F435722

General Info

Members Datasets Scaffolds Average Seq Length
404 266 808 255

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0410986|Ga0395898_0410986_81_947
Length 288
Sequence LSAGAEWVYHGPGSLLPRGAAIARRRRLVSHDEDRTALVTGAARGIGLATAERFLADGWRVALLDIDVPAVEATAARLDRPGRVLAVTADVSDPQAVASAVATITDRFGRLDALINNAGIAVFKPLTETTFADWSRVLAVNLSGPFLCTQAAIPLLAQRGGAIVNITSISGLRASTLRTAYGTSKAALAHLTKQQAVELAQFGIRVNAVAPGPVDTAMAKAVHSPEIRADYHDAVPFGRYGQETELANAIVYLCSDGASYVTGQQLAVDGGFEATGIGLSTLRRERRD

Samples

Sample ID Description Type Environment
1 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
51 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
75 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
113 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
114 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
115 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
116 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
117 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
118 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
119 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
122 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
125 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
126 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
127 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
128 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
129 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
130 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
136 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
137 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
138 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
139 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
140 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
141 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
142 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
143 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
144 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
145 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
146 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
147 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
148 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
149 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
150 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
151 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
152 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
153 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
154 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
155 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
156 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
157 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
158 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
159 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
160 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
161 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
162 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
163 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
164 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
165 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
166 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
167 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
168 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
169 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
170 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
171 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
172 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
173 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
174 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
175 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
176 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
177 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
178 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
179 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
180 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
181 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
182 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
185 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
186 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
187 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
188 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
193 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
194 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
195 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
196 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
197 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
198 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
199 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
200 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
201 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
213 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
214 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
215 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
216 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
217 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
218 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
219 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
220 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
221 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
222 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
223 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
231 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
232 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
233 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
234 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
240 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
241 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
242 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
243 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
244 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
245 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
246 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
247 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
248 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
249 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
250 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
251 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
252 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
253 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
254 2511231008 Pseudomonas sp. GM21 Isolate Nodule
255 2511231017 Pseudomonas sp. GM55 Isolate Nodule
256 2511231021 Pseudomonas sp. GM78 Isolate Nodule
257 2511231024 Pseudomonas sp. GM84 Isolate Nodule
258 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
259 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
260 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
261 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
262 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
263 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
264 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
265 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
266 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.53
Metatranscriptomes 0
Isolates 3.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.68
Nodule 1.24
Rhizoplane 3.96
Rhizosphere 81.68
Stem 0
Stem Tuber 0
Unclassified 0.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395898_0410986 3300037466 Bacteria 1290
2 Ga0065714_10012448 3300005288 Bacteria 3048
3 Ga0065707_10089839 3300005295 Bacteria 4269
4 Ga0070683_100026749 3300005329 Bacteria 5199
5 Ga0070670_100046350 3300005331 Bacteria 3738
6 Ga0068869_100097750 3300005334 Bacteria 2217
7 Ga0070680_100202114 3300005336 Bacteria 1676
8 Ga0068868_100349009 3300005338 Bacteria 1267
9 Ga0070689_100058718 3300005340 Bacteria 2988
10 Ga0070661_100137313 3300005344 Bacteria 1840
11 Ga0070668_100036221 3300005347 Bacteria 3765
12 Ga0070669_100022609 3300005353 Bacteria 4496
13 Ga0070675_100275501 3300005354 Bacteria 1477
14 Ga0070674_100056243 3300005356 Bacteria 2728
15 Ga0070688_100104948 3300005365 Bacteria 1870
16 Ga0070688_100353172 3300005365 Bacteria 1077
17 Ga0070700_100003161 3300005441 Bacteria 8463
18 Ga0070678_100044561 3300005456 Bacteria 3168
19 Ga0070662_100008827 3300005457 Bacteria 6570
20 Ga0070681_10042307 3300005458 Bacteria 4565
21 Ga0070681_10294360 3300005458 Bacteria 1533
22 Ga0068867_100007427 3300005459 Bacteria 7751
23 Ga0070707_100078037 3300005468 Bacteria 3195
24 Ga0070679_100009275 3300005530 Bacteria 9303
25 Ga0068853_100325719 3300005539 Bacteria 1425
26 Ga0070686_100158970 3300005544 Bacteria 1590
27 Ga0070702_100398065 3300005615 Bacteria 984
28 Ga0070702_100541584 3300005615 Bacteria 862
29 Ga0068859_100024780 3300005617 Bacteria 6021
30 Ga0068859_100322588 3300005617 Bacteria 1638
31 Ga0068859_100396407 3300005617 Bacteria 1476
32 Ga0068864_100278199 3300005618 Bacteria 1561
33 Ga0068861_100002141 3300005719 Bacteria 12777
34 Ga0068863_100601247 3300005841 Bacteria 1089
35 Ga0068858_100057254 3300005842 Bacteria 3603
36 Ga0068858_100316911 3300005842 Bacteria 1490
37 Ga0068858_100597686 3300005842 Bacteria 1070
38 Ga0068860_100000590 3300005843 Bacteria 43453
39 Ga0068862_100020883 3300005844 Bacteria 5471
40 Ga0081455_10002892 3300005937 Bacteria 20170
41 Ga0081539_10001448 3300005985 Bacteria 40582
42 Ga0081539_10063629 3300005985 Bacteria 2012
43 Ga0075365_10077213 3300006038 Bacteria 2250
44 Ga0075365_10086452 3300006038 Bacteria 2131
45 Ga0075363_100051385 3300006048 Bacteria 2198
46 Ga0075364_10308503 3300006051 Bacteria 1077
47 Ga0075432_10024964 3300006058 Bacteria 2050
48 Ga0075432_10043166 3300006058 Bacteria 1579
49 Ga0075432_10134501 3300006058 Bacteria 939
50 Ga0075362_10000974 3300006177 Bacteria 8749
51 Ga0075362_10011412 3300006177 Bacteria 3499
52 Ga0075367_10003655 3300006178 Bacteria 7379
53 Ga0075367_10017624 3300006178 Bacteria 3924
54 Ga0075369_10058186 3300006186 Bacteria 1683
55 Ga0075366_10016002 3300006195 Bacteria 4306
56 Ga0075370_10138973 3300006353 Bacteria 1420
57 Ga0075428_100348931 3300006844 Bacteria 1588
58 Ga0075428_100377978 3300006844 Bacteria 1519
59 Ga0075430_100039456 3300006846 Bacteria 3998
60 Ga0075431_100143355 3300006847 Bacteria 2462
61 Ga0075429_100033771 3300006880 Bacteria 4445
62 Ga0068865_100005106 3300006881 Bacteria 7943
63 Ga0097620_100024780 3300006931 Bacteria 6021
64 Ga0097620_100322592 3300006931 Bacteria 1638
65 Ga0097620_100396411 3300006931 Bacteria 1476
66 Ga0105251_10014888 3300009011 Bacteria 4274
67 Ga0105244_10008312 3300009036 Bacteria 6490
68 Ga0105244_10107077 3300009036 Bacteria 1363
69 Ga0111539_10007974 3300009094 Bacteria 13506
70 Ga0105245_10599112 3300009098 Bacteria 1128
71 Ga0105245_10831978 3300009098 Bacteria 962
72 Ga0105247_10013956 3300009101 Bacteria 4817
73 Ga0105243_10033815 3300009148 Bacteria 3954
74 Ga0105248_10237385 3300009177 Bacteria 2052
75 Ga0105237_10237260 3300009545 Bacteria 1825
76 Ga0105238_10046623 3300009551 Bacteria 4372
77 Ga0105238_10054488 3300009551 Bacteria 4016
78 Ga0105249_10025960 3300009553 Bacteria 5276
79 Ga0105239_10417326 3300010375 Bacteria 1520
80 Ga0105246_10093459 3300011119 Bacteria 2173
81 Ga0157373_10014004 3300013100 Bacteria 5880
82 Ga0157370_10008148 3300013104 Bacteria 11334
83 Ga0157370_10025768 3300013104 Bacteria 5818
84 Ga0157370_10090360 3300013104 Bacteria 2876
85 Ga0157378_10004481 3300013297 Bacteria 12262
86 Ga0163162_10010609 3300013306 Bacteria 8958
87 Ga0163162_10965768 3300013306 Bacteria 963
88 Ga0157372_10017981 3300013307 Bacteria 7596
89 Ga0157372_10081591 3300013307 Bacteria 3661
90 Ga0157375_10090587 3300013308 Bacteria 3117
91 Ga0163163_10329595 3300014325 Bacteria 1581
92 Ga0182008_10091199 3300014497 Bacteria 1502
93 Ga0157377_10249177 3300014745 Bacteria 1150
94 Ga0157376_10492878 3300014969 Bacteria 1203
95 Ga0213876_10013615 3300021384 Bacteria 4316
96 Ga0209677_101932 3300025253 Bacteria 8283
97 Ga0209233_1001548 3300025261 Bacteria 9017
98 Ga0209455_1000481 3300025272 Bacteria 29736
99 Ga0209455_1000557 3300025272 Bacteria 25222
100 Ga0209455_1001771 3300025272 Bacteria 9150
101 Ga0209758_1035624 3300025297 Bacteria 1958
102 Ga0207696_1011916 3300025711 Bacteria 3103
103 Ga0207655_1000077 3300025728 Bacteria 219418
104 Ga0207713_1009058 3300025735 Bacteria 5654
105 Ga0207707_10025719 3300025912 Bacteria 5149
106 Ga0207671_10152857 3300025914 Bacteria 1784
107 Ga0207662_10022529 3300025918 Bacteria 3612
108 Ga0207649_10010671 3300025920 Bacteria 5051
109 Ga0207652_10065457 3300025921 Bacteria 3148
110 Ga0207646_10089711 3300025922 Bacteria 2752
111 Ga0207694_10029001 3300025924 Bacteria 4220
112 Ga0207650_10030619 3300025925 Bacteria 3878
113 Ga0207659_10328873 3300025926 Bacteria 1263
114 Ga0207700_10050723 3300025928 Bacteria 3093
115 Ga0207706_10017226 3300025933 Bacteria 6513
116 Ga0207686_10469379 3300025934 Bacteria 971
117 Ga0207709_10107520 3300025935 Bacteria 1858
118 Ga0207670_10040980 3300025936 Bacteria 3043
119 Ga0207670_10311743 3300025936 Bacteria 1235
120 Ga0207669_10042756 3300025937 Bacteria 2648
121 Ga0207669_10117123 3300025937 Bacteria 1800
122 Ga0207669_10316188 3300025937 Bacteria 1193
123 Ga0207704_10004804 3300025938 Bacteria 6202
124 Ga0207691_10133833 3300025940 Bacteria 2188
125 Ga0207691_10229927 3300025940 Bacteria 1606
126 Ga0207689_10233956 3300025942 Bacteria 1519
127 Ga0207661_10066040 3300025944 Bacteria 2938
128 Ga0207668_10022124 3300025972 Bacteria 4065
129 Ga0207703_10025468 3300026035 Bacteria 4653
130 Ga0207703_10316940 3300026035 Bacteria 1427
131 Ga0207639_10023283 3300026041 Bacteria 4471
132 Ga0207708_10010230 3300026075 Bacteria 6965
133 Ga0207708_10284296 3300026075 Bacteria 1341
134 Ga0207648_10029822 3300026089 Bacteria 4837
135 Ga0207676_10013697 3300026095 Bacteria 5822
136 Ga0207674_10023116 3300026116 Bacteria 6667
137 Ga0207674_10125271 3300026116 Bacteria 2535
138 Ga0207675_100001900 3300026118 Bacteria 20834
139 Ga0207683_10030126 3300026121 Bacteria 4701
140 Ga0207698_10168852 3300026142 Bacteria 1924
141 Ga0207698_10226624 3300026142 Bacteria 1693
142 Ga0207428_10101604 3300027907 Bacteria 2222
143 Ga0207428_10328130 3300027907 Bacteria 1129
144 Ga0268265_10005950 3300028380 Bacteria 8303
145 Ga0268264_10000991 3300028381 Bacteria 28937
146 Ga0265337_1000131 3300028556 Bacteria 38040
147 Ga0265337_1013195 3300028556 Bacteria 2783
148 Ga0265326_10007527 3300028558 Bacteria 3331
149 Ga0265319_1042767 3300028563 Bacteria 1523
150 Ga0265334_10004418 3300028573 Bacteria 6242
151 Ga0265318_10035835 3300028577 Bacteria 1906
152 Ga0265323_10003986 3300028653 Bacteria 6408
153 Ga0265322_10037010 3300028654 Bacteria 1390
154 Ga0265336_10000415 3300028666 Bacteria 26412
155 Ga0265338_10010045 3300028800 Bacteria 11184
156 Ga0265324_10008579 3300029957 Bacteria 4053
157 Ga0265325_10038826 3300031241 Bacteria 2510
158 Ga0307412_10292383 3300031911 Bacteria 1284
159 Ga0373944_0034411 3300035089 Bacteria 1540
160 Ga0373956_0181807 3300035119 Bacteria 994
161 Ga0373955_0134552 3300035172 Bacteria 1445
162 Ga0373931_0019175 3300035691 Bacteria 3411
163 Ga0373931_0192573 3300035691 Bacteria 1214
164 Ga0373927_0120513 3300035695 Bacteria 1712
165 Ga0373933_0157454 3300035724 Bacteria 1441
166 Ga0373933_0242522 3300035724 Bacteria 1159
167 Ga0373947_0087091 3300035725 Bacteria 1942
168 Ga0373937_0070318 3300036401 Bacteria 3228
169 Ga0373937_0250886 3300036401 Bacteria 1668
170 Ga0373925_0015343 3300037068 Bacteria 5542
171 Ga0373925_0121237 3300037068 Bacteria 2030
172 Ga0395900_0430411 3300037418 Bacteria 1279
173 Ga0395898_0044004 3300037466 Bacteria 4398
174 Ga0395898_0357287 3300037466 Bacteria 1393
175 Ga0436365_0114482 3300039437 Bacteria 4549
176 Ga0436365_0634558 3300039437 Bacteria 1729
177 Ga0436365_1311472 3300039437 Bacteria 987
178 Ga0439438_000343 3300041405 Bacteria 20780
179 Ga0439438_001739 3300041405 Bacteria 9568
180 Ga0439447_001273 3300041407 Bacteria 9173
181 Ga0439447_007970 3300041407 Bacteria 3314
182 Ga0439453_0009843 3300041408 Bacteria 1565
183 Ga0439466_0000341 3300041411 Bacteria 17936
184 Ga0439466_0000943 3300041411 Bacteria 11152
185 Ga0439466_0012950 3300041411 Bacteria 3060
186 Ga0439452_000083 3300042010 Bacteria 81352
187 Ga0450902_001241 3300042137 Bacteria 3432
188 Ga0450902_007274 3300042137 Bacteria 1711
189 Ga0450903_002205 3300042138 Bacteria 3479
190 Ga0450905_000633 3300042142 Bacteria 4336
191 Ga0450906_031227 3300042145 Bacteria 942
192 Ga0439460_0015755 3300042461 Bacteria 2006
193 Ga0466963_0005718 3300044694 Bacteria 7309
194 Ga0466957_0066527 3300044842 Bacteria 2222
195 Ga0495617_000934 3300046452 Bacteria 13571
196 Ga0495617_008084 3300046452 Bacteria 3635
197 Ga0495617_019627 3300046452 Bacteria 2285
198 Ga0495617_020429 3300046452 Bacteria 2238
199 Ga0495627_001573 3300046453 Bacteria 12938
200 Ga0495603_0000197 3300046455 Bacteria 31627
201 Ga0495590_0028472 3300046457 Bacteria 1959
202 Ga0495591_000473 3300046458 Bacteria 31901
203 Ga0495591_019523 3300046458 Bacteria 2265
204 Ga0495591_025059 3300046458 Bacteria 1877
205 Ga0495591_030574 3300046458 Bacteria 1624
206 Ga0495638_0002076 3300046460 Bacteria 17015
207 Ga0495638_0002280 3300046460 Bacteria 15858
208 Ga0495638_0002926 3300046460 Bacteria 13638
209 Ga0495638_0004383 3300046460 Bacteria 10687
210 Ga0495638_0042170 3300046460 Bacteria 2883
211 Ga0495638_0047473 3300046460 Bacteria 2691
212 Ga0495638_0068832 3300046460 Bacteria 2169
213 Ga0495653_0002627 3300046463 Bacteria 14297
214 Ga0495650_0024371 3300046471 Bacteria 2858
215 Ga0495605_0090107 3300046474 Bacteria 1422
216 Ga0495605_0090816 3300046474 Bacteria 1415
217 Ga0495584_0000014 3300046491 Bacteria 172880
218 Ga0495584_0000631 3300046491 Bacteria 23533
219 Ga0495584_0017461 3300046491 Bacteria 3652
220 Ga0495584_0020594 3300046491 Bacteria 3349
221 Ga0495584_0023926 3300046491 Bacteria 3097
222 Ga0495585_0000051 3300046492 Bacteria 117875
223 Ga0495585_0046055 3300046492 Bacteria 2433
224 Ga0495596_0000103 3300046500 Bacteria 60746
225 Ga0495607_0015795 3300046501 Bacteria 4884
226 Ga0495583_0001549 3300046506 Bacteria 22779
227 Ga0495610_0021092 3300046512 Bacteria 3591
228 Ga0495610_0027917 3300046512 Bacteria 2992
229 Ga0495610_0030544 3300046512 Bacteria 2822
230 Ga0495616_0020148 3300046513 Bacteria 3633
231 Ga0495616_0030428 3300046513 Bacteria 2837
232 Ga0495616_0114813 3300046513 Bacteria 1248
233 Ga0495630_0003449 3300046517 Bacteria 10989
234 Ga0495631_0034358 3300046518 Bacteria 2273
235 Ga0495632_0000021 3300046519 Bacteria 187363
236 Ga0495632_0002204 3300046519 Bacteria 15032
237 Ga0495632_0025201 3300046519 Bacteria 3148
238 Ga0495637_0013748 3300046520 Bacteria 3837
239 Ga0495637_0016285 3300046520 Bacteria 3476
240 Ga0495643_0000029 3300046522 Bacteria 261028
241 Ga0495643_0000577 3300046522 Bacteria 45047
242 Ga0495643_0000796 3300046522 Bacteria 34872
243 Ga0495644_0000303 3300046523 Bacteria 22797
244 Ga0495644_0000413 3300046523 Bacteria 19054
245 Ga0495644_0012896 3300046523 Bacteria 3212
246 Ga0495648_0000099 3300046524 Bacteria 108810
247 Ga0495648_0000289 3300046524 Bacteria 57085
248 Ga0495666_0003269 3300046526 Bacteria 8176
249 Ga0495666_0006224 3300046526 Bacteria 6010
250 Ga0495654_0027034 3300046530 Bacteria 2944
251 Ga0495654_0046453 3300046530 Bacteria 2138
252 Ga0495654_0050727 3300046530 Bacteria 2026
253 Ga0495586_0104587 3300046535 Bacteria 1573
254 Ga0495587_0000067 3300046536 Bacteria 87245
255 Ga0495587_0062387 3300046536 Bacteria 2182
256 Ga0495597_0000938 3300046542 Bacteria 22502
257 Ga0495597_0016817 3300046542 Bacteria 3451
258 Ga0495597_0025932 3300046542 Bacteria 2695
259 Ga0495597_0057592 3300046542 Bacteria 1699
260 Ga0495597_0063254 3300046542 Bacteria 1608
261 Ga0495597_0069066 3300046542 Bacteria 1525
262 Ga0495597_0084391 3300046542 Bacteria 1354
263 Ga0495633_0109877 3300046558 Bacteria 1278
264 Ga0495668_0000610 3300046616 Bacteria 43140
265 Ga0495611_0023071 3300046648 Bacteria 2697
266 Ga0495625_0116377 3300046660 Bacteria 1823
267 Ga0495661_0123322 3300046665 Bacteria 1428
268 Ga0495661_0200678 3300046665 Bacteria 1044
269 Ga0495599_0322060 3300046678 Bacteria 930
270 Ga0495623_0007550 3300046679 Bacteria 7057
271 Ga0495646_0000050 3300046680 Bacteria 60794
272 Ga0495613_0001725 3300046689 Bacteria 16638
273 Ga0495670_0002081 3300046691 Bacteria 9876
274 Ga0495671_0002395 3300046692 Bacteria 11889
275 Ga0495671_0012375 3300046692 Bacteria 4662
276 Ga0495671_0048386 3300046692 Bacteria 2121
277 Ga0495671_0120514 3300046692 Bacteria 1280
278 Ga0495671_0128398 3300046692 Bacteria 1236
279 Ga0495649_0016483 3300046694 Bacteria 4187
280 Ga0495589_0161930 3300046794 Bacteria 1065
281 Ga0495660_0004036 3300046810 Bacteria 8960
282 Ga0495660_0004675 3300046810 Bacteria 8260
283 Ga0495660_0006838 3300046810 Bacteria 6720
284 Ga0495660_0040653 3300046810 Bacteria 2576
285 Ga0495660_0104598 3300046810 Bacteria 1452
286 Ga0495660_0164915 3300046810 Bacteria 1083
287 Ga0495604_0009334 3300047317 Bacteria 7764
288 Ga0495636_0040203 3300047318 Bacteria 1938
289 Ga0495674_0000047 3300047319 Bacteria 81759
290 Ga0495672_0000983 3300047320 Bacteria 29524
291 Ga0495672_0001007 3300047320 Bacteria 29098
292 Ga0495672_0024981 3300047320 Bacteria 3836
293 Ga0495672_0068315 3300047320 Bacteria 2021
294 Ga0495680_0000610 3300047322 Bacteria 40373
295 Ga0495680_0001293 3300047322 Bacteria 27292
296 Ga0495680_0007335 3300047322 Bacteria 10141
297 Ga0495680_0232099 3300047322 Bacteria 1313
298 Ga0495683_0004344 3300047323 Bacteria 8080
299 Ga0495683_0040260 3300047323 Bacteria 2360
300 Ga0495683_0062989 3300047323 Bacteria 1833
301 Ga0495683_0109343 3300047323 Bacteria 1321
302 Ga0495683_0152057 3300047323 Bacteria 1076
303 Ga0495679_001303 3300047446 Bacteria 14538
304 Ga0495673_0001262 3300047469 Bacteria 20838
305 Ga0495673_0082352 3300047469 Bacteria 1330
306 Ga0495681_0009103 3300047470 Bacteria 6151
307 Ga0495681_0017477 3300047470 Bacteria 3979
308 Ga0495681_0061405 3300047470 Bacteria 1731
309 Ga0495686_0004579 3300047472 Bacteria 11287
310 Ga0495593_0005918 3300047673 Bacteria 7203
311 Ga0495593_0044290 3300047673 Bacteria 2381
312 Ga0495614_0116683 3300048089 Bacteria 1175
313 Ga0495626_0001233 3300048091 Bacteria 21022
314 Ga0496100_0104983 3300048903 Bacteria 1953
315 Ga0496100_0441699 3300048903 Bacteria 996
316 Ga0496104_0056482 3300048907 Bacteria 3712
317 Ga0496104_0217193 3300048907 Bacteria 1824
318 Ga0496105_0034864 3300048908 Bacteria 4141
319 Ga0496107_0093002 3300048910 Bacteria 2205
320 Ga0496109_0317498 3300048912 Bacteria 1470
321 Ga0496110_0048936 3300048913 Bacteria 3707
322 Ga0496112_0006924 3300048915 Bacteria 10006
323 Ga0496113_0104867 3300048916 Bacteria 2194
324 Ga0496114_0084118 3300048917 Bacteria 2694
325 Ga0496114_0168895 3300048917 Bacteria 1905
326 Ga0496114_0180497 3300048917 Bacteria 1843
327 Ga0496114_0368984 3300048917 Bacteria 1270
328 Ga0496115_0070383 3300048918 Unclassified 2836
329 Ga0496115_0169270 3300048918 Bacteria 1807
330 Ga0496117_0002881 3300048920 Bacteria 20868
331 Ga0496117_0057061 3300048920 Bacteria 2715
332 Ga0496118_0001760 3300048921 Bacteria 31395
333 Ga0496118_0020719 3300048921 Bacteria 5821
334 Ga0496119_0068857 3300048922 Bacteria 2082
335 Ga0496121_0012479 3300048924 Bacteria 9255
336 Ga0496122_0000597 3300048925 Bacteria 74301
337 Ga0496123_0000343 3300048926 Bacteria 87669
338 Ga0496124_0001081 3300048927 Bacteria 43074
339 Ga0496124_0032351 3300048927 Bacteria 4618
340 Ga0496125_0024889 3300048928 Bacteria 5493
341 Ga0496125_0150147 3300048928 Bacteria 1602
342 Ga0496126_0016020 3300048929 Bacteria 7517
343 Ga0496126_0194629 3300048929 Bacteria 1715
344 Ga0496126_0369273 3300048929 Bacteria 1170
345 Ga0495678_000703 3300049459 Bacteria 30412
346 Ga0495678_026721 3300049459 Bacteria 2458
347 Ga0495682_0000861 3300049460 Bacteria 18861
348 Ga0501033_0038068 3300049570 Bacteria 3598
349 Ga0501034_0031854 3300049571 Bacteria 5356
350 Ga0501034_0100818 3300049571 Bacteria 2882
351 Ga0501038_0107870 3300049574 Bacteria 2310
352 Ga0501038_0563095 3300049574 Bacteria 866
353 Ga0501039_0507536 3300049575 Bacteria 947
354 Ga0501043_0265846 3300049579 Bacteria 1318
355 Ga0501046_0122589 3300049580 Bacteria 1977
356 Ga0501047_0037771 3300049581 Bacteria 4670
357 Ga0501047_0056176 3300049581 Bacteria 3806
358 Ga0501047_0105919 3300049581 Bacteria 2692
359 Ga0501067_0095532 3300049583 Bacteria 1650
360 Ga0501070_0009333 3300049586 Bacteria 8295
361 Ga0501072_0002326 3300049588 Bacteria 14257
362 Ga0501072_0078830 3300049588 Bacteria 2608
363 Ga0501073_0045982 3300049589 Bacteria 3072
364 Ga0501074_0334487 3300049590 Bacteria 1075
365 Ga0501080_0012503 3300049742 Bacteria 7784
366 Ga0501080_0707867 3300049742 Bacteria 888
367 Ga0501083_0018959 3300049744 Bacteria 4789
368 Ga0501083_0022144 3300049744 Bacteria 4411
369 Ga0501083_0034354 3300049744 Bacteria 3468
370 Ga0501083_0147579 3300049744 Bacteria 1540
371 Ga0501035_0016776 3300049822 Bacteria 6753
372 Ga0501035_0365415 3300049822 Bacteria 1205
373 Ga0501035_0570882 3300049822 Bacteria 925
374 Ga0501044_0004545 3300049823 Bacteria 15511
375 Ga0501044_0041347 3300049823 Bacteria 4798
376 Ga0501044_0224731 3300049823 Bacteria 1827
377 nmdc:mga03683_131057_c1 3300050489 Bacteria 1122
378 nmdc:mga0yw44_161355_c1 3300050492 Bacteria 1468
379 nmdc:mga06z11_53569_c1 3300050494 Bacteria 2075
380 nmdc:mga07m45_131207_c1 3300050496 Bacteria 1450
381 nmdc:mga09592_12375_c1 3300050508 Bacteria 6949
382 nmdc:mga08y16_2202_c1 3300050511 Bacteria 19987
383 nmdc:mga0sz30_76832_c1 3300050516 Bacteria 1442
384 Ga0495612_0038337 3300053078 Bacteria 1947
385 Ga0500641_0008455 3300053096 Bacteria 3673
386 Ga0500593_002492 3300053117 Bacteria 6758
387 Ga0500616_0027401 3300053153 Bacteria 3146
388 Ga0500636_0076977 3300053177 Bacteria 1927
389 Ga0500552_000559 3300053733 Bacteria 3477
390 Ga0501082_0003171 3300060353 Bacteria 14336
391 2509147813 2508501128 Bacteria 8613869
392 2511279971 2511231008 Bacteria 6624100
393 2511334849 2511231017 Bacteria 6503007
394 2511358127 2511231021 Bacteria 7302637
395 2511375454 2511231024 Bacteria 5835885
396 2596372734 2595698237 Bacteria 6712432
397 2643758769 2643221547 Bacteria 4740017
398 2834581491 2834578030 Bacteria 3530182
399 2899275576 2899275550 Bacteria 3958688
400 2902410863 2902405164 Bacteria 6784948
401 2928127472 2928125067 Bacteria 5937560
402 3007622321 3007619802 Bacteria 6411688
403 3007804716 3007803356 Bacteria 5931491
404 8057136246 8057132660 Bacteria 4061191
405 Ga0395898_0410986
406 Ga0065714_10012448
407 Ga0065707_10089839
408 Ga0070683_100026749
409 Ga0070670_100046350
410 Ga0068869_100097750
411 Ga0070680_100202114
412 Ga0068868_100349009
413 Ga0070689_100058718
414 Ga0070661_100137313
415 Ga0070668_100036221
416 Ga0070669_100022609
417 Ga0070675_100275501
418 Ga0070674_100056243
419 Ga0070688_100104948
420 Ga0070688_100353172
421 Ga0070700_100003161
422 Ga0070678_100044561
423 Ga0070662_100008827
424 Ga0070681_10042307
425 Ga0070681_10294360
426 Ga0068867_100007427
427 Ga0070707_100078037
428 Ga0070679_100009275
429 Ga0068853_100325719
430 Ga0070686_100158970
431 Ga0070702_100398065
432 Ga0070702_100541584
433 Ga0068859_100024780
434 Ga0068859_100322588
435 Ga0068859_100396407
436 Ga0068864_100278199
437 Ga0068861_100002141
438 Ga0068863_100601247
439 Ga0068858_100057254
440 Ga0068858_100316911
441 Ga0068858_100597686
442 Ga0068860_100000590
443 Ga0068862_100020883
444 Ga0081455_10002892
445 Ga0081539_10001448
446 Ga0081539_10063629
447 Ga0075365_10077213
448 Ga0075365_10086452
449 Ga0075363_100051385
450 Ga0075364_10308503
451 Ga0075432_10024964
452 Ga0075432_10043166
453 Ga0075432_10134501
454 Ga0075362_10000974
455 Ga0075362_10011412
456 Ga0075367_10003655
457 Ga0075367_10017624
458 Ga0075369_10058186
459 Ga0075366_10016002
460 Ga0075370_10138973
461 Ga0075428_100348931
462 Ga0075428_100377978
463 Ga0075430_100039456
464 Ga0075431_100143355
465 Ga0075429_100033771
466 Ga0068865_100005106
467 Ga0097620_100024780
468 Ga0097620_100322592
469 Ga0097620_100396411
470 Ga0105251_10014888
471 Ga0105244_10008312
472 Ga0105244_10107077
473 Ga0111539_10007974
474 Ga0105245_10599112
475 Ga0105245_10831978
476 Ga0105247_10013956
477 Ga0105243_10033815
478 Ga0105248_10237385
479 Ga0105237_10237260
480 Ga0105238_10046623
481 Ga0105238_10054488
482 Ga0105249_10025960
483 Ga0105239_10417326
484 Ga0105246_10093459
485 Ga0157373_10014004
486 Ga0157370_10008148
487 Ga0157370_10025768
488 Ga0157370_10090360
489 Ga0157378_10004481
490 Ga0163162_10010609
491 Ga0163162_10965768
492 Ga0157372_10017981
493 Ga0157372_10081591
494 Ga0157375_10090587
495 Ga0163163_10329595
496 Ga0182008_10091199
497 Ga0157377_10249177
498 Ga0157376_10492878
499 Ga0213876_10013615
500 Ga0209677_101932
501 Ga0209233_1001548
502 Ga0209455_1000481
503 Ga0209455_1000557
504 Ga0209455_1001771
505 Ga0209758_1035624
506 Ga0207696_1011916
507 Ga0207655_1000077
508 Ga0207713_1009058
509 Ga0207707_10025719
510 Ga0207671_10152857
511 Ga0207662_10022529
512 Ga0207649_10010671
513 Ga0207652_10065457
514 Ga0207646_10089711
515 Ga0207694_10029001
516 Ga0207650_10030619
517 Ga0207659_10328873
518 Ga0207700_10050723
519 Ga0207706_10017226
520 Ga0207686_10469379
521 Ga0207709_10107520
522 Ga0207670_10040980
523 Ga0207670_10311743
524 Ga0207669_10042756
525 Ga0207669_10117123
526 Ga0207669_10316188
527 Ga0207704_10004804
528 Ga0207691_10133833
529 Ga0207691_10229927
530 Ga0207689_10233956
531 Ga0207661_10066040
532 Ga0207668_10022124
533 Ga0207703_10025468
534 Ga0207703_10316940
535 Ga0207639_10023283
536 Ga0207708_10010230
537 Ga0207708_10284296
538 Ga0207648_10029822
539 Ga0207676_10013697
540 Ga0207674_10023116
541 Ga0207674_10125271
542 Ga0207675_100001900
543 Ga0207683_10030126
544 Ga0207698_10168852
545 Ga0207698_10226624
546 Ga0207428_10101604
547 Ga0207428_10328130
548 Ga0268265_10005950
549 Ga0268264_10000991
550 Ga0265337_1000131
551 Ga0265337_1013195
552 Ga0265326_10007527
553 Ga0265319_1042767
554 Ga0265334_10004418
555 Ga0265318_10035835
556 Ga0265323_10003986
557 Ga0265322_10037010
558 Ga0265336_10000415
559 Ga0265338_10010045
560 Ga0265324_10008579
561 Ga0265325_10038826
562 Ga0307412_10292383
563 Ga0373944_0034411
564 Ga0373956_0181807
565 Ga0373955_0134552
566 Ga0373931_0019175
567 Ga0373931_0192573
568 Ga0373927_0120513
569 Ga0373933_0157454
570 Ga0373933_0242522
571 Ga0373947_0087091
572 Ga0373937_0070318
573 Ga0373937_0250886
574 Ga0373925_0015343
575 Ga0373925_0121237
576 Ga0395900_0430411
577 Ga0395898_0044004
578 Ga0395898_0357287
579 Ga0436365_0114482
580 Ga0436365_0634558
581 Ga0436365_1311472
582 Ga0439438_000343
583 Ga0439438_001739
584 Ga0439447_001273
585 Ga0439447_007970
586 Ga0439453_0009843
587 Ga0439466_0000341
588 Ga0439466_0000943
589 Ga0439466_0012950
590 Ga0439452_000083
591 Ga0450902_001241
592 Ga0450902_007274
593 Ga0450903_002205
594 Ga0450905_000633
595 Ga0450906_031227
596 Ga0439460_0015755
597 Ga0466963_0005718
598 Ga0466957_0066527
599 Ga0495617_000934
600 Ga0495617_008084
601 Ga0495617_019627
602 Ga0495617_020429
603 Ga0495627_001573
604 Ga0495603_0000197
605 Ga0495590_0028472
606 Ga0495591_000473
607 Ga0495591_019523
608 Ga0495591_025059
609 Ga0495591_030574
610 Ga0495638_0002076
611 Ga0495638_0002280
612 Ga0495638_0002926
613 Ga0495638_0004383
614 Ga0495638_0042170
615 Ga0495638_0047473
616 Ga0495638_0068832
617 Ga0495653_0002627
618 Ga0495650_0024371
619 Ga0495605_0090107
620 Ga0495605_0090816
621 Ga0495584_0000014
622 Ga0495584_0000631
623 Ga0495584_0017461
624 Ga0495584_0020594
625 Ga0495584_0023926
626 Ga0495585_0000051
627 Ga0495585_0046055
628 Ga0495596_0000103
629 Ga0495607_0015795
630 Ga0495583_0001549
631 Ga0495610_0021092
632 Ga0495610_0027917
633 Ga0495610_0030544
634 Ga0495616_0020148
635 Ga0495616_0030428
636 Ga0495616_0114813
637 Ga0495630_0003449
638 Ga0495631_0034358
639 Ga0495632_0000021
640 Ga0495632_0002204
641 Ga0495632_0025201
642 Ga0495637_0013748
643 Ga0495637_0016285
644 Ga0495643_0000029
645 Ga0495643_0000577
646 Ga0495643_0000796
647 Ga0495644_0000303
648 Ga0495644_0000413
649 Ga0495644_0012896
650 Ga0495648_0000099
651 Ga0495648_0000289
652 Ga0495666_0003269
653 Ga0495666_0006224
654 Ga0495654_0027034
655 Ga0495654_0046453
656 Ga0495654_0050727
657 Ga0495586_0104587
658 Ga0495587_0000067
659 Ga0495587_0062387
660 Ga0495597_0000938
661 Ga0495597_0016817
662 Ga0495597_0025932
663 Ga0495597_0057592
664 Ga0495597_0063254
665 Ga0495597_0069066
666 Ga0495597_0084391
667 Ga0495633_0109877
668 Ga0495668_0000610
669 Ga0495611_0023071
670 Ga0495625_0116377
671 Ga0495661_0123322
672 Ga0495661_0200678
673 Ga0495599_0322060
674 Ga0495623_0007550
675 Ga0495646_0000050
676 Ga0495613_0001725
677 Ga0495670_0002081
678 Ga0495671_0002395
679 Ga0495671_0012375
680 Ga0495671_0048386
681 Ga0495671_0120514
682 Ga0495671_0128398
683 Ga0495649_0016483
684 Ga0495589_0161930
685 Ga0495660_0004036
686 Ga0495660_0004675
687 Ga0495660_0006838
688 Ga0495660_0040653
689 Ga0495660_0104598
690 Ga0495660_0164915
691 Ga0495604_0009334
692 Ga0495636_0040203
693 Ga0495674_0000047
694 Ga0495672_0000983
695 Ga0495672_0001007
696 Ga0495672_0024981
697 Ga0495672_0068315
698 Ga0495680_0000610
699 Ga0495680_0001293
700 Ga0495680_0007335
701 Ga0495680_0232099
702 Ga0495683_0004344
703 Ga0495683_0040260
704 Ga0495683_0062989
705 Ga0495683_0109343
706 Ga0495683_0152057
707 Ga0495679_001303
708 Ga0495673_0001262
709 Ga0495673_0082352
710 Ga0495681_0009103
711 Ga0495681_0017477
712 Ga0495681_0061405
713 Ga0495686_0004579
714 Ga0495593_0005918
715 Ga0495593_0044290
716 Ga0495614_0116683
717 Ga0495626_0001233
718 Ga0496100_0104983
719 Ga0496100_0441699
720 Ga0496104_0056482
721 Ga0496104_0217193
722 Ga0496105_0034864
723 Ga0496107_0093002
724 Ga0496109_0317498
725 Ga0496110_0048936
726 Ga0496112_0006924
727 Ga0496113_0104867
728 Ga0496114_0084118
729 Ga0496114_0168895
730 Ga0496114_0180497
731 Ga0496114_0368984
732 Ga0496115_0070383
733 Ga0496115_0169270
734 Ga0496117_0002881
735 Ga0496117_0057061
736 Ga0496118_0001760
737 Ga0496118_0020719
738 Ga0496119_0068857
739 Ga0496121_0012479
740 Ga0496122_0000597
741 Ga0496123_0000343
742 Ga0496124_0001081
743 Ga0496124_0032351
744 Ga0496125_0024889
745 Ga0496125_0150147
746 Ga0496126_0016020
747 Ga0496126_0194629
748 Ga0496126_0369273
749 Ga0495678_000703
750 Ga0495678_026721
751 Ga0495682_0000861
752 Ga0501033_0038068
753 Ga0501034_0031854
754 Ga0501034_0100818
755 Ga0501038_0107870
756 Ga0501038_0563095
757 Ga0501039_0507536
758 Ga0501043_0265846
759 Ga0501046_0122589
760 Ga0501047_0037771
761 Ga0501047_0056176
762 Ga0501047_0105919
763 Ga0501067_0095532
764 Ga0501070_0009333
765 Ga0501072_0002326
766 Ga0501072_0078830
767 Ga0501073_0045982
768 Ga0501074_0334487
769 Ga0501080_0012503
770 Ga0501080_0707867
771 Ga0501083_0018959
772 Ga0501083_0022144
773 Ga0501083_0034354
774 Ga0501083_0147579
775 Ga0501035_0016776
776 Ga0501035_0365415
777 Ga0501035_0570882
778 Ga0501044_0004545
779 Ga0501044_0041347
780 Ga0501044_0224731
781 nmdc:mga03683_131057_c1
782 nmdc:mga0yw44_161355_c1
783 nmdc:mga06z11_53569_c1
784 nmdc:mga07m45_131207_c1
785 nmdc:mga09592_12375_c1
786 nmdc:mga08y16_2202_c1
787 nmdc:mga0sz30_76832_c1
788 Ga0495612_0038337
789 Ga0500641_0008455
790 Ga0500593_002492
791 Ga0500616_0027401
792 Ga0500636_0076977
793 Ga0500552_000559
794 Ga0501082_0003171
795 2509147813
796 2511279971
797 2511334849
798 2511358127
799 2511375454
800 2596372734
801 2643758769
802 2834581491
803 2899275576
804 2902410863
805 2928127472
806 3007622321
807 3007804716
808 8057136246

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

35

227

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

41

273

0.96

PF08659

KR

KR domain

35

215

0.88

PF23441

30

274

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gaf-assembly2.cif.gz_D 2.2a crystal structure of 7-alpha-hydroxysteroid dehydrogenase from brucella melitensis 0.9613 30 236
8hax-assembly1.cif.gz_D brucella melitensis 7alpha-hydroxysteroid dehydrogenase mutant-i258m/k262t 0.9587 30 236
8hsa-assembly4.cif.gz_H-2 brucella melitensis 7-alpha-hydroxysteroid dehydrogenase mutant: 1-53 truncation/m196i/i258m/k262t-nad+ 0.9504 30 236
4nbv-assembly1.cif.gz_A crystal structure of fabg from cupriavidus taiwanensis 0.9488 32 237
4dqx-assembly1.cif.gz_C crystal structure of a short chain dehydrogenase from rhizobium etli cfn 42 0.9453 30 235
ID Description Score Start End Superfamily
af_P37440_1_255_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9374 33 235 3.40.50.720
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9372 32 235 3.40.50.720
af_Q0JDU3_1_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9369 73 235 3.40.50.720
5h5xG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9333 31 234 3.40.50.720
3dijB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9297 54 235 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6N3UMI6-F1-model_v4 Short-chain dehydrogenase 0.9919 40 243 GO:0016491
AF-A0A6N3UMI6-F1-model_v4 Short-chain dehydrogenase 0.9823 40 243 GO:0016491
AF-A0A524LGI5-F1-model_v4 SDR family oxidoreductase 0.9744 38 243 GO:0016491
AF-A0A6L5II69-F1-model_v4 deleted 0.9737 12 243
AF-A0A1M6DN59-F1-model_v4 7-alpha-hydroxysteroid dehydrogenase 0.9727 51 240

Map