F435869

General Info

Members Datasets Scaffolds Average Seq Length
405 254 810 226

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100260928|Ga0068868_1002609282
Length 267
Sequence MSNTDVRTDQANRDVSVGKVDLKLEAVVIPVSDVDRAKAFYAQLGWRLDADFAFDNGFRVVQFTPPGSGCSVQFGANITSAAPGSAQGLYLIVSDIETARGGLAAGGVEVSEVFHPGTPGAQFRLDGAKGRASGRSPENASYGSFADFADPDGNVWLLQEITARLPGRIDSDETSFASVTDLANALRRAAAAHGEHEVRTGQHDENWPDWYASYMVAEQAGRTPVVRDEAVIPCVQTSSRAAPSPTTRCPTTPALSAGSASYRVEIP

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
107 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
164 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
165 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
166 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
167 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
168 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
169 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
180 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
181 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
182 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
183 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
184 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
185 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
186 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
187 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
188 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
189 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
190 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
191 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
192 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
200 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
201 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
202 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
203 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
204 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
205 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
206 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
207 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
208 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
209 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
210 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
211 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
212 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
213 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
214 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
215 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
216 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
217 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
218 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
219 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
220 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
221 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
222 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
237 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
238 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
239 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
240 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
241 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
244 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
249 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
250 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
251 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
252 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
253 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
254 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 0.99
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.23
Nodule 0
Rhizoplane 11.6
Rhizosphere 83.7
Stem 0
Stem Tuber 0
Unclassified 2.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100260928 3300005338 Bacteria 1461
2 JGI24752J21851_1003134 3300001976 Bacteria 2182
3 JGI24746J21847_1006638 3300001977 Bacteria 1786
4 JGI24743J22301_10029091 3300001991 Bacteria 1084
5 JGI24748J21848_1001534 3300002074 Bacteria 2563
6 JGI24749J21850_1021296 3300002076 Bacteria 917
7 JGI24035J26624_1010332 3300002126 Bacteria 927
8 JGI24034J26672_10003117 3300002239 Bacteria 2306
9 JGI24742J22300_10030464 3300002244 Bacteria 941
10 JGI24751J29686_10006894 3300002459 Bacteria 2316
11 Ga0065712_10009489 3300005290 Bacteria 2322
12 Ga0065715_10119302 3300005293 Bacteria 2285
13 Ga0070658_10215640 3300005327 Bacteria 1622
14 Ga0070676_10071621 3300005328 Bacteria 2082
15 Ga0070683_100054067 3300005329 Bacteria 3722
16 Ga0070683_100069414 3300005329 Bacteria 3286
17 Ga0070683_100447789 3300005329 Bacteria 1232
18 Ga0070690_100063330 3300005330 Bacteria 2386
19 Ga0070677_10002649 3300005333 Bacteria 5727
20 Ga0068869_100018642 3300005334 Bacteria 4728
21 Ga0068869_100744352 3300005334 Bacteria 839
22 Ga0070666_10004422 3300005335 Bacteria 8560
23 Ga0070666_10018391 3300005335 Bacteria 4492
24 Ga0070682_100119562 3300005337 Bacteria 1767
25 Ga0070682_100404834 3300005337 Unclassified 1033
26 Ga0068868_100062865 3300005338 Bacteria 2944
27 Ga0068868_100073102 3300005338 Bacteria 2737
28 Ga0068868_100692443 3300005338 Bacteria 911
29 Ga0070660_100008189 3300005339 Bacteria 7306
30 Ga0070689_100000574 3300005340 Bacteria 22126
31 Ga0070689_100050895 3300005340 Bacteria 3200
32 Ga0070691_10270880 3300005341 Bacteria 918
33 Ga0070687_100035564 3300005343 Bacteria 2474
34 Ga0070687_100111698 3300005343 Bacteria 1548
35 Ga0070692_10095409 3300005345 Bacteria 1623
36 Ga0070668_100382216 3300005347 Bacteria 1198
37 Ga0070674_100117151 3300005356 Bacteria 1966
38 Ga0070674_100147533 3300005356 Bacteria 1772
39 Ga0070674_100279613 3300005356 Bacteria 1322
40 Ga0070688_100242605 3300005365 Bacteria 1279
41 Ga0070659_100188281 3300005366 Bacteria 1696
42 Ga0070667_100019636 3300005367 Bacteria 5606
43 Ga0070667_100021524 3300005367 Bacteria 5353
44 Ga0070701_10004563 3300005438 Bacteria 5630
45 Ga0070705_100367338 3300005440 Bacteria 1055
46 Ga0070700_100070909 3300005441 Bacteria 2223
47 Ga0070700_100118344 3300005441 Bacteria 1771
48 Ga0070694_100085211 3300005444 Bacteria 2206
49 Ga0070663_100155714 3300005455 Bacteria 1755
50 Ga0070678_100114413 3300005456 Bacteria 2116
51 Ga0070662_100021737 3300005457 Bacteria 4384
52 Ga0070681_10035667 3300005458 Bacteria 4995
53 Ga0070685_10001734 3300005466 Bacteria 11439
54 Ga0070699_100021030 3300005518 Bacteria 5626
55 Ga0070699_100620266 3300005518 Bacteria 986
56 Ga0070679_100046020 3300005530 Bacteria 4348
57 Ga0070679_100084673 3300005530 Bacteria 3158
58 Ga0070684_100062487 3300005535 Bacteria 3262
59 Ga0070684_100124857 3300005535 Bacteria 2318
60 Ga0070697_100022401 3300005536 Bacteria 5014
61 Ga0068853_100527705 3300005539 Bacteria 1116
62 Ga0070686_100486127 3300005544 Bacteria 955
63 Ga0070665_100043916 3300005548 Bacteria 4489
64 Ga0070665_100061055 3300005548 Bacteria 3778
65 Ga0070665_100072390 3300005548 Bacteria 3454
66 Ga0070665_100107336 3300005548 Bacteria 2794
67 Ga0070704_100217398 3300005549 Bacteria 1552
68 Ga0070704_100425611 3300005549 Bacteria 1138
69 Ga0070664_100098955 3300005564 Bacteria 2534
70 Ga0068857_100013263 3300005577 Bacteria 7178
71 Ga0070702_100028509 3300005615 Bacteria 3026
72 Ga0068852_100859734 3300005616 Bacteria 923
73 Ga0068859_100024646 3300005617 Bacteria 6037
74 Ga0068859_100348817 3300005617 Bacteria 1575
75 Ga0068864_100003661 3300005618 Bacteria 12708
76 Ga0068866_10038234 3300005718 Bacteria 2361
77 Ga0068861_100109565 3300005719 Bacteria 2210
78 Ga0068851_10002578 3300005834 Bacteria 7974
79 Ga0068851_10244629 3300005834 Bacteria 1016
80 Ga0068863_100221359 3300005841 Bacteria 1824
81 Ga0068863_100929588 3300005841 Bacteria 871
82 Ga0068858_100046916 3300005842 Bacteria 4005
83 Ga0068858_100219116 3300005842 Bacteria 1802
84 Ga0068860_100016517 3300005843 Bacteria 7199
85 Ga0068860_100046705 3300005843 Bacteria 4129
86 Ga0081538_10000305 3300005981 Bacteria 56642
87 Ga0081539_10001103 3300005985 Bacteria 49011
88 Ga0075363_100278651 3300006048 Bacteria 967
89 Ga0070716_100827180 3300006173 Bacteria 719
90 Ga0075367_10340559 3300006178 Bacteria 946
91 Ga0097621_100040446 3300006237 Bacteria 3748
92 Ga0068871_100026270 3300006358 Bacteria 4541
93 Ga0075428_100026691 3300006844 Bacteria 6395
94 Ga0075430_100008449 3300006846 Bacteria 8699
95 Ga0075431_100022210 3300006847 Bacteria 6488
96 Ga0075433_10465076 3300006852 Bacteria 1114
97 Ga0075434_100046172 3300006871 Bacteria 4323
98 Ga0075434_100066349 3300006871 Bacteria 3595
99 Ga0075429_100002605 3300006880 Bacteria 15213
100 Ga0068865_100293577 3300006881 Bacteria 1298
101 Ga0097620_100024645 3300006931 Bacteria 6037
102 Ga0097620_100348840 3300006931 Bacteria 1575
103 Ga0075435_100021218 3300007076 Bacteria 4992
104 Ga0075435_100055951 3300007076 Bacteria 3188
105 Ga0105240_10188717 3300009093 Unclassified 2425
106 Ga0105240_10560787 3300009093 Bacteria 1262
107 Ga0111539_10008914 3300009094 Bacteria 12700
108 Ga0111539_10010518 3300009094 Bacteria 11647
109 Ga0111539_10031897 3300009094 Bacteria 6400
110 Ga0111539_10255235 3300009094 Bacteria 2042
111 Ga0111539_10400726 3300009094 Bacteria 1598
112 Ga0105245_10008425 3300009098 Bacteria 9005
113 Ga0105245_10055467 3300009098 Bacteria 3559
114 Ga0105245_10072691 3300009098 Bacteria 3125
115 Ga0105245_10105147 3300009098 Bacteria 2618
116 Ga0105245_10156591 3300009098 Bacteria 2158
117 Ga0114129_10029653 3300009147 Bacteria 7748
118 Ga0114129_10173847 3300009147 Bacteria 2934
119 Ga0114129_10810475 3300009147 Bacteria 1194
120 Ga0105243_10081153 3300009148 Bacteria 2647
121 Ga0105242_10017481 3300009176 Bacteria 5590
122 Ga0105242_10112704 3300009176 Bacteria 2322
123 Ga0105242_10229382 3300009176 Bacteria 1663
124 Ga0105248_10010382 3300009177 Bacteria 10255
125 Ga0105248_10018766 3300009177 Bacteria 7648
126 Ga0105237_10020305 3300009545 Bacteria 6852
127 Ga0105249_10070790 3300009553 Bacteria 3220
128 Ga0105249_10120961 3300009553 Bacteria 2488
129 Ga0105239_10043937 3300010375 Bacteria 4900
130 Ga0105239_10686362 3300010375 Bacteria 1170
131 Ga0105246_10050554 3300011119 Bacteria 2851
132 Ga0105246_10146399 3300011119 Bacteria 1783
133 Ga0157327_1007061 3300012512 Unclassified 967
134 Ga0157371_10024902 3300013102 Bacteria 4366
135 Ga0157370_10105810 3300013104 Bacteria 2633
136 Ga0157369_10036606 3300013105 Bacteria 5375
137 Ga0157369_10679111 3300013105 Bacteria 1061
138 Ga0157374_10099556 3300013296 Unclassified 2785
139 Ga0157378_10134365 3300013297 Bacteria 2292
140 Ga0163162_10070379 3300013306 Bacteria 3550
141 Ga0157372_10075653 3300013307 Bacteria 3800
142 Ga0157375_10050391 3300013308 Bacteria 4084
143 Ga0157375_10527281 3300013308 Bacteria 1344
144 Ga0163163_10018706 3300014325 Bacteria 6492
145 Ga0163163_10031009 3300014325 Bacteria 5156
146 Ga0157380_10004907 3300014326 Bacteria 9322
147 Ga0157380_10142653 3300014326 Bacteria 2060
148 Ga0182008_10149909 3300014497 Bacteria 1169
149 Ga0157377_10008764 3300014745 Bacteria 4946
150 Ga0157379_10021858 3300014968 Bacteria 5668
151 Ga0157379_10118237 3300014968 Bacteria 2384
152 Ga0157376_10010038 3300014969 Bacteria 6910
153 Ga0157376_10050209 3300014969 Bacteria 3460
154 Ga0157376_10258653 3300014969 Bacteria 1630
155 Ga0157376_10526455 3300014969 Bacteria 1166
156 Ga0163161_10064008 3300017792 Bacteria 2682
157 Ga0163161_10087356 3300017792 Bacteria 2303
158 Ga0163161_10371368 3300017792 Bacteria 1141
159 Ga0206354_10639923 3300020081 Bacteria 4956
160 Ga0206354_10690675 3300020081 Bacteria 1055
161 Ga0206353_11116863 3300020082 Bacteria 1824
162 Ga0213876_10215297 3300021384 Bacteria 1021
163 Ga0213875_10039697 3300021388 Bacteria 2217
164 Ga0224712_10007728 3300022467 Bacteria 3147
165 Ga0207666_1002617 3300025271 Bacteria 2175
166 Ga0207673_1002197 3300025290 Bacteria 2202
167 Ga0207697_10002094 3300025315 Bacteria 10493
168 Ga0207656_10035246 3300025321 Bacteria 2094
169 Ga0207682_10001906 3300025893 Bacteria 9470
170 Ga0207642_10007755 3300025899 Bacteria 3639
171 Ga0207710_10030662 3300025900 Bacteria 2347
172 Ga0207688_10002963 3300025901 Bacteria 9240
173 Ga0207680_10003135 3300025903 Bacteria 7762
174 Ga0207680_10067793 3300025903 Bacteria 2199
175 Ga0207645_10004819 3300025907 Bacteria 9913
176 Ga0207643_10001268 3300025908 Bacteria 14767
177 Ga0207684_10747260 3300025910 Bacteria 829
178 Ga0207707_10025384 3300025912 Bacteria 5184
179 Ga0207707_10315573 3300025912 Bacteria 1350
180 Ga0207695_10011058 3300025913 Bacteria 10965
181 Ga0207660_10188425 3300025917 Bacteria 1605
182 Ga0207662_10009891 3300025918 Bacteria 5262
183 Ga0207657_10081060 3300025919 Bacteria 2727
184 Ga0207649_10077562 3300025920 Bacteria 2141
185 Ga0207652_10054570 3300025921 Bacteria 3435
186 Ga0207646_10022040 3300025922 Bacteria 5876
187 Ga0207646_10072045 3300025922 Bacteria 3086
188 Ga0207681_10218047 3300025923 Bacteria 1474
189 Ga0207650_10011837 3300025925 Bacteria 6013
190 Ga0207659_10011531 3300025926 Bacteria 5585
191 Ga0207687_10105520 3300025927 Bacteria 2082
192 Ga0207687_10124801 3300025927 Bacteria 1931
193 Ga0207644_10112146 3300025931 Bacteria 2063
194 Ga0207706_10012533 3300025933 Bacteria 7722
195 Ga0207706_10021214 3300025933 Bacteria 5836
196 Ga0207686_10050008 3300025934 Bacteria 2598
197 Ga0207686_10134784 3300025934 Bacteria 1699
198 Ga0207709_10041396 3300025935 Bacteria 2764
199 Ga0207670_10001883 3300025936 Bacteria 10959
200 Ga0207670_10009377 3300025936 Bacteria 5585
201 Ga0207669_10056964 3300025937 Bacteria 2377
202 Ga0207669_10295528 3300025937 Bacteria 1228
203 Ga0207704_10179847 3300025938 Bacteria 1527
204 Ga0207704_10662615 3300025938 Bacteria 861
205 Ga0207691_10029235 3300025940 Bacteria 5155
206 Ga0207711_10028592 3300025941 Bacteria 4693
207 Ga0207711_10054118 3300025941 Bacteria 3443
208 Ga0207689_10007789 3300025942 Bacteria 9371
209 Ga0207689_10689930 3300025942 Bacteria 861
210 Ga0207661_10033158 3300025944 Bacteria 4007
211 Ga0207661_10354924 3300025944 Bacteria 1323
212 Ga0207661_10467816 3300025944 Bacteria 1150
213 Ga0207651_10017625 3300025960 Bacteria 4223
214 Ga0207712_10055675 3300025961 Bacteria 2783
215 Ga0207712_10390808 3300025961 Bacteria 1167
216 Ga0207668_10774889 3300025972 Bacteria 848
217 Ga0207640_10132087 3300025981 Bacteria 1806
218 Ga0207658_10015593 3300025986 Bacteria 5214
219 Ga0207658_10047753 3300025986 Bacteria 3135
220 Ga0207658_10120578 3300025986 Bacteria 2090
221 Ga0207677_10014988 3300026023 Bacteria 4544
222 Ga0207677_10495900 3300026023 Bacteria 1055
223 Ga0207703_10007714 3300026035 Bacteria 8522
224 Ga0207703_10035598 3300026035 Bacteria 3956
225 Ga0207678_10013489 3300026067 Bacteria 7174
226 Ga0207678_10038377 3300026067 Bacteria 4162
227 Ga0207708_10011494 3300026075 Bacteria 6595
228 Ga0207708_10036029 3300026075 Bacteria 3765
229 Ga0207708_10098945 3300026075 Bacteria 2255
230 Ga0207641_10303971 3300026088 Bacteria 1507
231 Ga0207641_10393045 3300026088 Bacteria 1330
232 Ga0207648_10031933 3300026089 Bacteria 4652
233 Ga0207676_10036806 3300026095 Bacteria 3725
234 Ga0207674_10003711 3300026116 Bacteria 18650
235 Ga0207674_10107159 3300026116 Bacteria 2771
236 Ga0207675_100019186 3300026118 Bacteria 6381
237 Ga0207683_10012703 3300026121 Bacteria 7184
238 Ga0207683_10029030 3300026121 Bacteria 4787
239 Ga0207698_10026373 3300026142 Bacteria 4110
240 Ga0207428_10014236 3300027907 Bacteria 6919
241 Ga0207428_10020572 3300027907 Bacteria 5603
242 Ga0207428_10091444 3300027907 Bacteria 2362
243 Ga0207428_10161024 3300027907 Bacteria 1704
244 Ga0268266_10013044 3300028379 Bacteria 7166
245 Ga0268266_10048593 3300028379 Bacteria 3637
246 Ga0268266_10372729 3300028379 Bacteria 1345
247 Ga0268265_10695788 3300028380 Bacteria 981
248 Ga0268265_11059221 3300028380 Bacteria 803
249 Ga0268264_10006943 3300028381 Bacteria 9500
250 Ga0265338_10067798 3300028800 Unclassified 3079
251 Ga0307513_10002116 3300031456 Bacteria 27860
252 Ga0307513_10023601 3300031456 Bacteria 7182
253 Ga0326468_10000345 3300031889 Bacteria 4909
254 Ga0373956_0268379 3300035119 Bacteria 812
255 Ga0373960_0078299 3300035121 Unclassified 1036
256 Ga0373946_0058461 3300035171 Bacteria 1634
257 Ga0373961_0122106 3300035241 Unclassified 864
258 Ga0373935_0242414 3300035692 Bacteria 1259
259 Ga0373937_0094782 3300036401 Bacteria 2768
260 Ga0373925_0161393 3300037068 Bacteria 1766
261 Ga0395900_0029668 3300037418 Bacteria 5612
262 Ga0395898_0008000 3300037466 Bacteria 11219
263 Ga0395905_0175784 3300037471 Bacteria 2010
264 Ga0395905_0825015 3300037471 Bacteria 830
265 Ga0436364_0431017 3300037853 Bacteria 22054
266 Ga0436364_0708418 3300037853 Unclassified 1947
267 Ga0436364_1515026 3300037853 Bacteria 1009
268 Ga0395901_0002956 3300038443 Bacteria 17152
269 Ga0395901_0129255 3300038443 Bacteria 2654
270 Ga0395901_0451276 3300038443 Bacteria 1315
271 Ga0436365_0945109 3300039437 Bacteria 32440
272 Ga0436365_1688954 3300039437 Bacteria 2352
273 Ga0436362_0481613 3300039453 Bacteria 2565
274 Ga0436362_1245389 3300039453 Bacteria 2952
275 Ga0451787_108881 3300041441 Bacteria 2029
276 Ga0451789_0135687 3300041443 Bacteria 1699
277 Ga0451793_0046820 3300041452 Bacteria 4702
278 Ga0451797_0152092 3300041453 Bacteria 7806
279 Ga0451795_0988715 3300041456 Bacteria 4498
280 Ga0451837_1108925 3300041494 Bacteria 3179
281 Ga0451841_0988254 3300041498 Bacteria 980
282 Ga0451849_1563122 3300041505 Bacteria 2423
283 Ga0451853_0234180 3300041512 Bacteria 3394
284 Ga0439459_0009607 3300042438 Bacteria 1674
285 Ga0466964_0011549 3300044706 Bacteria 3338
286 Ga0466960_0025286 3300044901 Bacteria 2686
287 Ga0466960_0339271 3300044901 Bacteria 855
288 Ga0466958_0359795 3300045836 Bacteria 937
289 Ga0466967_0005206 3300045976 Bacteria 8956
290 Ga0466967_0018483 3300045976 Bacteria 5573
291 Ga0466967_0142300 3300045976 Bacteria 2235
292 Ga0466967_0304413 3300045976 Unclassified 1534
293 Ga0495592_0020799 3300046454 Bacteria 4992
294 Ga0495651_0004220 3300046462 Bacteria 11011
295 Ga0495653_0222580 3300046463 Bacteria 1268
296 Ga0495653_0336330 3300046463 Bacteria 974
297 Ga0495653_0346813 3300046463 Bacteria 956
298 Ga0495580_0185561 3300046472 Bacteria 1436
299 Ga0495582_0124909 3300046473 Bacteria 1452
300 Ga0495664_0062781 3300046477 Bacteria 2213
301 Ga0495664_0215373 3300046477 Bacteria 1163
302 Ga0495608_0016083 3300046511 Bacteria 5176
303 Ga0495608_0074923 3300046511 Bacteria 2206
304 Ga0495608_0210293 3300046511 Bacteria 1223
305 Ga0495608_0226684 3300046511 Bacteria 1171
306 Ga0495618_0016817 3300046514 Bacteria 4480
307 Ga0495628_0006709 3300046516 Bacteria 10036
308 Ga0495652_0006265 3300046529 Bacteria 11089
309 Ga0495640_0040874 3300046533 Bacteria 3244
310 Ga0495586_0090833 3300046535 Bacteria 1687
311 Ga0495586_0095198 3300046535 Bacteria 1648
312 Ga0495587_0152259 3300046536 Bacteria 1318
313 Ga0495621_0257188 3300046539 Bacteria 714
314 Ga0495645_0003920 3300046543 Bacteria 10142
315 Ga0495645_0149545 3300046543 Bacteria 1623
316 Ga0495667_0051362 3300046559 Bacteria 2720
317 Ga0495667_0124802 3300046559 Bacteria 1662
318 Ga0495634_0056925 3300046642 Bacteria 2611
319 Ga0495635_0045056 3300046663 Bacteria 3043
320 Ga0495635_0615196 3300046663 Bacteria 709
321 Ga0495657_0121547 3300046675 Bacteria 1644
322 Ga0495599_0124660 3300046678 Bacteria 1601
323 Ga0495658_0161957 3300046683 Bacteria 1380
324 Ga0495613_0353032 3300046689 Bacteria 1010
325 Ga0495613_0460782 3300046689 Bacteria 860
326 Ga0495670_0272146 3300046691 Bacteria 905
327 Ga0495600_0004949 3300046809 Bacteria 8001
328 Ga0495604_0043548 3300047317 Bacteria 3513
329 Ga0495604_0498524 3300047317 Bacteria 790
330 Ga0495674_0018246 3300047319 Bacteria 6533
331 Ga0495674_0563148 3300047319 Bacteria 906
332 Ga0495674_0741365 3300047319 Bacteria 768
333 Ga0495680_0014427 3300047322 Bacteria 6841
334 Ga0495680_0259665 3300047322 Bacteria 1229
335 Ga0495675_0000084 3300047444 Bacteria 66406
336 Ga0495684_0010399 3300047471 Bacteria 7196
337 Ga0495684_0029697 3300047471 Bacteria 4195
338 Ga0496100_0003348 3300048903 Bacteria 8349
339 Ga0496101_0113460 3300048904 Bacteria 2042
340 Ga0496102_0286522 3300048905 Bacteria 1552
341 Ga0496102_0719300 3300048905 Bacteria 921
342 Ga0496103_0447248 3300048906 Bacteria 829
343 Ga0496104_0004593 3300048907 Bacteria 12036
344 Ga0496104_0017034 3300048907 Bacteria 6612
345 Ga0496104_0237851 3300048907 Bacteria 1733
346 Ga0496105_0070367 3300048908 Bacteria 2892
347 Ga0496105_0081875 3300048908 Bacteria 2666
348 Ga0496106_0041201 3300048909 Bacteria 3460
349 Ga0496106_0045972 3300048909 Bacteria 3281
350 Ga0496107_0025215 3300048910 Bacteria 4208
351 Ga0496108_0001021 3300048911 Bacteria 21815
352 Ga0496108_0006849 3300048911 Bacteria 9221
353 Ga0496108_0050371 3300048911 Bacteria 3486
354 Ga0496108_0272416 3300048911 Bacteria 1473
355 Ga0496108_0340486 3300048911 Bacteria 1308
356 Ga0496108_0350194 3300048911 Bacteria 1289
357 Ga0496109_0002085 3300048912 Bacteria 16614
358 Ga0496109_0024125 3300048912 Bacteria 5404
359 Ga0496109_0064924 3300048912 Bacteria 3341
360 Ga0496109_0422040 3300048912 Bacteria 1260
361 Ga0496110_0009734 3300048913 Bacteria 7784
362 Ga0496110_0013658 3300048913 Bacteria 6725
363 Ga0496110_0038825 3300048913 Bacteria 4144
364 Ga0496110_0048778 3300048913 Bacteria 3712
365 Ga0496110_0167475 3300048913 Bacteria 1993
366 Ga0496111_0001622 3300048914 Bacteria 13022
367 Ga0496111_0079960 3300048914 Bacteria 2385
368 Ga0496111_0106570 3300048914 Bacteria 2063
369 Ga0496111_0171539 3300048914 Bacteria 1612
370 Ga0496111_0423059 3300048914 Bacteria 984
371 Ga0496112_0136251 3300048915 Bacteria 2425
372 Ga0496112_0499999 3300048915 Bacteria 1151
373 Ga0496113_0016143 3300048916 Bacteria 5154
374 Ga0496113_0626784 3300048916 Bacteria 861
375 Ga0496114_0119652 3300048917 Bacteria 2264
376 Ga0496114_0520391 3300048917 Bacteria 1052
377 Ga0496114_0606498 3300048917 Bacteria 965
378 Ga0496115_0037856 3300048918 Bacteria 3824
379 Ga0496115_0214420 3300048918 Bacteria 1590
380 Ga0496120_0110138 3300048923 Bacteria 1440
381 nmdc:mga03n38_42021_c3 3300050490 Bacteria 1018
382 nmdc:mga06z11_26461_c1 3300050494 Bacteria 2760
383 nmdc:mga05p37_42064_c1 3300050507 Bacteria 5613
384 nmdc:mga05p37_5096_c1 3300050507 Bacteria 15411
385 nmdc:mga05p37_8502_c1 3300050507 Bacteria 12132
386 nmdc:mga09592_1533_c1 3300050508 Bacteria 18612
387 nmdc:mga0qj67_88322_c1 3300050509 Bacteria 2489
388 nmdc:mga06r32_216658_c1 3300050510 Bacteria 1902
389 nmdc:mga06r32_577_c1 3300050510 Bacteria 31917
390 nmdc:mga08y16_18018_c1 3300050511 Bacteria 7439
391 nmdc:mga08y16_19232_c1 3300050511 Bacteria 7197
392 nmdc:mga08y16_20582_c1 3300050511 Bacteria 6964
393 nmdc:mga0n895_603452_c1 3300050512 Bacteria 1100
394 nmdc:mga0rr50_36861_c1 3300050513 Bacteria 3525
395 nmdc:mga0rr50_414485_c1 3300050513 Bacteria 1139
396 nmdc:mga0rr50_46725_c1 3300050513 Bacteria 3188
397 nmdc:mga0a205_19238_c1 3300050515 Bacteria 6435
398 nmdc:mga0a205_42973_c1 3300050515 Bacteria 3062
399 nmdc:mga0a205_482615_c1 3300050515 Bacteria 1098
400 Ga0495601_0020860 3300053077 Bacteria 4006
401 Ga0495595_0026665 3300053084 Bacteria 2569
402 Ga0495619_0017779 3300053085 Bacteria 4505
403 Ga0495619_0157577 3300053085 Bacteria 1567
404 Ga0500616_0001796 3300053153 Bacteria 19540
405 2819665772 2818991458 Bacteria 4794049
406 Ga0068868_100260928
407 JGI24752J21851_1003134
408 JGI24746J21847_1006638
409 JGI24743J22301_10029091
410 JGI24748J21848_1001534
411 JGI24749J21850_1021296
412 JGI24035J26624_1010332
413 JGI24034J26672_10003117
414 JGI24742J22300_10030464
415 JGI24751J29686_10006894
416 Ga0065712_10009489
417 Ga0065715_10119302
418 Ga0070658_10215640
419 Ga0070676_10071621
420 Ga0070683_100054067
421 Ga0070683_100069414
422 Ga0070683_100447789
423 Ga0070690_100063330
424 Ga0070677_10002649
425 Ga0068869_100018642
426 Ga0068869_100744352
427 Ga0070666_10004422
428 Ga0070666_10018391
429 Ga0070682_100119562
430 Ga0070682_100404834
431 Ga0068868_100062865
432 Ga0068868_100073102
433 Ga0068868_100692443
434 Ga0070660_100008189
435 Ga0070689_100000574
436 Ga0070689_100050895
437 Ga0070691_10270880
438 Ga0070687_100035564
439 Ga0070687_100111698
440 Ga0070692_10095409
441 Ga0070668_100382216
442 Ga0070674_100117151
443 Ga0070674_100147533
444 Ga0070674_100279613
445 Ga0070688_100242605
446 Ga0070659_100188281
447 Ga0070667_100019636
448 Ga0070667_100021524
449 Ga0070701_10004563
450 Ga0070705_100367338
451 Ga0070700_100070909
452 Ga0070700_100118344
453 Ga0070694_100085211
454 Ga0070663_100155714
455 Ga0070678_100114413
456 Ga0070662_100021737
457 Ga0070681_10035667
458 Ga0070685_10001734
459 Ga0070699_100021030
460 Ga0070699_100620266
461 Ga0070679_100046020
462 Ga0070679_100084673
463 Ga0070684_100062487
464 Ga0070684_100124857
465 Ga0070697_100022401
466 Ga0068853_100527705
467 Ga0070686_100486127
468 Ga0070665_100043916
469 Ga0070665_100061055
470 Ga0070665_100072390
471 Ga0070665_100107336
472 Ga0070704_100217398
473 Ga0070704_100425611
474 Ga0070664_100098955
475 Ga0068857_100013263
476 Ga0070702_100028509
477 Ga0068852_100859734
478 Ga0068859_100024646
479 Ga0068859_100348817
480 Ga0068864_100003661
481 Ga0068866_10038234
482 Ga0068861_100109565
483 Ga0068851_10002578
484 Ga0068851_10244629
485 Ga0068863_100221359
486 Ga0068863_100929588
487 Ga0068858_100046916
488 Ga0068858_100219116
489 Ga0068860_100016517
490 Ga0068860_100046705
491 Ga0081538_10000305
492 Ga0081539_10001103
493 Ga0075363_100278651
494 Ga0070716_100827180
495 Ga0075367_10340559
496 Ga0097621_100040446
497 Ga0068871_100026270
498 Ga0075428_100026691
499 Ga0075430_100008449
500 Ga0075431_100022210
501 Ga0075433_10465076
502 Ga0075434_100046172
503 Ga0075434_100066349
504 Ga0075429_100002605
505 Ga0068865_100293577
506 Ga0097620_100024645
507 Ga0097620_100348840
508 Ga0075435_100021218
509 Ga0075435_100055951
510 Ga0105240_10188717
511 Ga0105240_10560787
512 Ga0111539_10008914
513 Ga0111539_10010518
514 Ga0111539_10031897
515 Ga0111539_10255235
516 Ga0111539_10400726
517 Ga0105245_10008425
518 Ga0105245_10055467
519 Ga0105245_10072691
520 Ga0105245_10105147
521 Ga0105245_10156591
522 Ga0114129_10029653
523 Ga0114129_10173847
524 Ga0114129_10810475
525 Ga0105243_10081153
526 Ga0105242_10017481
527 Ga0105242_10112704
528 Ga0105242_10229382
529 Ga0105248_10010382
530 Ga0105248_10018766
531 Ga0105237_10020305
532 Ga0105249_10070790
533 Ga0105249_10120961
534 Ga0105239_10043937
535 Ga0105239_10686362
536 Ga0105246_10050554
537 Ga0105246_10146399
538 Ga0157327_1007061
539 Ga0157371_10024902
540 Ga0157370_10105810
541 Ga0157369_10036606
542 Ga0157369_10679111
543 Ga0157374_10099556
544 Ga0157378_10134365
545 Ga0163162_10070379
546 Ga0157372_10075653
547 Ga0157375_10050391
548 Ga0157375_10527281
549 Ga0163163_10018706
550 Ga0163163_10031009
551 Ga0157380_10004907
552 Ga0157380_10142653
553 Ga0182008_10149909
554 Ga0157377_10008764
555 Ga0157379_10021858
556 Ga0157379_10118237
557 Ga0157376_10010038
558 Ga0157376_10050209
559 Ga0157376_10258653
560 Ga0157376_10526455
561 Ga0163161_10064008
562 Ga0163161_10087356
563 Ga0163161_10371368
564 Ga0206354_10639923
565 Ga0206354_10690675
566 Ga0206353_11116863
567 Ga0213876_10215297
568 Ga0213875_10039697
569 Ga0224712_10007728
570 Ga0207666_1002617
571 Ga0207673_1002197
572 Ga0207697_10002094
573 Ga0207656_10035246
574 Ga0207682_10001906
575 Ga0207642_10007755
576 Ga0207710_10030662
577 Ga0207688_10002963
578 Ga0207680_10003135
579 Ga0207680_10067793
580 Ga0207645_10004819
581 Ga0207643_10001268
582 Ga0207684_10747260
583 Ga0207707_10025384
584 Ga0207707_10315573
585 Ga0207695_10011058
586 Ga0207660_10188425
587 Ga0207662_10009891
588 Ga0207657_10081060
589 Ga0207649_10077562
590 Ga0207652_10054570
591 Ga0207646_10022040
592 Ga0207646_10072045
593 Ga0207681_10218047
594 Ga0207650_10011837
595 Ga0207659_10011531
596 Ga0207687_10105520
597 Ga0207687_10124801
598 Ga0207644_10112146
599 Ga0207706_10012533
600 Ga0207706_10021214
601 Ga0207686_10050008
602 Ga0207686_10134784
603 Ga0207709_10041396
604 Ga0207670_10001883
605 Ga0207670_10009377
606 Ga0207669_10056964
607 Ga0207669_10295528
608 Ga0207704_10179847
609 Ga0207704_10662615
610 Ga0207691_10029235
611 Ga0207711_10028592
612 Ga0207711_10054118
613 Ga0207689_10007789
614 Ga0207689_10689930
615 Ga0207661_10033158
616 Ga0207661_10354924
617 Ga0207661_10467816
618 Ga0207651_10017625
619 Ga0207712_10055675
620 Ga0207712_10390808
621 Ga0207668_10774889
622 Ga0207640_10132087
623 Ga0207658_10015593
624 Ga0207658_10047753
625 Ga0207658_10120578
626 Ga0207677_10014988
627 Ga0207677_10495900
628 Ga0207703_10007714
629 Ga0207703_10035598
630 Ga0207678_10013489
631 Ga0207678_10038377
632 Ga0207708_10011494
633 Ga0207708_10036029
634 Ga0207708_10098945
635 Ga0207641_10303971
636 Ga0207641_10393045
637 Ga0207648_10031933
638 Ga0207676_10036806
639 Ga0207674_10003711
640 Ga0207674_10107159
641 Ga0207675_100019186
642 Ga0207683_10012703
643 Ga0207683_10029030
644 Ga0207698_10026373
645 Ga0207428_10014236
646 Ga0207428_10020572
647 Ga0207428_10091444
648 Ga0207428_10161024
649 Ga0268266_10013044
650 Ga0268266_10048593
651 Ga0268266_10372729
652 Ga0268265_10695788
653 Ga0268265_11059221
654 Ga0268264_10006943
655 Ga0265338_10067798
656 Ga0307513_10002116
657 Ga0307513_10023601
658 Ga0326468_10000345
659 Ga0373956_0268379
660 Ga0373960_0078299
661 Ga0373946_0058461
662 Ga0373961_0122106
663 Ga0373935_0242414
664 Ga0373937_0094782
665 Ga0373925_0161393
666 Ga0395900_0029668
667 Ga0395898_0008000
668 Ga0395905_0175784
669 Ga0395905_0825015
670 Ga0436364_0431017
671 Ga0436364_0708418
672 Ga0436364_1515026
673 Ga0395901_0002956
674 Ga0395901_0129255
675 Ga0395901_0451276
676 Ga0436365_0945109
677 Ga0436365_1688954
678 Ga0436362_0481613
679 Ga0436362_1245389
680 Ga0451787_108881
681 Ga0451789_0135687
682 Ga0451793_0046820
683 Ga0451797_0152092
684 Ga0451795_0988715
685 Ga0451837_1108925
686 Ga0451841_0988254
687 Ga0451849_1563122
688 Ga0451853_0234180
689 Ga0439459_0009607
690 Ga0466964_0011549
691 Ga0466960_0025286
692 Ga0466960_0339271
693 Ga0466958_0359795
694 Ga0466967_0005206
695 Ga0466967_0018483
696 Ga0466967_0142300
697 Ga0466967_0304413
698 Ga0495592_0020799
699 Ga0495651_0004220
700 Ga0495653_0222580
701 Ga0495653_0336330
702 Ga0495653_0346813
703 Ga0495580_0185561
704 Ga0495582_0124909
705 Ga0495664_0062781
706 Ga0495664_0215373
707 Ga0495608_0016083
708 Ga0495608_0074923
709 Ga0495608_0210293
710 Ga0495608_0226684
711 Ga0495618_0016817
712 Ga0495628_0006709
713 Ga0495652_0006265
714 Ga0495640_0040874
715 Ga0495586_0090833
716 Ga0495586_0095198
717 Ga0495587_0152259
718 Ga0495621_0257188
719 Ga0495645_0003920
720 Ga0495645_0149545
721 Ga0495667_0051362
722 Ga0495667_0124802
723 Ga0495634_0056925
724 Ga0495635_0045056
725 Ga0495635_0615196
726 Ga0495657_0121547
727 Ga0495599_0124660
728 Ga0495658_0161957
729 Ga0495613_0353032
730 Ga0495613_0460782
731 Ga0495670_0272146
732 Ga0495600_0004949
733 Ga0495604_0043548
734 Ga0495604_0498524
735 Ga0495674_0018246
736 Ga0495674_0563148
737 Ga0495674_0741365
738 Ga0495680_0014427
739 Ga0495680_0259665
740 Ga0495675_0000084
741 Ga0495684_0010399
742 Ga0495684_0029697
743 Ga0496100_0003348
744 Ga0496101_0113460
745 Ga0496102_0286522
746 Ga0496102_0719300
747 Ga0496103_0447248
748 Ga0496104_0004593
749 Ga0496104_0017034
750 Ga0496104_0237851
751 Ga0496105_0070367
752 Ga0496105_0081875
753 Ga0496106_0041201
754 Ga0496106_0045972
755 Ga0496107_0025215
756 Ga0496108_0001021
757 Ga0496108_0006849
758 Ga0496108_0050371
759 Ga0496108_0272416
760 Ga0496108_0340486
761 Ga0496108_0350194
762 Ga0496109_0002085
763 Ga0496109_0024125
764 Ga0496109_0064924
765 Ga0496109_0422040
766 Ga0496110_0009734
767 Ga0496110_0013658
768 Ga0496110_0038825
769 Ga0496110_0048778
770 Ga0496110_0167475
771 Ga0496111_0001622
772 Ga0496111_0079960
773 Ga0496111_0106570
774 Ga0496111_0171539
775 Ga0496111_0423059
776 Ga0496112_0136251
777 Ga0496112_0499999
778 Ga0496113_0016143
779 Ga0496113_0626784
780 Ga0496114_0119652
781 Ga0496114_0520391
782 Ga0496114_0606498
783 Ga0496115_0037856
784 Ga0496115_0214420
785 Ga0496120_0110138
786 nmdc:mga03n38_42021_c3
787 nmdc:mga06z11_26461_c1
788 nmdc:mga05p37_42064_c1
789 nmdc:mga05p37_5096_c1
790 nmdc:mga05p37_8502_c1
791 nmdc:mga09592_1533_c1
792 nmdc:mga0qj67_88322_c1
793 nmdc:mga06r32_216658_c1
794 nmdc:mga06r32_577_c1
795 nmdc:mga08y16_18018_c1
796 nmdc:mga08y16_19232_c1
797 nmdc:mga08y16_20582_c1
798 nmdc:mga0n895_603452_c1
799 nmdc:mga0rr50_36861_c1
800 nmdc:mga0rr50_414485_c1
801 nmdc:mga0rr50_46725_c1
802 nmdc:mga0a205_19238_c1
803 nmdc:mga0a205_42973_c1
804 nmdc:mga0a205_482615_c1
805 Ga0495601_0020860
806 Ga0495595_0026665
807 Ga0495619_0017779
808 Ga0495619_0157577
809 Ga0500616_0001796
810 2819665772

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

23

158

0.89

PF22677

Ble-like_N

Bleomycin resistance protein-like N-terminal

25

62

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zwy-assembly1.cif.gz_A ribokinase from leishmania donovani 0.954 201 231
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.8392 18 160
5ujp-assembly1.cif.gz_B the crystal structure of a glyoxalase/bleomycin resistance protein from streptomyces sp. cb03234 0.8235 22 159
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.8198 18 160
5ujp-assembly1.cif.gz_B the crystal structure of a glyoxalase/bleomycin resistance protein from streptomyces sp. cb03234 0.817 22 159
ID Description Score Start End Superfamily
5ujpB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8217 22 159 3.10.180.10
5ujpB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8151 22 159 3.10.180.10
4hc5C00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8011 19 159 3.10.180.10
af_A0A1X7YDR8_31_97_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7903 19 74 3.10.180.10
4hc5C00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7895 19 159 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A6B2DH88-F1-model_v4 VOC family protein 0.9602 19 168
AF-A0A6B2DH88-F1-model_v4 VOC family protein 0.9534 19 168
AF-A0A535B260-F1-model_v4 Glyoxalase 0.9527 19 110
AF-A0A0K1JFV7-F1-model_v4 Glyoxalase 0.9428 19 160
AF-A0A1Q7AUU4-F1-model_v4 Glyoxalase 0.9422 19 163

Map