3300005347 Bacteria 3286
19 Ga0070669_100053381 3300005353 Unclassified 2958
20 Ga0070669_100058052 3300005353 Bacteria 2840
21 Ga0070669_100323289 3300005353 Bacteria 1246
22 Ga0070675_100151238 3300005354 Unclassified 1990
23 Ga0070671_100006889 3300005355 Bacteria 9103
24 Ga0070671_100018531 3300005355 Bacteria 5655
25 Ga0070671_100029192 3300005355 Bacteria 4548
26 Ga0070671_100048320 3300005355 Bacteria 3538
27 Ga0070671_100251483 3300005355 Bacteria 1501
28 Ga0070674_100036191 3300005356 Bacteria 3311
29 Ga0070674_100220226 3300005356 Bacteria 1476
30 Ga0070673_100100240 3300005364 Bacteria 2384
31 Ga0070673_100192364 3300005364 Unclassified 1753
32 Ga0070659_100340343 3300005366 Bacteria 1257
33 Ga0070667_100020434 3300005367 Bacteria 5497
34 Ga0070667_100385290 3300005367 Bacteria 1274
35 Ga0070667_100394380 3300005367 Bacteria 1259
36 Ga0070705_100109111 3300005440 Bacteria 1764
37 Ga0070708_100000135 3300005445 Bacteria 50646
38 Ga0070708_100145693 3300005445 Bacteria 2199
39 Ga0070708_100210361 3300005445 Bacteria 1822
40 Ga0070708_100397843 3300005445 Unclassified 1299
41 Ga0070678_100256896 3300005456 Bacteria 1467
42 Ga0070662_100031406 3300005457 Bacteria 3727
43 Ga0070662_100040382 3300005457 Bacteria 3321
44 Ga0070662_100280036 3300005457 Bacteria 1349
45 Ga0068867_100020150 3300005459 Bacteria 4751
46 Ga0068867_100020774 3300005459 Bacteria 4681
47 Ga0068867_100334828 3300005459 Bacteria 1258
48 Ga0070706_100005039 3300005467 Bacteria 12628
49 Ga0070706_100089172 3300005467 Bacteria 2859
50 Ga0070706_100223581 3300005467 Bacteria 1757
51 Ga0070707_100189442 3300005468 Bacteria 2005
52 Ga0070707_100306890 3300005468 Bacteria 1542
53 Ga0070698_100054305 3300005471 Bacteria 4067
54 Ga0070698_100056502 3300005471 Bacteria 3977
55 Ga0070698_100210545 3300005471 Bacteria 1879
56 Ga0070698_100343606 3300005471 Bacteria 1424
57 Ga0070699_100055378 3300005518 Bacteria 3434
58 Ga0070699_100135002 3300005518 Bacteria 2177
59 Ga0070699_100316084 3300005518 Unclassified 1403
60 Ga0070697_100016073 3300005536 Bacteria 5884
61 Ga0070697_100018977 3300005536 Bacteria 5426
62 Ga0070697_100091094 3300005536 Bacteria 2521
63 Ga0070672_100010360 3300005543 Bacteria 6464
64 Ga0070672_100018481 3300005543 Bacteria 5040
65 Ga0070672_100026642 3300005543 Bacteria 4305
66 Ga0070672_100043065 3300005543 Bacteria 3479
67 Ga0070696_100171103 3300005546 Bacteria 1606
68 Ga0070704_100095677 3300005549 Unclassified 2225
69 Ga0070704_100251556 3300005549 Bacteria 1451
70 Ga0068855_100018555 3300005563 Bacteria 8364
71 Ga0070664_100217319 3300005564 Bacteria 1709
72 Ga0068857_100016954 3300005577 Bacteria 6383
73 Ga0068852_100286331 3300005616 Bacteria 1590
74 Ga0068859_100086582 3300005617 Unclassified 3180
75 Ga0068864_100008471 3300005618 Bacteria 8487
76 Ga0068864_100020865 3300005618 Bacteria 5484
77 Ga0068864_100045825 3300005618 Unclassified 3751
78 Ga0068864_100048908 3300005618 Bacteria 3636
79 Ga0068864_100063446 3300005618 Bacteria 3202
80 Ga0068861_100016309 3300005719 Bacteria 5254
81 Ga0068861_100165355 3300005719 Bacteria 1829
82 Ga0068851_10061071 3300005834 Bacteria 1931
83 Ga0068870_10147646 3300005840 Bacteria 1382
84 Ga0068863_100001574 3300005841 Bacteria 22566
85 Ga0068863_100002104 3300005841 Bacteria 19733
86 Ga0068863_100011783 3300005841 Bacteria 8451
87 Ga0068863_100030724 3300005841 Bacteria 5129
88 Ga0068863_100050089 3300005841 Bacteria 3961
89 Ga0068863_100145710 3300005841 Bacteria 2265
90 Ga0068863_100201494 3300005841 Bacteria 1915
91 Ga0068863_100263994 3300005841 Bacteria 1665
92 Ga0068863_100352961 3300005841 Unclassified 1432
93 Ga0068858_100026262 3300005842 Bacteria 5413
94 Ga0068858_100225650 3300005842 Bacteria 1775
95 Ga0068858_100409796 3300005842 Bacteria 1303
96 Ga0068860_100125077 3300005843 Bacteria 2464
97 Ga0068862_100080812 3300005844 Bacteria 2819
98 Ga0081455_10005062 3300005937 Bacteria 14551
99 Ga0081455_10248722 3300005937 Bacteria 1302
100 Ga0081538_10018428 3300005981 Bacteria 5242
101 Ga0081540_1098431 3300005983 Bacteria 1266
102 Ga0075365_10090453 3300006038 Bacteria 2084
103 Ga0075366_10002865 3300006195 Bacteria 8942
104 Ga0097621_100061658 3300006237 Bacteria 3076
105 Ga0097621_100304453 3300006237 Bacteria 1408
106 Ga0068871_100021641 3300006358 Bacteria 4946
107 Ga0075428_100139083 3300006844 Bacteria 2639
108 Ga0075428_100148511 3300006844 Bacteria 2547
109 Ga0075428_100280145 3300006844 Bacteria 1794
110 Ga0075428_100504905 3300006844 Unclassified 1294
111 Ga0075428_100507241 3300006844 Unclassified 1290
112 Ga0075430_100154380 3300006846 Bacteria 1911
113 Ga0075430_100285165 3300006846 Bacteria 1366
114 Ga0075431_100150364 3300006847 Bacteria 2398
115 Ga0075433_10031383 3300006852 Unclassified 4541
116 Ga0075434_100061387 3300006871 Bacteria 3739
117 Ga0075434_100197158 3300006871 Bacteria 2033
118 Ga0075429_100015522 3300006880 Bacteria 6599
119 Ga0068865_100011504 3300006881 Bacteria 5544
120 Ga0068865_100051611 3300006881 Bacteria 2848
121 Ga0068865_100160969 3300006881 Bacteria 1712
122 Ga0075436_100015672 3300006914 Bacteria 5189
123 Ga0075436_100043412 3300006914 Unclassified 3100
124 Ga0075436_100079872 3300006914 Bacteria 2266
125 Ga0097620_100086586 3300006931 Unclassified 3180
126 Ga0075435_100011918 3300007076 Bacteria 6421
127 Ga0075435_100076762 3300007076 Bacteria 2738
128 Ga0075435_100115493 3300007076 Bacteria 2235
129 Ga0075435_100249921 3300007076 Unclassified 1509
130 Ga0099794_10009064 3300007265 Bacteria 4159
131 Ga0099794_10014737 3300007265 Unclassified 3432
132 Ga0111539_10432066 3300009094 Bacteria 1533
133 Ga0105247_10060543 3300009101 Unclassified 2346
134 Ga0114129_10032052 3300009147 Bacteria 7429
135 Ga0114129_10060854 3300009147 Bacteria 5279
136 Ga0114129_10176609 3300009147 Bacteria 2909
137 Ga0114129_10252185 3300009147 Archaea 2368
138 Ga0114129_10309882 3300009147 Bacteria 2101
139 Ga0114129_10379550 3300009147 Bacteria 1867
140 Ga0114129_10410635 3300009147 Unclassified 1783
141 Ga0114129_10679539 3300009147 Unclassified 1326
142 Ga0114129_10921335 3300009147 Unclassified 1106
143 Ga0105243_10099768 3300009148 Bacteria 2408
144 Ga0105243_10405316 3300009148 Bacteria 1268
145 Ga0105242_10321963 3300009176 Bacteria 1418
146 Ga0105242_10341413 3300009176 Bacteria 1380
147 Ga0105248_10001100 3300009177 Bacteria 29922
148 Ga0105248_10013286 3300009177 Bacteria 9065
149 Ga0105248_10024130 3300009177 Bacteria 6759
150 Ga0105237_10055585 3300009545 Bacteria 3964
151 Ga0105249_10023824 3300009553 Bacteria 5498
152 Ga0105249_10343183 3300009553 Bacteria 1511
153 Ga0105246_10427722 3300011119 Bacteria 1107
154 Ga0157374_10037458 3300013296 Bacteria 4451
155 Ga0157374_10104021 3300013296 Bacteria 2725
156 Ga0157374_10163175 3300013296 Bacteria 2171
157 Ga0157378_10019077 3300013297 Bacteria 6025
158 Ga0157378_10218933 3300013297 Bacteria 1809
159 Ga0163162_10020095 3300013306 Bacteria 6557
160 Ga0163162_10065725 3300013306 Bacteria 3675
161 Ga0163162_10101810 3300013306 Bacteria 2965
162 Ga0163162_10103334 3300013306 Bacteria 2943
163 Ga0163162_10236118 3300013306 Bacteria 1959
164 Ga0163162_10388433 3300013306 Bacteria 1529
165 Ga0157375_10043344 3300013308 Bacteria 4363
166 Ga0157375_10081870 3300013308 Unclassified 3269
167 Ga0157375_10171639 3300013308 Bacteria 2316
168 Ga0157375_10174442 3300013308 Unclassified 2299
169 Ga0157375_10178550 3300013308 Bacteria 2274
170 Ga0163163_10009637 3300014325 Bacteria 8638
171 Ga0163163_10061986 3300014325 Bacteria 3705
172 Ga0163163_10092944 3300014325 Unclassified 3032
173 Ga0163163_10167625 3300014325 Bacteria 2243
174 Ga0163163_10170238 3300014325 Bacteria 2225
175 Ga0157380_10544494 3300014326 Bacteria 1137
176 Ga0157379_10002838 3300014968 Bacteria 14609
177 Ga0157379_10154124 3300014968 Bacteria 2072
178 Ga0157379_10455991 3300014968 Bacteria 1181
179 Ga0157376_10029093 3300014969 Bacteria 4399
180 Ga0157376_10035334 3300014969 Bacteria 4042
181 Ga0163161_10095906 3300017792 Bacteria 2201
182 Ga0163161_10144847 3300017792 Bacteria 1801
183 Ga0207682_10060964 3300025893 Bacteria 1579
184 Ga0207710_10016568 3300025900 Bacteria 3119
185 Ga0207680_10144643 3300025903 Bacteria 1579
186 Ga0207699_10145401 3300025906 Unclassified 1562
187 Ga0207643_10062320 3300025908 Bacteria 2131
188 Ga0207684_10001349 3300025910 Bacteria 26905
189 Ga0207684_10014179 3300025910 Bacteria 6880
190 Ga0207684_10043546 3300025910 Bacteria 3806
191 Ga0207684_10062338 3300025910 Bacteria 3166
192 Ga0207684_10063847 3300025910 Bacteria 3126
193 Ga0207662_10226652 3300025918 Unclassified 1219
194 Ga0207649_10144080 3300025920 Bacteria 1634
195 Ga0207646_10035354 3300025922 Bacteria 4512
196 Ga0207646_10053062 3300025922 Bacteria 3627
197 Ga0207646_10128096 3300025922 Bacteria 2283
198 Ga0207681_10256571 3300025923 Bacteria 1367
199 Ga0207650_10007232 3300025925 Bacteria 7562
200 Ga0207650_10014793 3300025925 Bacteria 5425
201 Ga0207650_10017673 3300025925 Bacteria 4995
202 Ga0207650_10038986 3300025925 Bacteria 3472
203 Ga0207650_10096915 3300025925 Unclassified 2263
204 Ga0207659_10004832 3300025926 Bacteria 8168
205 Ga0207644_10019175 3300025931 Bacteria 4637
206 Ga0207644_10036179 3300025931 Bacteria 3464
207 Ga0207644_10085959 3300025931 Bacteria 2334
208 Ga0207706_10042034 3300025933 Bacteria 4050
209 Ga0207706_10191561 3300025933 Bacteria 1795
210 Ga0207669_10141146 3300025937 Bacteria 1672
211 Ga0207704_10065862 3300025938 Unclassified 2270
212 Ga0207665_10001063 3300025939 Bacteria 18496
213 Ga0207691_10013368 3300025940 Bacteria 7860
214 Ga0207691_10026414 3300025940 Bacteria 5447
215 Ga0207691_10028280 3300025940 Bacteria 5251
216 Ga0207691_10122003 3300025940 Bacteria 2308
217 Ga0207691_10126047 3300025940 Bacteria 2266
218 Ga0207711_10016119 3300025941 Bacteria 6203
219 Ga0207711_10020792 3300025941 Bacteria 5477
220 Ga0207711_10055348 3300025941 Bacteria 3406
221 Ga0207711_10055669 3300025941 Bacteria 3396
222 Ga0207679_10066329 3300025945 Bacteria 2704
223 Ga0207667_10026565 3300025949 Bacteria 6320
224 Ga0207651_10116050 3300025960 Bacteria 2020
225 Ga0207651_10219676 3300025960 Unclassified 1535
226 Ga0207651_10285925 3300025960 Bacteria 1365
227 Ga0207712_10073035 3300025961 Unclassified 2472
228 Ga0207712_10148639 3300025961 Bacteria 1807
229 Ga0207668_10017160 3300025972 Bacteria 4531
230 Ga0207668_10032190 3300025972 Bacteria 3462
231 Ga0207668_10202311 3300025972 Bacteria 1582
232 Ga0207658_10198376 3300025986 Bacteria 1674
233 Ga0207703_10001964 3300026035 Bacteria 18166
234 Ga0207703_10095507 3300026035 Bacteria 2508
235 Ga0207678_10264148 3300026067 Bacteria 1475
236 Ga0207641_10004233 3300026088 Bacteria 12513
237 Ga0207641_10005023 3300026088 Bacteria 11339
238 Ga0207641_10043181 3300026088 Unclassified 3785
239 Ga0207641_10088241 3300026088 Bacteria 2708
240 Ga0207648_10004018 3300026089 Bacteria 15269
241 Ga0207648_10071559 3300026089 Bacteria 3022
242 Ga0207676_10003041 3300026095 Bacteria 11976
243 Ga0207676_10012711 3300026095 Bacteria 6039
244 Ga0207676_10023911 3300026095 Bacteria 4515
245 Ga0207676_10174632 3300026095 Bacteria 1875
246 Ga0207674_10020899 3300026116 Bacteria 7064
247 Ga0207674_10207588 3300026116 Bacteria 1908
248 Ga0207675_100104437 3300026118 Unclassified 2670
249 Ga0207675_100214657 3300026118 Bacteria 1852
250 Ga0207675_100268176 3300026118 Unclassified 1656
251 Ga0207683_10168401 3300026121 Unclassified 1983
252 Ga0207698_10288916 3300026142 Bacteria 1521
253 Ga0209984_1007789 3300027424 Bacteria 1336
254 Ga0209999_1017079 3300027543 Bacteria 1322
255 Ga0209974_10000278 3300027876 Bacteria 16656
256 Ga0268265_10005210 3300028380 Bacteria 8905
257 Ga0268265_10124029 3300028380 Bacteria 2134
258 Ga0268265_10162422 3300028380 Bacteria 1899
259 Ga0268264_10001435 3300028381 Bacteria 22296
260 Ga0268264_10055707 3300028381 Bacteria 3304
261 Ga0265325_10053976 3300031241 Unclassified 2059
262 Ga0307416_100213320 3300032002 Unclassified 1844
263 Ga0373923_0090946 3300035111 Bacteria 1335
264 Ga0373932_0018349 3300035112 Bacteria 1808
265 Ga0373936_0005083 3300035113 Bacteria 4952
266 Ga0373941_0027483 3300035115 Bacteria 1661
267 Ga0373945_0023092 3300035116 Bacteria 2147
268 Ga0373943_0003545 3300035170 Bacteria 7105
269 Ga0373931_0070651 3300035691 Bacteria 1905
270 Ga0373931_0188426 3300035691 Bacteria 1226
271 Ga0373947_0000087 3300035725 Bacteria 46416
272 Ga0373925_0049405 3300037068 Bacteria 3135
273 Ga0451804_1072069 3300041463 Unclassified 1606
274 Ga0451807_2450003 3300041486 Unclassified 1255
275 Ga0439434_0016314 3300042435 Bacteria 2219
276 Ga0451577_0032443 3300042876 Bacteria 4705
277 Ga0451577_0253021 3300042876 Bacteria 1595
278 Ga0451577_0308955 3300042876 Bacteria 1433
279 Ga0453684_0201865 3300044712 Bacteria 2317
280 Ga0453684_0262430 3300044712 Bacteria 1978
281 Ga0453684_0454183 3300044712 Unclassified 1426
282 Ga0451576_0055767 3300045051 Bacteria 4133
283 Ga0451576_0176592 3300045051 Bacteria 2230
284 Ga0495653_0192763 3300046463 Bacteria 1389
285 Ga0495580_0061866 3300046472 Unclassified 2627
286 Ga0495639_0010932 3300046475 Bacteria 3908
287 Ga0495662_0012636 3300046476 Bacteria 4118
288 Ga0495664_0004452 3300046477 Bacteria 7668
289 Ga0495584_0072656 3300046491 Bacteria 1729
290 Ga0495618_0051684 3300046514 Bacteria 2596
291 Ga0495628_0131167 3300046516 Bacteria 1917
292 Ga0495665_0017988 3300046531 Bacteria 3799
293 Ga0495640_0002358 3300046533 Bacteria 15136
294 Ga0495586_0032504 3300046535 Bacteria 2797
295 Ga0495598_0034723 3300046537 Bacteria 1439
296 Ga0495598_0047018 3300046537 Bacteria 1284
297 Ga0495621_0061016 3300046539 Bacteria 1369
298 Ga0495645_0015493 3300046543 Bacteria 5422
299 Ga0495667_0170186 3300046559 Bacteria 1400
300 Ga0495634_0009716 3300046642 Bacteria 7081
301 Ga0495634_0010150 3300046642 Bacteria 6909
302 Ga0495635_0006737 3300046663 Bacteria 8026
303 Ga0495646_0077725 3300046680 Bacteria 1941
304 Ga0495669_0046553 3300046684 Bacteria 1936
305 Ga0495613_0012175 3300046689 Bacteria 6394
306 Ga0495624_0007492 3300046690 Bacteria 7657
307 Ga0495581_0012809 3300047315 Bacteria 4857
308 Ga0495581_0023307 3300047315 Bacteria 3587
309 Ga0495674_0007933 3300047319 Bacteria 10131
310 Ga0495684_0013453 3300047471 Bacteria 6298
311 Ga0495593_0021410 3300047673 Bacteria 3613
312 Ga0496103_0060652 3300048906 Unclassified 2351
313 Ga0496103_0113047 3300048906 Bacteria 1726
314 Ga0496104_0016949 3300048907 Bacteria 6627
315 Ga0496104_0465965 3300048907 Bacteria 1175
316 Ga0496108_0066240 3300048911 Bacteria 3045
317 Ga0496109_0003548 3300048912 Bacteria 13018
318 Ga0496109_0046173 3300048912 Bacteria 3956
319 Ga0496109_0612711 3300048912 Bacteria 1025
320 Ga0496110_0000282 3300048913 Bacteria 33145
321 Ga0496110_0185356 3300048913 Bacteria 1890
322 Ga0496112_0009122 3300048915 Bacteria 8913
323 Ga0496113_0002455 3300048916 Bacteria 10796
324 Ga0496114_0404713 3300048917 Unclassified 1208
325 Ga0501031_0012597 3300049568 Bacteria 5522
326 Ga0501033_0061968 3300049570 Bacteria 2755
327 Ga0501033_0201310 3300049570 Bacteria 1422
328 Ga0501036_0001428 3300049572 Bacteria 18359
329 Ga0501036_0004892 3300049572 Bacteria 10821
330 Ga0501037_0071219 3300049573 Bacteria 2529
331 Ga0501038_0219970 3300049574 Unclassified 1515
332 Ga0501038_0236293 3300049574 Bacteria 1452
333 Ga0501039_0018693 3300049575 Bacteria 5319
334 Ga0501040_0005874 3300049576 Bacteria 7943
335 Ga0501040_0104081 3300049576 Unclassified 1982
336 Ga0501041_0000107 3300049577 Bacteria 34774
337 Ga0501041_0064555 3300049577 Unclassified 2242
338 Ga0501042_0003251 3300049578 Bacteria 10164
339 Ga0501042_0033014 3300049578 Bacteria 3668
340 Ga0501046_0018489 3300049580 Bacteria 5798
341 Ga0501046_0136182 3300049580 Bacteria 1860
342 Ga0501048_0000692 3300049582 Bacteria 24512
343 Ga0501048_0015648 3300049582 Bacteria 5598
344 Ga0501071_0000064 3300049587 Bacteria 37306
345 Ga0501071_0016155 3300049587 Bacteria 5131
346 Ga0501072_0005084 3300049588 Bacteria 10015
347 Ga0501072_0071987 3300049588 Bacteria 2731
348 Ga0501073_0056637 3300049589 Bacteria 2742
349 Ga0501074_0029841 3300049590 Bacteria 3952
350 Ga0501075_0000428 3300049591 Bacteria 24716
351 Ga0501075_0002133 3300049591 Bacteria 13089
352 Ga0501076_0000399 3300049592 Bacteria 27186
353 Ga0501076_0006710 3300049592 Bacteria 8349
354 Ga0501076_0257193 3300049592 Bacteria 1429
355 Ga0501077_0000369 3300049593 Bacteria 26860
356 Ga0501077_0274904 3300049593 Unclassified 1072
357 Ga0501079_0037469 3300049741 Bacteria 3737
358 Ga0501079_0101564 3300049741 Bacteria 2230
359 Ga0501080_0026757 3300049742 Bacteria 5361
360 Ga0501080_0034575 3300049742 Bacteria 4720
361 Ga0501080_0055137 3300049742 Bacteria 3702
362 Ga0501081_0002152 3300049743 Bacteria 12342
363 Ga0501081_0017332 3300049743 Bacteria 4766
364 Ga0501081_0157167 3300049743 Bacteria 1636
365 Ga0501035_0011944 3300049822 Bacteria 8036
366 Ga0501035_0080254 3300049822 Bacteria 2881
367 Ga0501045_0000112 3300049824 Bacteria 41068
368 Ga0501045_0144620 3300049824 Bacteria 1768
369 nmdc:mga0yw44_421_c1 3300050492 Bacteria 14823
370 nmdc:mga0k408_1621_c1 3300050493 Bacteria 12161
371 nmdc:mga05p37_148850_c1 3300050507 Archaea 2865
372 nmdc:mga05p37_423499_c1 3300050507 Bacteria 1549
373 nmdc:mga05p37_44485_c1 3300050507 Bacteria 5462
374 nmdc:mga05p37_48352_c1 3300050507 Bacteria 5232
375 nmdc:mga05p37_65298_c1 3300050507 Bacteria 4478
376 nmdc:mga05p37_90622_c1 3300050507 Bacteria 3768
377 nmdc:mga09592_30565_c1 3300050508 Bacteria 4483
378 nmdc:mga0qj67_12134_c1 3300050509 Bacteria 6480
379 nmdc:mga06r32_19723_c1 3300050510 Bacteria 6196
380 nmdc:mga06r32_226334_c1 3300050510 Bacteria 1859
381 nmdc:mga08y16_260874_c1 3300050511 Bacteria 1789
382 nmdc:mga0n895_233084_c1 3300050512 Bacteria 1869
383 nmdc:mga0n895_469372_c1 3300050512 Unclassified 1270
384 nmdc:mga0rr50_42882_c1 3300050513 Bacteria 3307
385 nmdc:mga0rr50_53847_c1 3300050513 Bacteria 2995
386 nmdc:mga08x19_156094_c1 3300050514 Viruses 1548
387 nmdc:mga08x19_6211_c1 3300050514 Bacteria 7067
388 nmdc:mga0a205_253307_c1 3300050515 Bacteria 1639
389 nmdc:mga0a205_51672_c1 3300050515 Bacteria 3968
390 nmdc:mga0a205_63691_c1 3300050515 Bacteria 3562
391 Ga0495601_0031104 3300053077 Unclassified 3316
392 Ga0495601_0213416 3300053077 Unclassified 1261
393 Ga0495619_0024340 3300053085 Bacteria 3883
394 Ga0495619_0025384 3300053085 Bacteria 3805
395 Ga0495619_0335866 3300053085 Bacteria 1046
396 Ga0501084_0011267 3300054114 Bacteria 7401
397 Ga0501084_0011475 3300054114 Bacteria 7336
398 Ga0501082_0002730 3300060353 Bacteria 15426
399 Ga0501082_0133762 3300060353 Bacteria 2151
400 Ga0530510_0001865 3300061734 Bacteria 14409
401 Ga0530510_0014435 3300061734 Bacteria 5568
402 2929623306 2929615660 Bacteria 9193770
403 2929632604 2929624759 Bacteria 9339455
404 2933585209 2933577622 Bacteria 9116884
405 8055743247 8055742211 Bacteria 9226248
406 Ga0070704_100039939
407 Ga0065712_10000663
408 Ga0065715_10011425
409 Ga0065707_10233635
410 Ga0070683_100309497
411 Ga0070670_100001548
412 Ga0070670_100003928
413 Ga0070670_100004009
414 Ga0070670_100005925
415 Ga0070670_100057350
416 Ga0070670_100264025
417 Ga0070670_100285064
418 Ga0070677_10070733
419 Ga0068869_100006797
420 Ga0070666_10173815
421 Ga0070661_100298228
422 Ga0070668_100016985
423 Ga0070668_100047919
424 Ga0070669_100053381
425 Ga0070669_100058052
426 Ga0070669_100323289
427 Ga0070675_100151238
428 Ga0070671_100006889
429 Ga0070671_100018531
430 Ga0070671_100029192
431 Ga0070671_100048320
432 Ga0070671_100251483
433 Ga0070674_100036191
434 Ga0070674_100220226
435 Ga0070673_100100240
436 Ga0070673_100192364
437 Ga0070659_100340343
438 Ga0070667_100020434
439 Ga0070667_100385290
440 Ga0070667_100394380
441 Ga0070705_100109111
442 Ga0070708_100000135
443 Ga0070708_100145693
444 Ga0070708_100210361
445 Ga0070708_100397843
446 Ga0070678_100256896
447 Ga0070662_100031406
448 Ga0070662_100040382
449 Ga0070662_100280036
450 Ga0068867_100020150
451 Ga0068867_100020774
452 Ga0068867_100334828
453 Ga0070706_100005039
454 Ga0070706_100089172
455 Ga0070706_100223581
456 Ga0070707_100189442
457 Ga0070707_100306890
458 Ga0070698_100054305
459 Ga0070698_100056502
460 Ga0070698_100210545
461 Ga0070698_100343606
462 Ga0070699_100055378
463 Ga0070699_100135002
464 Ga0070699_100316084
465 Ga0070697_100016073
466 Ga0070697_100018977
467 Ga0070697_100091094
468 Ga0070672_100010360
469 Ga0070672_100018481
470 Ga0070672_100026642
471 Ga0070672_100043065
472 Ga0070696_100171103
473 Ga0070704_100095677
474 Ga0070704_100251556
475 Ga0068855_100018555
476 Ga0070664_100217319
477 Ga0068857_100016954
478 Ga0068852_100286331
479 Ga0068859_100086582
480 Ga0068864_100008471
481 Ga0068864_100020865
482 Ga0068864_100045825
483 Ga0068864_100048908
484 Ga0068864_100063446
485 Ga0068861_100016309
486 Ga0068861_100165355
487 Ga0068851_10061071
488 Ga0068870_10147646
489 Ga0068863_100001574
490 Ga0068863_100002104
491 Ga0068863_100011783
492 Ga0068863_100030724
493 Ga0068863_100050089
494 Ga0068863_100145710
495 Ga0068863_100201494
496 Ga0068863_100263994
497 Ga0068863_100352961
498 Ga0068858_100026262
499 Ga0068858_100225650
500 Ga0068858_100409796
501 Ga0068860_100125077
502 Ga0068862_100080812
503 Ga0081455_10005062
504 Ga0081455_10248722
505 Ga0081538_10018428
506 Ga0081540_1098431
507 Ga0075365_10090453
508 Ga0075366_10002865
509 Ga0097621_100061658
510 Ga0097621_100304453
511 Ga0068871_100021641
512 Ga0075428_100139083
513 Ga0075428_100148511
514 Ga0075428_100280145
515 Ga0075428_100504905
516 Ga0075428_100507241
517 Ga0075430_100154380
518 Ga0075430_100285165
519 Ga0075431_100150364
520 Ga0075433_10031383
521 Ga0075434_100061387
522 Ga0075434_100197158
523 Ga0075429_100015522
524 Ga0068865_100011504
525 Ga0068865_100051611
526 Ga0068865_100160969
527 Ga0075436_100015672
528 Ga0075436_100043412
529 Ga0075436_100079872
530 Ga0097620_100086586
531 Ga0075435_100011918
532 Ga0075435_100076762
533 Ga0075435_100115493
534 Ga0075435_100249921
535 Ga0099794_10009064
536 Ga0099794_10014737
537 Ga0111539_10432066
538 Ga0105247_10060543
539 Ga0114129_10032052
540 Ga0114129_10060854
541 Ga0114129_10176609
542 Ga0114129_10252185
543 Ga0114129_10309882
544 Ga0114129_10379550
545 Ga0114129_10410635
546 Ga0114129_10679539
547 Ga0114129_10921335
548 Ga0105243_10099768
549 Ga0105243_10405316
550 Ga0105242_10321963
551 Ga0105242_10341413
552 Ga0105248_10001100
553 Ga0105248_10013286
554 Ga0105248_10024130
555 Ga0105237_10055585
556 Ga0105249_10023824
557 Ga0105249_10343183
558 Ga0105246_10427722
559 Ga0157374_10037458
560 Ga0157374_10104021
561 Ga0157374_10163175
562 Ga0157378_10019077
563 Ga0157378_10218933
564 Ga0163162_10020095
565 Ga0163162_10065725
566 Ga0163162_10101810
567 Ga0163162_10103334
568 Ga0163162_10236118
569 Ga0163162_10388433
570 Ga0157375_10043344
571 Ga0157375_10081870
572 Ga0157375_10171639
573 Ga0157375_10174442
574 Ga0157375_10178550
575 Ga0163163_10009637
576 Ga0163163_10061986
577 Ga0163163_10092944
578 Ga0163163_10167625
579 Ga0163163_10170238
580 Ga0157380_10544494
581 Ga0157379_10002838
582 Ga0157379_10154124
583 Ga0157379_10455991
584 Ga0157376_10029093
585 Ga0157376_10035334
586 Ga0163161_10095906
587 Ga0163161_10144847
588 Ga0207682_10060964
589 Ga0207710_10016568
590 Ga0207680_10144643
591 Ga0207699_10145401
592 Ga0207643_10062320
593 Ga0207684_10001349
594 Ga0207684_10014179
595 Ga0207684_10043546
596 Ga0207684_10062338
597 Ga0207684_10063847
598 Ga0207662_10226652
599 Ga0207649_10144080
600 Ga0207646_10035354
601 Ga0207646_10053062
602 Ga0207646_10128096
603 Ga0207681_10256571
604 Ga0207650_10007232
605 Ga0207650_10014793
606 Ga0207650_10017673
607 Ga0207650_10038986
608 Ga0207650_10096915
609 Ga0207659_10004832
610 Ga0207644_10019175
611 Ga0207644_10036179
612 Ga0207644_10085959
613 Ga0207706_10042034
614 Ga0207706_10191561
615 Ga0207669_10141146
616 Ga0207704_10065862
617 Ga0207665_10001063
618 Ga0207691_10013368
619 Ga0207691_10026414
620 Ga0207691_10028280
621 Ga0207691_10122003
622 Ga0207691_10126047
623 Ga0207711_10016119
624 Ga0207711_10020792
625 Ga0207711_10055348
626 Ga0207711_10055669
627 Ga0207679_10066329
628 Ga0207667_10026565
629 Ga0207651_10116050
630 Ga0207651_10219676
631 Ga0207651_10285925
632 Ga0207712_10073035
633 Ga0207712_10148639
634 Ga0207668_10017160
635 Ga0207668_10032190
636 Ga0207668_10202311
637 Ga0207658_10198376
638 Ga0207703_10001964
639 Ga0207703_10095507
640 Ga0207678_10264148
641 Ga0207641_10004233
642 Ga0207641_10005023
643 Ga0207641_10043181
644 Ga0207641_10088241
645 Ga0207648_10004018
646 Ga0207648_10071559
647 Ga0207676_10003041
648 Ga0207676_10012711
649 Ga0207676_10023911
650 Ga0207676_10174632
651 Ga0207674_10020899
652 Ga0207674_10207588
653 Ga0207675_100104437
654 Ga0207675_100214657
655 Ga0207675_100268176
656 Ga0207683_10168401
657 Ga0207698_10288916
658 Ga0209984_1007789
659 Ga0209999_1017079
660 Ga0209974_10000278
661 Ga0268265_10005210
662 Ga0268265_10124029
663 Ga0268265_10162422
664 Ga0268264_10001435
665 Ga0268264_10055707
666 Ga0265325_10053976
667 Ga0307416_100213320
668 Ga0373923_0090946
669 Ga0373932_0018349
670 Ga0373936_0005083
671 Ga0373941_0027483
672 Ga0373945_0023092
673 Ga0373943_0003545
674 Ga0373931_0070651
675 Ga0373931_0188426
676 Ga0373947_0000087
677 Ga0373925_0049405
678 Ga0451804_1072069
679 Ga0451807_2450003
680 Ga0439434_0016314
681 Ga0451577_0032443
682 Ga0451577_0253021
683 Ga0451577_0308955
684 Ga0453684_0201865
685 Ga0453684_0262430
686 Ga0453684_0454183
687 Ga0451576_0055767
688 Ga0451576_0176592
689 Ga0495653_0192763
690 Ga0495580_0061866
691 Ga0495639_0010932
692 Ga0495662_0012636
693 Ga0495664_0004452
694 Ga0495584_0072656
695 Ga0495618_0051684
696 Ga0495628_0131167
697 Ga0495665_0017988
698 Ga0495640_0002358
699 Ga0495586_0032504
700 Ga0495598_0034723
701 Ga0495598_0047018
702 Ga0495621_0061016
703 Ga0495645_0015493
704 Ga0495667_0170186
705 Ga0495634_0009716
706 Ga0495634_0010150
707 Ga0495635_0006737
708 Ga0495646_0077725
709 Ga0495669_0046553
710 Ga0495613_0012175
711 Ga0495624_0007492
712 Ga0495581_0012809
713 Ga0495581_0023307
714 Ga0495674_0007933
715 Ga0495684_0013453
716 Ga0495593_0021410
717 Ga0496103_0060652
718 Ga0496103_0113047
719 Ga0496104_0016949
720 Ga0496104_0465965
721 Ga0496108_0066240
722 Ga0496109_0003548
723 Ga0496109_0046173
724 Ga0496109_0612711
725 Ga0496110_0000282
726 Ga0496110_0185356
727 Ga0496112_0009122
728 Ga0496113_0002455
729 Ga0496114_0404713
730 Ga0501031_0012597
731 Ga0501033_0061968
732 Ga0501033_0201310
733 Ga0501036_0001428
734 Ga0501036_0004892
735 Ga0501037_0071219
736 Ga0501038_0219970
737 Ga0501038_0236293
738 Ga0501039_0018693
739 Ga0501040_0005874
740 Ga0501040_0104081
741 Ga0501041_0000107
742 Ga0501041_0064555
743 Ga0501042_0003251
744 Ga0501042_0033014
745 Ga0501046_0018489
746 Ga0501046_0136182
747 Ga0501048_0000692
748 Ga0501048_0015648
749 Ga0501071_0000064
750 Ga0501071_0016155
751 Ga0501072_0005084
752 Ga0501072_0071987
753 Ga0501073_0056637
754 Ga0501074_0029841
755 Ga0501075_0000428
756 Ga0501075_0002133
757 Ga0501076_0000399
758 Ga0501076_0006710
759 Ga0501076_0257193
760 Ga0501077_0000369
761 Ga0501077_0274904
762 Ga0501079_0037469
763 Ga0501079_0101564
764 Ga0501080_0026757
765 Ga0501080_0034575
766 Ga0501080_0055137
767 Ga0501081_0002152
768 Ga0501081_0017332
769 Ga0501081_0157167
770 Ga0501035_0011944
771 Ga0501035_0080254
772 Ga0501045_0000112
773 Ga0501045_0144620
774 nmdc:mga0yw44_421_c1
775 nmdc:mga0k408_1621_c1
776 nmdc:mga05p37_148850_c1
777 nmdc:mga05p37_423499_c1
778 nmdc:mga05p37_44485_c1
779 nmdc:mga05p37_48352_c1
780 nmdc:mga05p37_65298_c1
781 nmdc:mga05p37_90622_c1
782 nmdc:mga09592_30565_c1
783 nmdc:mga0qj67_12134_c1
784 nmdc:mga06r32_19723_c1
785 nmdc:mga06r32_226334_c1
786 nmdc:mga08y16_260874_c1
787 nmdc:mga0n895_233084_c1
788 nmdc:mga0n895_469372_c1
789 nmdc:mga0rr50_42882_c1
790 nmdc:mga0rr50_53847_c1
791 nmdc:mga08x19_156094_c1
792 nmdc:mga08x19_6211_c1
793 nmdc:mga0a205_253307_c1
794 nmdc:mga0a205_51672_c1
795 nmdc:mga0a205_63691_c1
796 Ga0495601_0031104
797 Ga0495601_0213416
798 Ga0495619_0024340
799 Ga0495619_0025384
800 Ga0495619_0335866
801 Ga0501084_0011267
802 Ga0501084_0011475
803 Ga0501082_0002730
804 Ga0501082_0133762
805 Ga0530510_0001865
806 Ga0530510_0014435
807 2929623306
808 2929632604
809 2933585209
810 8055743247

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04392

ABC_sub_bind

ABC transporter substrate binding protein

82

371

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.8906 27 325
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.8849 27 325
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.8742 29 326
3lft-assembly2.cif.gz_B the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.8679 31 326
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.866 29 326
ID Description Score Start End Superfamily
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8971 148 325 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8783 148 326 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8737 148 325 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8614 148 326 3.40.50.2300
3lftB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8574 31 297 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2V6ZIS3-F1-model_v4 ABC transporter substrate-binding protein 0.9634 224 327
AF-A0A537SPV0-F1-model_v4 ABC transporter substrate-binding protein 0.9601 54 327
AF-A0A2V7CXZ3-F1-model_v4 ABC transporter substrate-binding protein 0.959 143 327
AF-A0A1G5L1X1-F1-model_v4 Putative ABC transport system substrate-binding protein 0.9556 47 327
AF-A0A536Z1U0-F1-model_v4 ABC transporter substrate-binding protein 0.954 149 327

Map