F435786

General Info

Members Datasets Scaffolds Average Seq Length
404 200 808 277

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0074411|Ga0501031_0074411_1169_2086
Length 305
Sequence MTTSEPPAGGPPEQPIEPAEAIKKDHGRAGRDLRAAVTSAVVLVAAILVSLLFWKPAFMGIVAIAVVIAVWELHRGLSAKGVDIPEQPLMLGGVVMVVVAYVWGAPALVTATAVTALVIMLWLLRRGVDGYVKNATASVFTLVYVPFLASFVALLLGEGGTAPAFGLDVDDPGVRGVITFIAITVASDTGGYVAGVLFGKHPMAPVISPKKSWEGFAGSMVATIAVGVWLVSSFLGGDWWVGVLLGVIAAVMATLGDLCESVMKRDLGIKDMSQVIPGHGGLMDRLDSLLATVAPIWLVLYYLVF

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
57 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
85 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
86 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
87 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
88 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
89 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
92 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
93 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
94 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
101 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
102 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
103 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
104 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
105 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
106 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
107 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
108 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
109 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
110 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
111 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
112 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
119 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
120 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
121 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
122 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
123 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
127 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
128 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
150 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
151 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
154 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
155 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
156 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
157 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
158 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
159 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
160 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
163 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
164 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
166 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
167 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
168 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
169 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
170 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
171 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
172 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
173 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
174 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
175 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
176 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
177 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
178 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
180 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
181 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
182 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
183 2643221561 Nocardioides sp. Root151 Isolate Unclassified
184 2643221576 Nocardioides sp. Root614 Isolate Unclassified
185 2643221590 Nocardioides sp. Root682 Isolate Unclassified
186 2643221604 Nocardioides sp. Root190 Isolate Unclassified
187 2643221615 Nocardioides sp. Root224 Isolate Unclassified
188 2643221617 Nocardioides sp. Root79 Isolate Unclassified
189 2643221620 Nocardioides sp. Root240 Isolate Unclassified
190 2643221641 Nocardioides sp. Root122 Isolate Unclassified
191 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
192 2643221696 Nocardioides sp. Root140 Isolate Unclassified
193 2738541305 Nocardioides sp. CF167 Isolate Unclassified
194 2739367898 Nocardioides sp. CF479 Isolate Unclassified
195 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
196 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
197 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
198 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
199 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
200 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.05
Metatranscriptomes 0.5
Isolates 4.46

Biome Distribution

Category Percentage (%)
Aerial Root 0.5
Bulb 0
Endosphere 13.86
Nodule 0.25
Rhizoplane 7.43
Rhizosphere 73.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0074411 3300049568 Bacteria 2212
2 JGI24737J22298_10004996 3300001990 Bacteria 4597
3 Ga0070658_10023260 3300005327 Bacteria 4975
4 Ga0070658_10122041 3300005327 Bacteria 2165
5 Ga0070658_10173537 3300005327 Bacteria 1812
6 Ga0070683_100003306 3300005329 Bacteria 13039
7 Ga0070683_100011900 3300005329 Bacteria 7543
8 Ga0070680_100114317 3300005336 Bacteria 2249
9 Ga0070682_100149354 3300005337 Bacteria 1602
10 Ga0070682_100292944 3300005337 Bacteria 1191
11 Ga0070660_100014243 3300005339 Bacteria 5727
12 Ga0070692_10022131 3300005345 Bacteria 3102
13 Ga0070688_100054685 3300005365 Bacteria 2501
14 Ga0070659_100016220 3300005366 Bacteria 5591
15 Ga0070659_100028953 3300005366 Bacteria 4279
16 Ga0070659_100132401 3300005366 Bacteria 2026
17 Ga0070667_100335589 3300005367 Bacteria 1366
18 Ga0070708_100122725 3300005445 Bacteria 2398
19 Ga0070698_100002559 3300005471 Bacteria 20015
20 Ga0070679_100102291 3300005530 Bacteria 2851
21 Ga0070684_100052068 3300005535 Bacteria 3559
22 Ga0070684_100052965 3300005535 Bacteria 3530
23 Ga0070684_100263530 3300005535 Bacteria 1577
24 Ga0070672_100125763 3300005543 Bacteria 2103
25 Ga0070665_100001981 3300005548 Bacteria 23041
26 Ga0070664_100190516 3300005564 Bacteria 1827
27 Ga0068857_100031122 3300005577 Bacteria 4715
28 Ga0068854_100582323 3300005578 Bacteria 953
29 Ga0068856_100359886 3300005614 Bacteria 1474
30 Ga0070702_100170109 3300005615 Bacteria 1417
31 Ga0068852_100339501 3300005616 Bacteria 1464
32 Ga0068858_100105291 3300005842 Bacteria 2632
33 Ga0068860_100000403 3300005843 Bacteria 56312
34 Ga0068860_100029832 3300005843 Bacteria 5247
35 Ga0081455_10087331 3300005937 Bacteria 2537
36 Ga0075365_10000971 3300006038 Bacteria 12208
37 Ga0075365_10031127 3300006038 Bacteria 3421
38 Ga0075365_10056266 3300006038 Bacteria 2614
39 Ga0075365_10073315 3300006038 Bacteria 2307
40 Ga0075365_10125477 3300006038 Bacteria 1773
41 Ga0075365_10133080 3300006038 Bacteria 1722
42 Ga0075365_10160290 3300006038 Bacteria 1567
43 Ga0075365_10167619 3300006038 Bacteria 1532
44 Ga0075365_10264808 3300006038 Bacteria 1209
45 Ga0075368_10002653 3300006042 Bacteria 5881
46 Ga0075368_10006555 3300006042 Bacteria 4073
47 Ga0075368_10016809 3300006042 Bacteria 2729
48 Ga0075368_10018989 3300006042 Bacteria 2591
49 Ga0075363_100000563 3300006048 Bacteria 12115
50 Ga0075363_100002773 3300006048 Bacteria 7267
51 Ga0075363_100039655 3300006048 Bacteria 2479
52 Ga0075363_100050806 3300006048 Bacteria 2209
53 Ga0075363_100059586 3300006048 Bacteria 2053
54 Ga0075363_100073735 3300006048 Bacteria 1857
55 Ga0075364_10031580 3300006051 Bacteria 3402
56 Ga0075364_10032495 3300006051 Bacteria 3355
57 Ga0075364_10034863 3300006051 Bacteria 3250
58 Ga0075364_10035074 3300006051 Bacteria 3241
59 Ga0075364_10088245 3300006051 Bacteria 2056
60 Ga0075364_10193328 3300006051 Bacteria 1378
61 Ga0075367_10011325 3300006178 Bacteria 4715
62 Ga0075367_10027855 3300006178 Bacteria 3218
63 Ga0075367_10037623 3300006178 Bacteria 2813
64 Ga0075367_10065049 3300006178 Bacteria 2183
65 Ga0075370_10048445 3300006353 Bacteria 2407
66 Ga0075434_100118268 3300006871 Bacteria 2664
67 Ga0068865_100025601 3300006881 Bacteria 3883
68 Ga0111539_10109431 3300009094 Bacteria 3243
69 Ga0105245_10004744 3300009098 Bacteria 12003
70 Ga0105243_10072256 3300009148 Bacteria 2792
71 Ga0105248_10649405 3300009177 Bacteria 1190
72 Ga0105249_10439128 3300009553 Bacteria 1342
73 Ga0105239_10003188 3300010375 Bacteria 20302
74 Ga0105239_10034294 3300010375 Bacteria 5572
75 Ga0105246_10003761 3300011119 Bacteria 9196
76 Ga0105246_10378406 3300011119 Bacteria 1169
77 Ga0157371_10135836 3300013102 Bacteria 1751
78 Ga0157370_10107617 3300013104 Bacteria 2607
79 Ga0157369_10086284 3300013105 Bacteria 3352
80 Ga0163162_10044126 3300013306 Bacteria 4465
81 Ga0163162_10576806 3300013306 Bacteria 1252
82 Ga0157372_10019307 3300013307 Bacteria 7342
83 Ga0157372_10108234 3300013307 Bacteria 3181
84 Ga0157372_10533139 3300013307 Bacteria 1368
85 Ga0157372_10591232 3300013307 Bacteria 1294
86 Ga0157372_10593895 3300013307 Bacteria 1290
87 Ga0157375_10016370 3300013308 Bacteria 6658
88 Ga0157375_10037050 3300013308 Bacteria 4670
89 Ga0157375_10071449 3300013308 Bacteria 3484
90 Ga0163163_10087963 3300014325 Bacteria 3118
91 Ga0163163_10267969 3300014325 Bacteria 1759
92 Ga0157380_10078564 3300014326 Bacteria 2692
93 Ga0157380_10329602 3300014326 Bacteria 1419
94 Ga0157380_10531069 3300014326 Bacteria 1150
95 Ga0182008_10204613 3300014497 Bacteria 1005
96 Ga0157377_10017399 3300014745 Bacteria 3717
97 Ga0157377_10253486 3300014745 Bacteria 1142
98 Ga0157379_10008363 3300014968 Bacteria 8992
99 Ga0157376_10644444 3300014969 Bacteria 1059
100 Ga0163161_10044129 3300017792 Bacteria 3211
101 Ga0163161_10181162 3300017792 Bacteria 1615
102 Ga0163161_10189926 3300017792 Bacteria 1579
103 Ga0206353_11757438 3300020082 Bacteria 1122
104 Ga0206353_12042388 3300020082 Bacteria 2364
105 Ga0213875_10101446 3300021388 Bacteria 1343
106 Ga0207647_10004003 3300025904 Bacteria 10991
107 Ga0207647_10018747 3300025904 Bacteria 4670
108 Ga0207647_10023720 3300025904 Bacteria 4053
109 Ga0207660_10049712 3300025917 Bacteria 2974
110 Ga0207657_10011519 3300025919 Bacteria 8779
111 Ga0207657_10077087 3300025919 Bacteria 2811
112 Ga0207652_10064798 3300025921 Bacteria 3162
113 Ga0207652_10151278 3300025921 Bacteria 2078
114 Ga0207694_10318866 3300025924 Bacteria 1282
115 Ga0207659_10310590 3300025926 Bacteria 1298
116 Ga0207687_10002553 3300025927 Bacteria 12368
117 Ga0207664_10039435 3300025929 Bacteria 3667
118 Ga0207690_10019304 3300025932 Bacteria 4195
119 Ga0207690_10157939 3300025932 Bacteria 1687
120 Ga0207709_10158555 3300025935 Bacteria 1576
121 Ga0207709_10275145 3300025935 Bacteria 1241
122 Ga0207704_10011208 3300025938 Bacteria 4406
123 Ga0207711_10271351 3300025941 Bacteria 1561
124 Ga0207661_10004926 3300025944 Bacteria 9362
125 Ga0207661_10030164 3300025944 Bacteria 4174
126 Ga0207661_10165159 3300025944 Bacteria 1923
127 Ga0207661_10503248 3300025944 Bacteria 1107
128 Ga0207661_10584448 3300025944 Bacteria 1024
129 Ga0207668_10082330 3300025972 Bacteria 2338
130 Ga0207640_10254991 3300025981 Bacteria 1364
131 Ga0207658_10157419 3300025986 Bacteria 1858
132 Ga0207658_10331838 3300025986 Bacteria 1319
133 Ga0207677_10054876 3300026023 Bacteria 2722
134 Ga0207677_10103405 3300026023 Bacteria 2103
135 Ga0207677_10315667 3300026023 Bacteria 1297
136 Ga0207703_10046791 3300026035 Bacteria 3486
137 Ga0207708_10021328 3300026075 Bacteria 4884
138 Ga0207702_10397364 3300026078 Bacteria 1329
139 Ga0207674_10046009 3300026116 Bacteria 4484
140 Ga0207674_10238855 3300026116 Bacteria 1764
141 Ga0207683_10043239 3300026121 Bacteria 3937
142 Ga0209813_10001987 3300027866 Bacteria 4625
143 Ga0209813_10002962 3300027866 Bacteria 3933
144 Ga0209813_10012448 3300027866 Bacteria 2249
145 Ga0209813_10040090 3300027866 Bacteria 1422
146 Ga0207428_10317183 3300027907 Bacteria 1152
147 Ga0268266_10001699 3300028379 Bacteria 25235
148 Ga0268264_10000355 3300028381 Bacteria 68889
149 Ga0268264_10021303 3300028381 Bacteria 5294
150 Ga0307408_100126941 3300031548 Bacteria 1985
151 Ga0307408_100635373 3300031548 Bacteria 953
152 Ga0307405_10042400 3300031731 Bacteria 2770
153 Ga0307405_10475470 3300031731 Bacteria 996
154 Ga0307413_10460521 3300031824 Bacteria 1011
155 Ga0307410_10055335 3300031852 Bacteria 2693
156 Ga0307406_10060136 3300031901 Bacteria 2449
157 Ga0307406_10081579 3300031901 Bacteria 2151
158 Ga0307407_10022943 3300031903 Bacteria 3248
159 Ga0307407_10023957 3300031903 Bacteria 3192
160 Ga0307407_10270867 3300031903 Bacteria 1172
161 Ga0307407_10328882 3300031903 Bacteria 1075
162 Ga0307412_10062218 3300031911 Bacteria 2512
163 Ga0307409_100022774 3300031995 Bacteria 4324
164 Ga0307409_100094817 3300031995 Bacteria 2457
165 Ga0307409_100247924 3300031995 Bacteria 1626
166 Ga0307409_100450625 3300031995 Bacteria 1242
167 Ga0307416_100020281 3300032002 Bacteria 4739
168 Ga0307416_100051519 3300032002 Bacteria 3289
169 Ga0307416_100224324 3300032002 Bacteria 1805
170 Ga0307416_100332163 3300032002 Bacteria 1528
171 Ga0307414_10088432 3300032004 Bacteria 2293
172 Ga0307414_10479158 3300032004 Bacteria 1097
173 Ga0307411_10119469 3300032005 Bacteria 1904
174 Ga0307411_10287040 3300032005 Bacteria 1313
175 Ga0307415_100001845 3300032126 Bacteria 10397
176 Ga0307415_100052219 3300032126 Bacteria 2778
177 Ga0307415_100215278 3300032126 Bacteria 1536
178 Ga0307415_100251801 3300032126 Bacteria 1435
179 Ga0307415_100487529 3300032126 Bacteria 1075
180 Ga0395900_0172371 3300037418 Bacteria 2202
181 Ga0395898_0014466 3300037466 Bacteria 8104
182 Ga0395905_0354163 3300037471 Bacteria 1360
183 Ga0436364_0138886 3300037853 Bacteria 3287
184 Ga0395901_0285602 3300038443 Bacteria 1713
185 Ga0451791_0464199 3300041451 Bacteria 1302
186 Ga0451839_1443106 3300041496 Bacteria 911
187 Ga0439442_009799 3300042002 Bacteria 1938
188 Ga0439448_0087262 3300042005 Bacteria 1052
189 Ga0466972_0026208 3300044658 Bacteria 2889
190 Ga0466972_0039144 3300044658 Bacteria 2315
191 Ga0466972_0074882 3300044658 Bacteria 1613
192 Ga0466972_0093674 3300044658 Bacteria 1424
193 Ga0466966_0023493 3300044684 Bacteria 4036
194 Ga0466966_0034946 3300044684 Bacteria 3249
195 Ga0466961_0045234 3300044693 Bacteria 2816
196 Ga0466961_0048126 3300044693 Bacteria 2725
197 Ga0466961_0063476 3300044693 Bacteria 2347
198 Ga0466961_0091464 3300044693 Bacteria 1921
199 Ga0466963_0003403 3300044694 Bacteria 9100
200 Ga0466963_0038976 3300044694 Bacteria 3110
201 Ga0466963_0042330 3300044694 Bacteria 2990
202 Ga0466963_0090954 3300044694 Bacteria 2078
203 Ga0466963_0116106 3300044694 Bacteria 1840
204 Ga0466963_0129178 3300044694 Bacteria 1744
205 Ga0466964_0004880 3300044706 Bacteria 4955
206 Ga0466964_0149550 3300044706 Bacteria 1081
207 Ga0466971_0008969 3300044719 Bacteria 4372
208 Ga0466971_0029127 3300044719 Bacteria 2469
209 Ga0466970_0007055 3300044765 Bacteria 5620
210 Ga0466970_0022153 3300044765 Bacteria 3316
211 Ga0466970_0031784 3300044765 Bacteria 2788
212 Ga0466970_0257481 3300044765 Bacteria 978
213 Ga0466957_0005834 3300044842 Bacteria 6932
214 Ga0466957_0039178 3300044842 Bacteria 2859
215 Ga0466957_0052873 3300044842 Bacteria 2475
216 Ga0466957_0055236 3300044842 Bacteria 2427
217 Ga0466957_0177017 3300044842 Bacteria 1391
218 Ga0466960_0008141 3300044901 Bacteria 4284
219 Ga0466960_0012986 3300044901 Bacteria 3528
220 Ga0466960_0014186 3300044901 Bacteria 3404
221 Ga0466960_0024038 3300044901 Bacteria 2744
222 Ga0466960_0059758 3300044901 Bacteria 1866
223 Ga0466960_0108088 3300044901 Bacteria 1441
224 Ga0466960_0110506 3300044901 Bacteria 1427
225 Ga0466960_0112733 3300044901 Bacteria 1415
226 Ga0466960_0120970 3300044901 Bacteria 1371
227 Ga0466960_0182386 3300044901 Bacteria 1138
228 Ga0466959_0014225 3300045049 Bacteria 5774
229 Ga0451576_0031672 3300045051 Bacteria 5637
230 Ga0466958_0020266 3300045836 Bacteria 3877
231 Ga0466958_0080628 3300045836 Bacteria 2002
232 Ga0466958_0098729 3300045836 Bacteria 1813
233 Ga0466958_0151993 3300045836 Bacteria 1460
234 Ga0466967_0004927 3300045976 Bacteria 9127
235 Ga0466967_0061602 3300045976 Bacteria 3329
236 Ga0466967_0096134 3300045976 Bacteria 2701
237 Ga0466967_0111634 3300045976 Bacteria 2512
238 Ga0466967_0115538 3300045976 Bacteria 2471
239 Ga0466967_0122197 3300045976 Bacteria 2408
240 Ga0466967_0140581 3300045976 Bacteria 2248
241 Ga0466967_0143435 3300045976 Bacteria 2226
242 Ga0466967_0213727 3300045976 Bacteria 1830
243 Ga0466967_0354338 3300045976 Bacteria 1421
244 Ga0495629_0152573 3300046459 Bacteria 1606
245 Ga0495582_0260904 3300046473 Bacteria 994
246 Ga0495664_0235244 3300046477 Bacteria 1108
247 Ga0495596_0131125 3300046500 Bacteria 973
248 Ga0495667_0290982 3300046559 Bacteria 1036
249 Ga0495676_0223577 3300047321 Bacteria 1296
250 Ga0496101_0187527 3300048904 Bacteria 1595
251 Ga0496101_0418442 3300048904 Bacteria 1056
252 Ga0496102_0005200 3300048905 Bacteria 11048
253 Ga0496102_0058630 3300048905 Bacteria 3518
254 Ga0496102_0096724 3300048905 Bacteria 2738
255 Ga0496104_0104307 3300048907 Bacteria 2717
256 Ga0496105_0139035 3300048908 Bacteria 2000
257 Ga0496106_0024706 3300048909 Bacteria 4468
258 Ga0496107_0075892 3300048910 Bacteria 2447
259 Ga0496107_0119010 3300048910 Bacteria 1945
260 Ga0496108_0184600 3300048911 Bacteria 1806
261 Ga0496109_0009349 3300048912 Bacteria 8350
262 Ga0496109_0060900 3300048912 Bacteria 3450
263 Ga0496109_0306527 3300048912 Bacteria 1498
264 Ga0496110_0007280 3300048913 Bacteria 8823
265 Ga0496110_0062909 3300048913 Bacteria 3279
266 Ga0496110_0123312 3300048913 Bacteria 2336
267 Ga0496111_0026311 3300048914 Bacteria 4107
268 Ga0496111_0032748 3300048914 Bacteria 3706
269 Ga0496113_0051697 3300048916 Bacteria 3067
270 Ga0496113_0126893 3300048916 Bacteria 1999
271 Ga0496114_0002538 3300048917 Bacteria 13934
272 Ga0496114_0085180 3300048917 Bacteria 2677
273 Ga0496114_0123013 3300048917 Bacteria 2233
274 Ga0496114_0126284 3300048917 Bacteria 2205
275 Ga0496114_0222104 3300048917 Bacteria 1659
276 Ga0496114_0319467 3300048917 Bacteria 1372
277 Ga0496114_0327037 3300048917 Bacteria 1355
278 Ga0496115_0029242 3300048918 Bacteria 4326
279 Ga0496124_0307502 3300048927 Bacteria 1142
280 Ga0501031_0031805 3300049568 Bacteria 3442
281 Ga0501032_0140136 3300049569 Bacteria 1593
282 Ga0501034_0039170 3300049571 Bacteria 4802
283 Ga0501034_0039340 3300049571 Bacteria 4790
284 Ga0501036_0017294 3300049572 Bacteria 6026
285 Ga0501036_0073167 3300049572 Bacteria 2898
286 Ga0501036_0186103 3300049572 Bacteria 1748
287 Ga0501036_0273902 3300049572 Bacteria 1413
288 Ga0501036_0397107 3300049572 Bacteria 1150
289 Ga0501037_0328822 3300049573 Bacteria 1057
290 Ga0501038_0056161 3300049574 Bacteria 3381
291 Ga0501038_0147553 3300049574 Bacteria 1919
292 Ga0501038_0223477 3300049574 Bacteria 1501
293 Ga0501038_0244729 3300049574 Bacteria 1423
294 Ga0501038_0362596 3300049574 Bacteria 1127
295 Ga0501039_0019976 3300049575 Bacteria 5135
296 Ga0501039_0040810 3300049575 Bacteria 3582
297 Ga0501040_0036928 3300049576 Bacteria 3317
298 Ga0501040_0063552 3300049576 Bacteria 2540
299 Ga0501040_0339747 3300049576 Bacteria 1075
300 Ga0501041_0046296 3300049577 Bacteria 2646
301 Ga0501041_0156049 3300049577 Bacteria 1426
302 Ga0501042_0134954 3300049578 Bacteria 1779
303 Ga0501042_0227038 3300049578 Bacteria 1347
304 Ga0501043_0019484 3300049579 Bacteria 5325
305 Ga0501047_0032631 3300049581 Bacteria 5028
306 Ga0501048_0092586 3300049582 Bacteria 2132
307 Ga0501048_0222954 3300049582 Bacteria 1337
308 Ga0501067_0006124 3300049583 Bacteria 6670
309 Ga0501067_0006563 3300049583 Bacteria 6448
310 Ga0501067_0012136 3300049583 Bacteria 4776
311 Ga0501067_0014285 3300049583 Bacteria 4396
312 Ga0501067_0133297 3300049583 Bacteria 1383
313 Ga0501067_0140689 3300049583 Bacteria 1344
314 Ga0501068_0027545 3300049584 Bacteria 3356
315 Ga0501068_0034522 3300049584 Bacteria 3016
316 Ga0501068_0083597 3300049584 Bacteria 1962
317 Ga0501068_0104863 3300049584 Bacteria 1754
318 Ga0501069_0025624 3300049585 Bacteria 3225
319 Ga0501069_0040261 3300049585 Bacteria 2583
320 Ga0501069_0132859 3300049585 Bacteria 1426
321 Ga0501070_0013892 3300049586 Bacteria 6780
322 Ga0501070_0052480 3300049586 Bacteria 3384
323 Ga0501070_0093443 3300049586 Bacteria 2488
324 Ga0501070_0222769 3300049586 Bacteria 1546
325 Ga0501070_0226947 3300049586 Bacteria 1531
326 Ga0501071_0000958 3300049587 Bacteria 15721
327 Ga0501071_0066867 3300049587 Bacteria 2613
328 Ga0501071_0104792 3300049587 Bacteria 2087
329 Ga0501071_0181306 3300049587 Bacteria 1578
330 Ga0501072_0041444 3300049588 Bacteria 3616
331 Ga0501072_0047824 3300049588 Bacteria 3369
332 Ga0501073_0011427 3300049589 Bacteria 6496
333 Ga0501073_0068329 3300049589 Bacteria 2476
334 Ga0501074_0019354 3300049590 Bacteria 4945
335 Ga0501074_0114053 3300049590 Bacteria 1933
336 Ga0501074_0191459 3300049590 Bacteria 1458
337 Ga0501074_0204064 3300049590 Bacteria 1408
338 Ga0501075_0202208 3300049591 Bacteria 1515
339 Ga0501075_0337745 3300049591 Bacteria 1148
340 Ga0501075_0406108 3300049591 Bacteria 1038
341 Ga0501076_0032671 3300049592 Bacteria 4062
342 Ga0501076_0065807 3300049592 Bacteria 2891
343 Ga0501076_0279021 3300049592 Bacteria 1369
344 Ga0501077_0027335 3300049593 Bacteria 3623
345 Ga0501077_0117753 3300049593 Bacteria 1684
346 Ga0501079_0006212 3300049741 Bacteria 8965
347 Ga0501079_0026169 3300049741 Bacteria 4473
348 Ga0501080_0035472 3300049742 Bacteria 4654
349 Ga0501080_0040336 3300049742 Bacteria 4354
350 Ga0501080_0300287 3300049742 Bacteria 1457
351 Ga0501081_0017780 3300049743 Bacteria 4712
352 Ga0501083_0001603 3300049744 Bacteria 15466
353 Ga0501035_0101211 3300049822 Bacteria 2529
354 Ga0501045_0069581 3300049824 Bacteria 2588
355 Ga0501045_0499974 3300049824 Bacteria 903
356 nmdc:mga03683_1607_c1 3300050489 Bacteria 6763
357 nmdc:mga03n38_231322_c1 3300050490 Bacteria 969
358 nmdc:mga03n38_54726_c1 3300050490 Bacteria 1795
359 nmdc:mga00v17_166133_c1 3300050491 Bacteria 1422
360 nmdc:mga00v17_220524_c1 3300050491 Bacteria 1228
361 nmdc:mga00v17_30341_c1 3300050491 Bacteria 3181
362 nmdc:mga00v17_43967_c1 3300050491 Bacteria 2692
363 nmdc:mga00v17_58156_c1 3300050491 Bacteria 2367
364 nmdc:mga00v17_6774_c1 3300050491 Bacteria 6088
365 nmdc:mga0yw44_39482_c1 3300050492 Bacteria 2800
366 nmdc:mga0yw44_51656_c1 3300050492 Bacteria 2490
367 nmdc:mga0yw44_5829_c1 3300050492 Bacteria 5878
368 nmdc:mga0yw44_9383_c1 3300050492 Bacteria 4942
369 nmdc:mga06z11_25864_c1 3300050494 Bacteria 2787
370 nmdc:mga04h51_14554_c1 3300050495 Bacteria 2250
371 nmdc:mga04h51_28234_c1 3300050495 Bacteria 1749
372 nmdc:mga04h51_3774_c1 3300050495 Bacteria 3715
373 nmdc:mga07m45_4651_c1 3300050496 Bacteria 6735
374 Ga0495595_0036445 3300053084 Bacteria 2232
375 Ga0495619_0036687 3300053085 Bacteria 3193
376 Ga0500644_0000262 3300053088 Bacteria 29710
377 Ga0500554_024272 3300053102 Bacteria 1716
378 Ga0500593_000198 3300053117 Bacteria 24426
379 Ga0500573_0067222 3300053140 Bacteria 2048
380 Ga0501084_0293731 3300054114 Bacteria 1372
381 Ga0501084_0528774 3300054114 Bacteria 997
382 Ga0501082_0026502 3300060353 Bacteria 4996
383 Ga0501082_0061641 3300060353 Bacteria 3229
384 Ga0501082_0065042 3300060353 Bacteria 3140
385 Ga0466962_0039827 3300061719 Bacteria 2249
386 Ga0530510_0185678 3300061734 Bacteria 1543
387 2643825402 2643221561 Bacteria 4984412
388 2643893094 2643221576 Bacteria 5214352
389 2643961847 2643221590 Bacteria 5214697
390 2644034157 2643221604 Bacteria 5014917
391 2644089807 2643221615 Bacteria 5487866
392 2644102469 2643221617 Bacteria 5139111
393 2644118132 2643221620 Bacteria 5134593
394 2644229078 2643221641 Bacteria 4490190
395 2644319652 2643221657 Bacteria 5490246
396 2644531397 2643221696 Bacteria 5431823
397 2738871373 2738541305 Bacteria 4910150
398 2740166824 2739367898 Bacteria 4367674
399 2812333773 2811994874 Bacteria 5367947
400 2855387637 2855386786 Bacteria 4752232
401 2857483473 2857481737 Bacteria 4761446
402 2984577041 2984576629 Bacteria 4248407
403 2990258788 2990256926 Bacteria 4252839
404 8054612556 8054609563 Bacteria 5170090
405 Ga0501031_0074411
406 JGI24737J22298_10004996
407 Ga0070658_10023260
408 Ga0070658_10122041
409 Ga0070658_10173537
410 Ga0070683_100003306
411 Ga0070683_100011900
412 Ga0070680_100114317
413 Ga0070682_100149354
414 Ga0070682_100292944
415 Ga0070660_100014243
416 Ga0070692_10022131
417 Ga0070688_100054685
418 Ga0070659_100016220
419 Ga0070659_100028953
420 Ga0070659_100132401
421 Ga0070667_100335589
422 Ga0070708_100122725
423 Ga0070698_100002559
424 Ga0070679_100102291
425 Ga0070684_100052068
426 Ga0070684_100052965
427 Ga0070684_100263530
428 Ga0070672_100125763
429 Ga0070665_100001981
430 Ga0070664_100190516
431 Ga0068857_100031122
432 Ga0068854_100582323
433 Ga0068856_100359886
434 Ga0070702_100170109
435 Ga0068852_100339501
436 Ga0068858_100105291
437 Ga0068860_100000403
438 Ga0068860_100029832
439 Ga0081455_10087331
440 Ga0075365_10000971
441 Ga0075365_10031127
442 Ga0075365_10056266
443 Ga0075365_10073315
444 Ga0075365_10125477
445 Ga0075365_10133080
446 Ga0075365_10160290
447 Ga0075365_10167619
448 Ga0075365_10264808
449 Ga0075368_10002653
450 Ga0075368_10006555
451 Ga0075368_10016809
452 Ga0075368_10018989
453 Ga0075363_100000563
454 Ga0075363_100002773
455 Ga0075363_100039655
456 Ga0075363_100050806
457 Ga0075363_100059586
458 Ga0075363_100073735
459 Ga0075364_10031580
460 Ga0075364_10032495
461 Ga0075364_10034863
462 Ga0075364_10035074
463 Ga0075364_10088245
464 Ga0075364_10193328
465 Ga0075367_10011325
466 Ga0075367_10027855
467 Ga0075367_10037623
468 Ga0075367_10065049
469 Ga0075370_10048445
470 Ga0075434_100118268
471 Ga0068865_100025601
472 Ga0111539_10109431
473 Ga0105245_10004744
474 Ga0105243_10072256
475 Ga0105248_10649405
476 Ga0105249_10439128
477 Ga0105239_10003188
478 Ga0105239_10034294
479 Ga0105246_10003761
480 Ga0105246_10378406
481 Ga0157371_10135836
482 Ga0157370_10107617
483 Ga0157369_10086284
484 Ga0163162_10044126
485 Ga0163162_10576806
486 Ga0157372_10019307
487 Ga0157372_10108234
488 Ga0157372_10533139
489 Ga0157372_10591232
490 Ga0157372_10593895
491 Ga0157375_10016370
492 Ga0157375_10037050
493 Ga0157375_10071449
494 Ga0163163_10087963
495 Ga0163163_10267969
496 Ga0157380_10078564
497 Ga0157380_10329602
498 Ga0157380_10531069
499 Ga0182008_10204613
500 Ga0157377_10017399
501 Ga0157377_10253486
502 Ga0157379_10008363
503 Ga0157376_10644444
504 Ga0163161_10044129
505 Ga0163161_10181162
506 Ga0163161_10189926
507 Ga0206353_11757438
508 Ga0206353_12042388
509 Ga0213875_10101446
510 Ga0207647_10004003
511 Ga0207647_10018747
512 Ga0207647_10023720
513 Ga0207660_10049712
514 Ga0207657_10011519
515 Ga0207657_10077087
516 Ga0207652_10064798
517 Ga0207652_10151278
518 Ga0207694_10318866
519 Ga0207659_10310590
520 Ga0207687_10002553
521 Ga0207664_10039435
522 Ga0207690_10019304
523 Ga0207690_10157939
524 Ga0207709_10158555
525 Ga0207709_10275145
526 Ga0207704_10011208
527 Ga0207711_10271351
528 Ga0207661_10004926
529 Ga0207661_10030164
530 Ga0207661_10165159
531 Ga0207661_10503248
532 Ga0207661_10584448
533 Ga0207668_10082330
534 Ga0207640_10254991
535 Ga0207658_10157419
536 Ga0207658_10331838
537 Ga0207677_10054876
538 Ga0207677_10103405
539 Ga0207677_10315667
540 Ga0207703_10046791
541 Ga0207708_10021328
542 Ga0207702_10397364
543 Ga0207674_10046009
544 Ga0207674_10238855
545 Ga0207683_10043239
546 Ga0209813_10001987
547 Ga0209813_10002962
548 Ga0209813_10012448
549 Ga0209813_10040090
550 Ga0207428_10317183
551 Ga0268266_10001699
552 Ga0268264_10000355
553 Ga0268264_10021303
554 Ga0307408_100126941
555 Ga0307408_100635373
556 Ga0307405_10042400
557 Ga0307405_10475470
558 Ga0307413_10460521
559 Ga0307410_10055335
560 Ga0307406_10060136
561 Ga0307406_10081579
562 Ga0307407_10022943
563 Ga0307407_10023957
564 Ga0307407_10270867
565 Ga0307407_10328882
566 Ga0307412_10062218
567 Ga0307409_100022774
568 Ga0307409_100094817
569 Ga0307409_100247924
570 Ga0307409_100450625
571 Ga0307416_100020281
572 Ga0307416_100051519
573 Ga0307416_100224324
574 Ga0307416_100332163
575 Ga0307414_10088432
576 Ga0307414_10479158
577 Ga0307411_10119469
578 Ga0307411_10287040
579 Ga0307415_100001845
580 Ga0307415_100052219
581 Ga0307415_100215278
582 Ga0307415_100251801
583 Ga0307415_100487529
584 Ga0395900_0172371
585 Ga0395898_0014466
586 Ga0395905_0354163
587 Ga0436364_0138886
588 Ga0395901_0285602
589 Ga0451791_0464199
590 Ga0451839_1443106
591 Ga0439442_009799
592 Ga0439448_0087262
593 Ga0466972_0026208
594 Ga0466972_0039144
595 Ga0466972_0074882
596 Ga0466972_0093674
597 Ga0466966_0023493
598 Ga0466966_0034946
599 Ga0466961_0045234
600 Ga0466961_0048126
601 Ga0466961_0063476
602 Ga0466961_0091464
603 Ga0466963_0003403
604 Ga0466963_0038976
605 Ga0466963_0042330
606 Ga0466963_0090954
607 Ga0466963_0116106
608 Ga0466963_0129178
609 Ga0466964_0004880
610 Ga0466964_0149550
611 Ga0466971_0008969
612 Ga0466971_0029127
613 Ga0466970_0007055
614 Ga0466970_0022153
615 Ga0466970_0031784
616 Ga0466970_0257481
617 Ga0466957_0005834
618 Ga0466957_0039178
619 Ga0466957_0052873
620 Ga0466957_0055236
621 Ga0466957_0177017
622 Ga0466960_0008141
623 Ga0466960_0012986
624 Ga0466960_0014186
625 Ga0466960_0024038
626 Ga0466960_0059758
627 Ga0466960_0108088
628 Ga0466960_0110506
629 Ga0466960_0112733
630 Ga0466960_0120970
631 Ga0466960_0182386
632 Ga0466959_0014225
633 Ga0451576_0031672
634 Ga0466958_0020266
635 Ga0466958_0080628
636 Ga0466958_0098729
637 Ga0466958_0151993
638 Ga0466967_0004927
639 Ga0466967_0061602
640 Ga0466967_0096134
641 Ga0466967_0111634
642 Ga0466967_0115538
643 Ga0466967_0122197
644 Ga0466967_0140581
645 Ga0466967_0143435
646 Ga0466967_0213727
647 Ga0466967_0354338
648 Ga0495629_0152573
649 Ga0495582_0260904
650 Ga0495664_0235244
651 Ga0495596_0131125
652 Ga0495667_0290982
653 Ga0495676_0223577
654 Ga0496101_0187527
655 Ga0496101_0418442
656 Ga0496102_0005200
657 Ga0496102_0058630
658 Ga0496102_0096724
659 Ga0496104_0104307
660 Ga0496105_0139035
661 Ga0496106_0024706
662 Ga0496107_0075892
663 Ga0496107_0119010
664 Ga0496108_0184600
665 Ga0496109_0009349
666 Ga0496109_0060900
667 Ga0496109_0306527
668 Ga0496110_0007280
669 Ga0496110_0062909
670 Ga0496110_0123312
671 Ga0496111_0026311
672 Ga0496111_0032748
673 Ga0496113_0051697
674 Ga0496113_0126893
675 Ga0496114_0002538
676 Ga0496114_0085180
677 Ga0496114_0123013
678 Ga0496114_0126284
679 Ga0496114_0222104
680 Ga0496114_0319467
681 Ga0496114_0327037
682 Ga0496115_0029242
683 Ga0496124_0307502
684 Ga0501031_0031805
685 Ga0501032_0140136
686 Ga0501034_0039170
687 Ga0501034_0039340
688 Ga0501036_0017294
689 Ga0501036_0073167
690 Ga0501036_0186103
691 Ga0501036_0273902
692 Ga0501036_0397107
693 Ga0501037_0328822
694 Ga0501038_0056161
695 Ga0501038_0147553
696 Ga0501038_0223477
697 Ga0501038_0244729
698 Ga0501038_0362596
699 Ga0501039_0019976
700 Ga0501039_0040810
701 Ga0501040_0036928
702 Ga0501040_0063552
703 Ga0501040_0339747
704 Ga0501041_0046296
705 Ga0501041_0156049
706 Ga0501042_0134954
707 Ga0501042_0227038
708 Ga0501043_0019484
709 Ga0501047_0032631
710 Ga0501048_0092586
711 Ga0501048_0222954
712 Ga0501067_0006124
713 Ga0501067_0006563
714 Ga0501067_0012136
715 Ga0501067_0014285
716 Ga0501067_0133297
717 Ga0501067_0140689
718 Ga0501068_0027545
719 Ga0501068_0034522
720 Ga0501068_0083597
721 Ga0501068_0104863
722 Ga0501069_0025624
723 Ga0501069_0040261
724 Ga0501069_0132859
725 Ga0501070_0013892
726 Ga0501070_0052480
727 Ga0501070_0093443
728 Ga0501070_0222769
729 Ga0501070_0226947
730 Ga0501071_0000958
731 Ga0501071_0066867
732 Ga0501071_0104792
733 Ga0501071_0181306
734 Ga0501072_0041444
735 Ga0501072_0047824
736 Ga0501073_0011427
737 Ga0501073_0068329
738 Ga0501074_0019354
739 Ga0501074_0114053
740 Ga0501074_0191459
741 Ga0501074_0204064
742 Ga0501075_0202208
743 Ga0501075_0337745
744 Ga0501075_0406108
745 Ga0501076_0032671
746 Ga0501076_0065807
747 Ga0501076_0279021
748 Ga0501077_0027335
749 Ga0501077_0117753
750 Ga0501079_0006212
751 Ga0501079_0026169
752 Ga0501080_0035472
753 Ga0501080_0040336
754 Ga0501080_0300287
755 Ga0501081_0017780
756 Ga0501083_0001603
757 Ga0501035_0101211
758 Ga0501045_0069581
759 Ga0501045_0499974
760 nmdc:mga03683_1607_c1
761 nmdc:mga03n38_231322_c1
762 nmdc:mga03n38_54726_c1
763 nmdc:mga00v17_166133_c1
764 nmdc:mga00v17_220524_c1
765 nmdc:mga00v17_30341_c1
766 nmdc:mga00v17_43967_c1
767 nmdc:mga00v17_58156_c1
768 nmdc:mga00v17_6774_c1
769 nmdc:mga0yw44_39482_c1
770 nmdc:mga0yw44_51656_c1
771 nmdc:mga0yw44_5829_c1
772 nmdc:mga0yw44_9383_c1
773 nmdc:mga06z11_25864_c1
774 nmdc:mga04h51_14554_c1
775 nmdc:mga04h51_28234_c1
776 nmdc:mga04h51_3774_c1
777 nmdc:mga07m45_4651_c1
778 Ga0495595_0036445
779 Ga0495619_0036687
780 Ga0500644_0000262
781 Ga0500554_024272
782 Ga0500593_000198
783 Ga0500573_0067222
784 Ga0501084_0293731
785 Ga0501084_0528774
786 Ga0501082_0026502
787 Ga0501082_0061641
788 Ga0501082_0065042
789 Ga0466962_0039827
790 Ga0530510_0185678
791 2643825402
792 2643893094
793 2643961847
794 2644034157
795 2644089807
796 2644102469
797 2644118132
798 2644229078
799 2644319652
800 2644531397
801 2738871373
802 2740166824
803 2812333773
804 2855387637
805 2857483473
806 2984577041
807 2990258788
808 8054612556

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01148

CTP_transf_1

Cytidylyltransferase family

34

303

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4q2g-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s223c, inactive mutant) 0.7094 18 273
4q2e-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s258c, active mutant) 0.6902 12 273
4q2g-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s223c, inactive mutant) 0.6805 18 273
4q2e-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s258c, active mutant) 0.6738 12 273
5guf-assembly1.cif.gz_A-2 structural insight into an intramembrane enzyme for archaeal membrane lipids biosynthesis 0.4868 142 271
ID Description Score Start End Superfamily
af_O44196_80_262_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.3456 116 271 1.10.357.20
af_Q21565_16_458_1.10.3430.10 Mainly Alpha;Orthogonal Bundle;Ammonium transporter fold;Ammonium transporter AmtB like domains 0.3387 107 269 1.10.3430.10
af_Q2G0R7_343_485_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.331 16 201 1.10.1760.20
af_Q2G0R7_343_485_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.3229 16 201 1.10.1760.20
af_O44196_80_262_1.10.357.20 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;SLC41 divalent cation transporters, integral membrane domain 0.3138 116 271 1.10.357.20
ID Description Score Start End GO Terms
AF-A0A7K0QTU9-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) (CDP-DAG synthase) (CDP-DG synthase) (CDP-diacylglycerol synthase) (CDP-diglyceride pyrophosphorylase) (CDP-diglyceride synthase) (CTP:phosphatidate cytidylyltransferase) 0.913 36 274 GO:0004605
GO:0005886
GO:0016024
AF-A0A4V1VKC1-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) 0.9109 44 275 GO:0004605
GO:0005886
GO:0016024
AF-A0A1C3PCQ8-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) 0.9102 148 274 GO:0004605
GO:0005886
GO:0016024
AF-A0A6L6EHW0-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) 0.9086 73 273 GO:0004605
GO:0005886
GO:0016024
AF-A0A7X6NFA2-F1-model_v4 deleted 0.9009 105 271

Map