F435712

General Info

Members Datasets Scaffolds Average Seq Length
404 266 808 122

Family's Representative Sequence

Representative Sequence 3300035113|Ga0373936_0014639|Ga0373936_0014639_1677_2108
Length 143
Sequence MAAKKVWIASSLRSSQCDNNKEVLMSYVDGFIVAVPKTNLEAYRSLARKAGKVWREHGALEYREWVAEDVKVGKRTSFPRSVKLKPGETVVFSWITYKSRAQRDRVNAKVMADKRLAGTMDTKSLPFDAKRMIFGGFESLVKA

Samples

Sample ID Description Type Environment
1 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
75 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
151 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
152 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
153 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
157 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
158 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
159 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
160 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
161 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
172 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
173 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
174 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
175 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
176 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
177 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
181 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
182 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
183 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
184 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
185 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
186 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
187 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
188 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
189 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
190 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
191 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
192 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
193 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
194 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
195 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
196 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
197 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
198 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
199 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
200 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
201 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
202 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
203 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
206 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
207 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
208 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
209 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
212 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
213 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
214 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
215 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
216 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
217 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
233 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
234 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
239 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
240 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
241 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
242 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
245 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
246 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
247 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
248 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
249 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
250 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
251 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
252 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
253 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
254 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
255 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
256 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
257 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
258 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
259 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
260 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
261 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
262 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
263 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
264 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
265 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
266 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.77
Metatranscriptomes 0.99
Isolates 1.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.7
Nodule 1.24
Rhizoplane 7.92
Rhizosphere 84.65
Stem 0
Stem Tuber 0
Unclassified 0.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373936_0014639 3300035113 Bacteria 3001
2 JGI24750J21931_1002556 3300002070 Bacteria 2197
3 JGI24744J21845_10056449 3300002077 Bacteria 721
4 Ga0058861_11528593 3300004800 Bacteria 824
5 Ga0058862_12642361 3300004803 Bacteria 1289
6 Ga0065712_10341169 3300005290 Bacteria 800
7 Ga0070658_10083555 3300005327 Bacteria 2625
8 Ga0070658_10735182 3300005327 Bacteria 857
9 Ga0070683_100051211 3300005329 Bacteria 3822
10 Ga0068869_100439782 3300005334 Bacteria 1079
11 Ga0070666_10336177 3300005335 Bacteria 1079
12 Ga0070666_10347518 3300005335 Bacteria 1061
13 Ga0070680_100030935 3300005336 Bacteria 4301
14 Ga0070680_100032332 3300005336 Bacteria 4211
15 Ga0070660_100107000 3300005339 Bacteria 2222
16 Ga0070689_100656375 3300005340 Bacteria 913
17 Ga0070691_10017744 3300005341 Bacteria 3275
18 Ga0070691_10677121 3300005341 Bacteria 617
19 Ga0070661_100056971 3300005344 Bacteria 2864
20 Ga0070661_100060582 3300005344 Bacteria 2777
21 Ga0070668_100219651 3300005347 Bacteria 1567
22 Ga0070675_100698026 3300005354 Bacteria 924
23 Ga0070671_100039391 3300005355 Bacteria 3923
24 Ga0070671_100865424 3300005355 Bacteria 789
25 Ga0070674_100170762 3300005356 Bacteria 1657
26 Ga0070674_100562441 3300005356 Bacteria 958
27 Ga0070673_100177788 3300005364 Bacteria 1820
28 Ga0070673_100330616 3300005364 Bacteria 1348
29 Ga0070688_101633283 3300005365 Bacteria 527
30 Ga0070659_100155178 3300005366 Bacteria 1869
31 Ga0070709_10017254 3300005434 Bacteria 4137
32 Ga0070709_10329245 3300005434 Bacteria 1123
33 Ga0070709_11344690 3300005434 Bacteria 577
34 Ga0070714_101085042 3300005435 Bacteria 780
35 Ga0070713_100212392 3300005436 Bacteria 1752
36 Ga0070713_101429954 3300005436 Bacteria 671
37 Ga0070710_10015581 3300005437 Bacteria 3851
38 Ga0070710_10024617 3300005437 Bacteria 3178
39 Ga0070710_10203961 3300005437 Bacteria 1250
40 Ga0070711_100008057 3300005439 Bacteria 6433
41 Ga0070711_100137023 3300005439 Bacteria 1831
42 Ga0070700_100028523 3300005441 Bacteria 3321
43 Ga0070694_101909389 3300005444 Bacteria 507
44 Ga0070708_100490706 3300005445 Bacteria 1159
45 Ga0070663_100388853 3300005455 Bacteria 1138
46 Ga0070663_100753654 3300005455 Bacteria 831
47 Ga0070663_101522862 3300005455 Bacteria 595
48 Ga0070678_100107116 3300005456 Bacteria 2179
49 Ga0070678_100155664 3300005456 Bacteria 1846
50 Ga0070678_100176129 3300005456 Bacteria 1746
51 Ga0070662_100733657 3300005457 Bacteria 837
52 Ga0070681_10041611 3300005458 Bacteria 4605
53 Ga0070681_11267871 3300005458 Bacteria 659
54 Ga0068867_100027055 3300005459 Bacteria 4120
55 Ga0068867_101020947 3300005459 Bacteria 751
56 Ga0070685_10320243 3300005466 Bacteria 1051
57 Ga0070685_10633423 3300005466 Bacteria 773
58 Ga0070685_11492491 3300005466 Bacteria 521
59 Ga0070698_100727629 3300005471 Bacteria 935
60 Ga0070679_100278277 3300005530 Bacteria 1626
61 Ga0070679_100895014 3300005530 Bacteria 831
62 Ga0070684_100006848 3300005535 Bacteria 8842
63 Ga0070684_101548740 3300005535 Bacteria 625
64 Ga0070697_100007122 3300005536 Bacteria 8696
65 Ga0070697_100025780 3300005536 Bacteria 4689
66 Ga0070697_100102463 3300005536 Bacteria 2378
67 Ga0068853_100002046 3300005539 Bacteria 14941
68 Ga0070672_100517393 3300005543 Bacteria 1034
69 Ga0070695_100009804 3300005545 Bacteria 5706
70 Ga0070696_100640164 3300005546 Bacteria 861
71 Ga0070696_101236759 3300005546 Bacteria 632
72 Ga0070696_101744131 3300005546 Unclassified 537
73 Ga0070693_100203411 3300005547 Bacteria 1287
74 Ga0070693_100236317 3300005547 Bacteria 1205
75 Ga0068855_100118419 3300005563 Bacteria 3033
76 Ga0068855_101607087 3300005563 Bacteria 665
77 Ga0070664_100763727 3300005564 Bacteria 903
78 Ga0068857_100151542 3300005577 Bacteria 2101
79 Ga0068857_100237208 3300005577 Bacteria 1669
80 Ga0068854_100854597 3300005578 Bacteria 797
81 Ga0068856_100732118 3300005614 Bacteria 1009
82 Ga0070702_100174376 3300005615 Bacteria 1401
83 Ga0070702_100489665 3300005615 Bacteria 901
84 Ga0068852_100429397 3300005616 Bacteria 1304
85 Ga0068852_100511819 3300005616 Bacteria 1197
86 Ga0068852_101086889 3300005616 Bacteria 820
87 Ga0068864_100087108 3300005618 Bacteria 2749
88 Ga0068864_101353654 3300005618 Bacteria 713
89 Ga0068866_10906963 3300005718 Bacteria 620
90 Ga0068861_100866100 3300005719 Bacteria 853
91 Ga0068851_10007760 3300005834 Bacteria 4936
92 Ga0068863_102711251 3300005841 Bacteria 504
93 Ga0081538_10118704 3300005981 Bacteria 1277
94 Ga0081540_1119379 3300005983 Bacteria 1097
95 Ga0070717_10802912 3300006028 Bacteria 856
96 Ga0070715_10137118 3300006163 Bacteria 1184
97 Ga0070716_100060181 3300006173 Bacteria 2192
98 Ga0070716_100671182 3300006173 Bacteria 788
99 Ga0070712_100123386 3300006175 Bacteria 1953
100 Ga0070712_100411488 3300006175 Bacteria 1119
101 Ga0075362_10543335 3300006177 Bacteria 597
102 Ga0097621_100437668 3300006237 Bacteria 1176
103 Ga0097621_100502349 3300006237 Bacteria 1098
104 Ga0068871_100126444 3300006358 Bacteria 2164
105 Ga0068871_100161503 3300006358 Bacteria 1917
106 Ga0075428_100773908 3300006844 Bacteria 1021
107 Ga0075430_100687092 3300006846 Bacteria 843
108 Ga0075431_100496813 3300006847 Bacteria 1211
109 Ga0068865_100253839 3300006881 Bacteria 1389
110 Ga0075436_100153662 3300006914 Bacteria 1620
111 Ga0075435_100109230 3300007076 Bacteria 2299
112 Ga0075435_100992077 3300007076 Bacteria 733
113 Ga0099794_10224101 3300007265 Bacteria 966
114 Ga0099794_10459892 3300007265 Bacteria 668
115 Ga0099795_10070855 3300007788 Bacteria 1315
116 Ga0105251_10205882 3300009011 Bacteria 886
117 Ga0105240_10013202 3300009093 Bacteria 11365
118 Ga0105240_10037304 3300009093 Bacteria 6247
119 Ga0105245_10023519 3300009098 Bacteria 5409
120 Ga0105245_11487546 3300009098 Bacteria 728
121 Ga0105247_10552628 3300009101 Bacteria 847
122 Ga0105243_12494171 3300009148 Bacteria 556
123 Ga0105237_10015833 3300009545 Bacteria 7843
124 Ga0105237_10657210 3300009545 Bacteria 1055
125 Ga0105238_10030812 3300009551 Bacteria 5459
126 Ga0105238_10080104 3300009551 Bacteria 3255
127 Ga0105249_10177797 3300009553 Bacteria 2068
128 Ga0105249_11673648 3300009553 Bacteria 709
129 Ga0099796_10029253 3300010159 Bacteria 1776
130 Ga0099796_10090398 3300010159 Bacteria 1137
131 Ga0099796_10162029 3300010159 Bacteria 887
132 Ga0099796_10286705 3300010159 Bacteria 694
133 Ga0105239_10022119 3300010375 Bacteria 7008
134 Ga0105239_10293556 3300010375 Bacteria 1830
135 Ga0105246_10006100 3300011119 Bacteria 7355
136 Ga0105246_10302456 3300011119 Bacteria 1292
137 Ga0105246_10409398 3300011119 Bacteria 1128
138 Ga0105246_10493480 3300011119 Bacteria 1038
139 Ga0157370_10027652 3300013104 Bacteria 5591
140 Ga0157370_10046245 3300013104 Bacteria 4173
141 Ga0157369_10015069 3300013105 Bacteria 8727
142 Ga0157374_10177698 3300013296 Bacteria 2078
143 Ga0157374_11276424 3300013296 Bacteria 756
144 Ga0157378_10020524 3300013297 Bacteria 5809
145 Ga0157378_10955049 3300013297 Bacteria 890
146 Ga0157378_11288619 3300013297 Bacteria 772
147 Ga0163162_10025263 3300013306 Bacteria 5870
148 Ga0163162_10891347 3300013306 Bacteria 1003
149 Ga0157375_10036108 3300013308 Bacteria 4724
150 Ga0163163_10592903 3300014325 Bacteria 1171
151 Ga0163163_11700976 3300014325 Bacteria 691
152 Ga0157380_10141401 3300014326 Bacteria 2068
153 Ga0157380_10233784 3300014326 Bacteria 1653
154 Ga0157377_10632787 3300014745 Bacteria 768
155 Ga0157379_10390096 3300014968 Bacteria 1279
156 Ga0157379_10959705 3300014968 Bacteria 813
157 Ga0157376_10037409 3300014969 Bacteria 3939
158 Ga0157376_10242881 3300014969 Bacteria 1678
159 Ga0163161_10054773 3300017792 Bacteria 2895
160 Ga0163161_10470527 3300017792 Bacteria 1019
161 Ga0163161_11234897 3300017792 Bacteria 647
162 Ga0197907_10951524 3300020069 Bacteria 684
163 Ga0206356_10789575 3300020070 Bacteria 1260
164 Ga0207656_10018083 3300025321 Bacteria 2769
165 Ga0207682_10312045 3300025893 Bacteria 738
166 Ga0207692_10011685 3300025898 Bacteria 3747
167 Ga0207692_10064240 3300025898 Bacteria 1910
168 Ga0207688_10081469 3300025901 Bacteria 1849
169 Ga0207688_10316424 3300025901 Bacteria 957
170 Ga0207680_10926622 3300025903 Bacteria 624
171 Ga0207685_10013495 3300025905 Bacteria 2529
172 Ga0207699_10078001 3300025906 Bacteria 2045
173 Ga0207699_10482846 3300025906 Bacteria 893
174 Ga0207705_10383062 3300025909 Bacteria 1086
175 Ga0207707_10038353 3300025912 Bacteria 4186
176 Ga0207707_10067370 3300025912 Bacteria 3118
177 Ga0207695_10093742 3300025913 Bacteria 3012
178 Ga0207695_10821255 3300025913 Bacteria 810
179 Ga0207671_10060833 3300025914 Bacteria 2802
180 Ga0207693_10027604 3300025915 Bacteria 4487
181 Ga0207693_10130976 3300025915 Bacteria 1972
182 Ga0207663_10054591 3300025916 Bacteria 2502
183 Ga0207663_11214297 3300025916 Bacteria 607
184 Ga0207660_10143526 3300025917 Bacteria 1827
185 Ga0207660_10763188 3300025917 Bacteria 789
186 Ga0207660_10808109 3300025917 Bacteria 765
187 Ga0207657_10002309 3300025919 Bacteria 20677
188 Ga0207649_10084076 3300025920 Bacteria 2068
189 Ga0207652_10068093 3300025921 Bacteria 3088
190 Ga0207652_10526366 3300025921 Bacteria 1063
191 Ga0207646_10046406 3300025922 Bacteria 3898
192 Ga0207646_11675993 3300025922 Bacteria 547
193 Ga0207694_10016998 3300025924 Bacteria 5495
194 Ga0207694_10421507 3300025924 Bacteria 1112
195 Ga0207687_10022551 3300025927 Bacteria 4191
196 Ga0207700_10029590 3300025928 Bacteria 3866
197 Ga0207700_10156341 3300025928 Bacteria 1889
198 Ga0207664_10886368 3300025929 Bacteria 801
199 Ga0207644_10034099 3300025931 Bacteria 3562
200 Ga0207644_10552290 3300025931 Bacteria 953
201 Ga0207706_10456970 3300025933 Bacteria 1104
202 Ga0207670_10871976 3300025936 Bacteria 753
203 Ga0207669_10072112 3300025937 Bacteria 2173
204 Ga0207669_10079818 3300025937 Bacteria 2090
205 Ga0207665_10039121 3300025939 Bacteria 3161
206 Ga0207665_10274571 3300025939 Bacteria 1253
207 Ga0207665_10606845 3300025939 Bacteria 855
208 Ga0207665_11099834 3300025939 Bacteria 634
209 Ga0207689_10406830 3300025942 Bacteria 1135
210 Ga0207661_10046432 3300025944 Bacteria 3444
211 Ga0207679_10030855 3300025945 Bacteria 3747
212 Ga0207667_10006322 3300025949 Bacteria 14355
213 Ga0207667_10024168 3300025949 Bacteria 6676
214 Ga0207667_10804353 3300025949 Bacteria 937
215 Ga0207651_10077619 3300025960 Bacteria 2379
216 Ga0207651_10521397 3300025960 Bacteria 1030
217 Ga0207651_11451668 3300025960 Bacteria 618
218 Ga0207712_10034113 3300025961 Bacteria 3446
219 Ga0207640_10370214 3300025981 Bacteria 1158
220 Ga0207658_10646832 3300025986 Bacteria 953
221 Ga0207677_10010183 3300026023 Bacteria 5312
222 Ga0207677_11950562 3300026023 Bacteria 546
223 Ga0207677_12058465 3300026023 Bacteria 531
224 Ga0207639_10074760 3300026041 Bacteria 2662
225 Ga0207639_10081421 3300026041 Bacteria 2564
226 Ga0207678_10069659 3300026067 Bacteria 3016
227 Ga0207678_10081245 3300026067 Bacteria 2774
228 Ga0207708_10003321 3300026075 Bacteria 11845
229 Ga0207702_11400022 3300026078 Bacteria 693
230 Ga0207641_10271076 3300026088 Bacteria 1593
231 Ga0207641_12470136 3300026088 Bacteria 518
232 Ga0207648_10097531 3300026089 Bacteria 2573
233 Ga0207648_11624595 3300026089 Bacteria 607
234 Ga0207676_10051561 3300026095 Bacteria 3213
235 Ga0207676_11213016 3300026095 Bacteria 748
236 Ga0207674_10012507 3300026116 Bacteria 9481
237 Ga0207674_10585788 3300026116 Bacteria 1077
238 Ga0207683_10029392 3300026121 Bacteria 4758
239 Ga0207683_10074116 3300026121 Bacteria 3011
240 Ga0207683_10099241 3300026121 Bacteria 2599
241 Ga0207698_10062250 3300026142 Bacteria 2913
242 Ga0207698_10795833 3300026142 Bacteria 947
243 Ga0209179_1091613 3300027512 Bacteria 674
244 Ga0209588_1008002 3300027671 Bacteria 3127
245 Ga0268266_10449071 3300028379 Bacteria 1225
246 Ga0268265_11253258 3300028380 Bacteria 740
247 Ga0265336_10103680 3300028666 Bacteria 847
248 Ga0307517_10327549 3300028786 Bacteria 844
249 Ga0307517_10365006 3300028786 Bacteria 778
250 Ga0265338_10332372 3300028800 Bacteria 1097
251 Ga0265328_10101077 3300031239 Bacteria 1068
252 Ga0307408_100855628 3300031548 Bacteria 829
253 Ga0307411_12191989 3300032005 Bacteria 518
254 Ga0307510_10446661 3300033180 Bacteria 734
255 Ga0373930_0205631 3300034816 Bacteria 514
256 Ga0373934_0299780 3300035086 Bacteria 667
257 Ga0373944_0271729 3300035089 Bacteria 630
258 Ga0373945_0005563 3300035116 Bacteria 4038
259 Ga0373954_0025256 3300035118 Bacteria 2715
260 Ga0373943_0016307 3300035170 Bacteria 3386
261 Ga0373946_0000788 3300035171 Bacteria 10802
262 Ga0373955_0068233 3300035172 Bacteria 1981
263 Ga0373955_0648083 3300035172 Bacteria 648
264 Ga0373962_0398733 3300035242 Bacteria 506
265 Ga0373935_0002501 3300035692 Bacteria 10535
266 Ga0373935_1165907 3300035692 Bacteria 574
267 Ga0373927_0000564 3300035695 Bacteria 28279
268 Ga0373927_0016306 3300035695 Bacteria 4902
269 Ga0373947_0002584 3300035725 Bacteria 10871
270 Ga0373947_0004169 3300035725 Bacteria 8492
271 Ga0373937_0647048 3300036401 Bacteria 1002
272 Ga0373925_0009074 3300037068 Bacteria 7240
273 Ga0373925_0455806 3300037068 Bacteria 1048
274 Ga0451845_0514505 3300041501 Bacteria 626
275 Ga0439445_0261412 3300042004 Bacteria 518
276 Ga0495592_0045390 3300046454 Bacteria 3279
277 Ga0495603_0000072 3300046455 Bacteria 44178
278 Ga0495603_0004634 3300046455 Bacteria 8214
279 Ga0495603_0006194 3300046455 Bacteria 7154
280 Ga0495629_0000136 3300046459 Bacteria 64126
281 Ga0495638_0333497 3300046460 Bacteria 806
282 Ga0495641_0001701 3300046461 Bacteria 18384
283 Ga0495651_0490127 3300046462 Bacteria 788
284 Ga0495580_0002073 3300046472 Bacteria 17604
285 Ga0495582_0000015 3300046473 Bacteria 101848
286 Ga0495582_0506342 3300046473 Bacteria 698
287 Ga0495639_0000025 3300046475 Bacteria 68702
288 Ga0495639_0083996 3300046475 Bacteria 1486
289 Ga0495662_0000508 3300046476 Bacteria 17697
290 Ga0495584_0506647 3300046491 Bacteria 615
291 Ga0495594_0000156 3300046499 Bacteria 32566
292 Ga0495628_0040802 3300046516 Bacteria 3707
293 Ga0495628_0616902 3300046516 Bacteria 773
294 Ga0495630_0093600 3300046517 Bacteria 2271
295 Ga0495637_0124110 3300046520 Bacteria 991
296 Ga0495643_0165767 3300046522 Bacteria 1084
297 Ga0495644_0035536 3300046523 Bacteria 1882
298 Ga0495666_0059308 3300046526 Bacteria 1830
299 Ga0495666_0344106 3300046526 Bacteria 672
300 Ga0495666_0412550 3300046526 Bacteria 606
301 Ga0495652_0149733 3300046529 Bacteria 1825
302 Ga0495665_0000548 3300046531 Bacteria 19083
303 Ga0495640_0004382 3300046533 Bacteria 11266
304 Ga0495621_0395987 3300046539 Bacteria 585
305 Ga0495622_0011784 3300046557 Bacteria 4042
306 Ga0495667_0027548 3300046559 Bacteria 3828
307 Ga0495634_0000723 3300046642 Bacteria 31979
308 Ga0495625_0082430 3300046660 Bacteria 2237
309 Ga0495635_0000143 3300046663 Bacteria 43594
310 Ga0495659_0104195 3300046664 Bacteria 1102
311 Ga0495588_0005599 3300046674 Bacteria 5598
312 Ga0495599_0854732 3300046678 Bacteria 517
313 Ga0495647_0001357 3300046681 Bacteria 7542
314 Ga0495658_0008358 3300046683 Bacteria 5124
315 Ga0495658_0705040 3300046683 Bacteria 646
316 Ga0495669_0001205 3300046684 Bacteria 10760
317 Ga0495669_0075390 3300046684 Bacteria 1543
318 Ga0495669_0170234 3300046684 Bacteria 1036
319 Ga0495613_0004768 3300046689 Bacteria 10176
320 Ga0495624_0000331 3300046690 Bacteria 37420
321 Ga0495670_0809658 3300046691 Bacteria 511
322 Ga0495581_0000056 3300047315 Bacteria 42968
323 Ga0495581_0364778 3300047315 Bacteria 843
324 Ga0495674_0000332 3300047319 Bacteria 41530
325 Ga0495672_0066225 3300047320 Bacteria 2062
326 Ga0495676_0074932 3300047321 Bacteria 2590
327 Ga0495676_0260454 3300047321 Bacteria 1180
328 Ga0495675_0820164 3300047444 Bacteria 514
329 Ga0495673_0011929 3300047469 Bacteria 4642
330 Ga0495593_0000037 3300047673 Bacteria 53464
331 Ga0495614_0024024 3300048089 Bacteria 2631
332 Ga0496100_0026931 3300048903 Bacteria 3530
333 Ga0496100_0702199 3300048903 Bacteria 789
334 Ga0496101_0028752 3300048904 Bacteria 3884
335 Ga0496101_0537305 3300048904 Bacteria 924
336 Ga0496101_0760101 3300048904 Bacteria 765
337 Ga0496102_0019481 3300048905 Bacteria 5976
338 Ga0496102_0156788 3300048905 Bacteria 2140
339 Ga0496102_0308944 3300048905 Bacteria 1490
340 Ga0496103_0057295 3300048906 Bacteria 2419
341 Ga0496104_0079884 3300048907 Bacteria 3117
342 Ga0496104_0514480 3300048907 Bacteria 1108
343 Ga0496105_0041877 3300048908 Bacteria 3774
344 Ga0496106_0020661 3300048909 Bacteria 4889
345 Ga0496107_0002957 3300048910 Bacteria 11251
346 Ga0496107_0338944 3300048910 Bacteria 1119
347 Ga0496107_0475375 3300048910 Bacteria 928
348 Ga0496108_1795187 3300048911 Bacteria 502
349 Ga0496110_0943222 3300048913 Bacteria 769
350 Ga0496111_0027263 3300048914 Bacteria 4040
351 Ga0496111_0082868 3300048914 Bacteria 2343
352 Ga0496112_0102120 3300048915 Bacteria 2837
353 Ga0496112_1237836 3300048915 Bacteria 663
354 Ga0496113_0030438 3300048916 Bacteria 3907
355 Ga0496113_0301247 3300048916 Bacteria 1283
356 Ga0496113_0879956 3300048916 Bacteria 709
357 Ga0496114_0029306 3300048917 Bacteria 4522
358 Ga0496114_1421742 3300048917 Bacteria 581
359 Ga0496114_1635644 3300048917 Bacteria 532
360 Ga0496114_1799480 3300048917 Bacteria 501
361 Ga0496115_0001085 3300048918 Bacteria 19693
362 Ga0496115_0368043 3300048918 Bacteria 1170
363 Ga0496115_1037967 3300048918 Bacteria 625
364 Ga0496125_0521412 3300048928 Bacteria 664
365 Ga0496126_0110682 3300048929 Bacteria 2392
366 Ga0501032_0568842 3300049569 Bacteria 722
367 Ga0501034_0106763 3300049571 Bacteria 2793
368 Ga0501034_1258890 3300049571 Bacteria 617
369 Ga0501042_1022870 3300049578 Bacteria 602
370 Ga0501046_1111193 3300049580 Bacteria 546
371 Ga0501069_0435780 3300049585 Bacteria 778
372 Ga0501070_0033033 3300049586 Bacteria 4328
373 Ga0501079_0997072 3300049741 Bacteria 660
374 Ga0501044_0288203 3300049823 Bacteria 1574
375 nmdc:mga0qj67_1000407_c1 3300050509 Bacteria 656
376 nmdc:mga0qj67_1098082_c1 3300050509 Bacteria 621
377 nmdc:mga0qj67_823828_c1 3300050509 Bacteria 734
378 nmdc:mga0rr50_241546_c1 3300050513 Bacteria 1497
379 nmdc:mga0rr50_75974_c1 3300050513 Bacteria 2577
380 nmdc:mga08x19_6_c2 3300050514 Bacteria 52011
381 Ga0500635_0005372 3300053080 Bacteria 3357
382 Ga0495619_0020901 3300053085 Bacteria 4175
383 Ga0500643_055556 3300053087 Bacteria 1121
384 Ga0500643_104448 3300053087 Bacteria 767
385 Ga0500644_0001565 3300053088 Bacteria 6006
386 Ga0500646_0387404 3300053090 Bacteria 515
387 Ga0500651_0029503 3300053093 Bacteria 3450
388 Ga0500566_0179545 3300053094 Bacteria 1087
389 Ga0500650_0110357 3300053098 Bacteria 1284
390 Ga0500554_009233 3300053102 Bacteria 2354
391 Ga0500595_000001 3300053119 Bacteria 1088438
392 Ga0500642_0130553 3300053130 Bacteria 1177
393 Ga0500652_012496 3300053131 Bacteria 2981
394 Ga0500603_001308 3300053150 Bacteria 5715
395 Ga0500616_0000001 3300053153 Bacteria 1986011
396 Ga0500616_0094160 3300053153 Bacteria 1476
397 Ga0500638_209775 3300053162 Bacteria 817
398 Ga0500637_0026990 3300053178 Bacteria 3167
399 Ga0500645_000590 3300053730 Bacteria 23439
400 2513694169 2513237101 Bacteria 7952346
401 2723849455 2721755755 Bacteria 8322773
402 8006970450 8006964411 Bacteria 8966052
403 8007000083 8006994254 Bacteria 8309700
404 8056677831 8056673599 Bacteria 7871253
405 Ga0373936_0014639
406 JGI24750J21931_1002556
407 JGI24744J21845_10056449
408 Ga0058861_11528593
409 Ga0058862_12642361
410 Ga0065712_10341169
411 Ga0070658_10083555
412 Ga0070658_10735182
413 Ga0070683_100051211
414 Ga0068869_100439782
415 Ga0070666_10336177
416 Ga0070666_10347518
417 Ga0070680_100030935
418 Ga0070680_100032332
419 Ga0070660_100107000
420 Ga0070689_100656375
421 Ga0070691_10017744
422 Ga0070691_10677121
423 Ga0070661_100056971
424 Ga0070661_100060582
425 Ga0070668_100219651
426 Ga0070675_100698026
427 Ga0070671_100039391
428 Ga0070671_100865424
429 Ga0070674_100170762
430 Ga0070674_100562441
431 Ga0070673_100177788
432 Ga0070673_100330616
433 Ga0070688_101633283
434 Ga0070659_100155178
435 Ga0070709_10017254
436 Ga0070709_10329245
437 Ga0070709_11344690
438 Ga0070714_101085042
439 Ga0070713_100212392
440 Ga0070713_101429954
441 Ga0070710_10015581
442 Ga0070710_10024617
443 Ga0070710_10203961
444 Ga0070711_100008057
445 Ga0070711_100137023
446 Ga0070700_100028523
447 Ga0070694_101909389
448 Ga0070708_100490706
449 Ga0070663_100388853
450 Ga0070663_100753654
451 Ga0070663_101522862
452 Ga0070678_100107116
453 Ga0070678_100155664
454 Ga0070678_100176129
455 Ga0070662_100733657
456 Ga0070681_10041611
457 Ga0070681_11267871
458 Ga0068867_100027055
459 Ga0068867_101020947
460 Ga0070685_10320243
461 Ga0070685_10633423
462 Ga0070685_11492491
463 Ga0070698_100727629
464 Ga0070679_100278277
465 Ga0070679_100895014
466 Ga0070684_100006848
467 Ga0070684_101548740
468 Ga0070697_100007122
469 Ga0070697_100025780
470 Ga0070697_100102463
471 Ga0068853_100002046
472 Ga0070672_100517393
473 Ga0070695_100009804
474 Ga0070696_100640164
475 Ga0070696_101236759
476 Ga0070696_101744131
477 Ga0070693_100203411
478 Ga0070693_100236317
479 Ga0068855_100118419
480 Ga0068855_101607087
481 Ga0070664_100763727
482 Ga0068857_100151542
483 Ga0068857_100237208
484 Ga0068854_100854597
485 Ga0068856_100732118
486 Ga0070702_100174376
487 Ga0070702_100489665
488 Ga0068852_100429397
489 Ga0068852_100511819
490 Ga0068852_101086889
491 Ga0068864_100087108
492 Ga0068864_101353654
493 Ga0068866_10906963
494 Ga0068861_100866100
495 Ga0068851_10007760
496 Ga0068863_102711251
497 Ga0081538_10118704
498 Ga0081540_1119379
499 Ga0070717_10802912
500 Ga0070715_10137118
501 Ga0070716_100060181
502 Ga0070716_100671182
503 Ga0070712_100123386
504 Ga0070712_100411488
505 Ga0075362_10543335
506 Ga0097621_100437668
507 Ga0097621_100502349
508 Ga0068871_100126444
509 Ga0068871_100161503
510 Ga0075428_100773908
511 Ga0075430_100687092
512 Ga0075431_100496813
513 Ga0068865_100253839
514 Ga0075436_100153662
515 Ga0075435_100109230
516 Ga0075435_100992077
517 Ga0099794_10224101
518 Ga0099794_10459892
519 Ga0099795_10070855
520 Ga0105251_10205882
521 Ga0105240_10013202
522 Ga0105240_10037304
523 Ga0105245_10023519
524 Ga0105245_11487546
525 Ga0105247_10552628
526 Ga0105243_12494171
527 Ga0105237_10015833
528 Ga0105237_10657210
529 Ga0105238_10030812
530 Ga0105238_10080104
531 Ga0105249_10177797
532 Ga0105249_11673648
533 Ga0099796_10029253
534 Ga0099796_10090398
535 Ga0099796_10162029
536 Ga0099796_10286705
537 Ga0105239_10022119
538 Ga0105239_10293556
539 Ga0105246_10006100
540 Ga0105246_10302456
541 Ga0105246_10409398
542 Ga0105246_10493480
543 Ga0157370_10027652
544 Ga0157370_10046245
545 Ga0157369_10015069
546 Ga0157374_10177698
547 Ga0157374_11276424
548 Ga0157378_10020524
549 Ga0157378_10955049
550 Ga0157378_11288619
551 Ga0163162_10025263
552 Ga0163162_10891347
553 Ga0157375_10036108
554 Ga0163163_10592903
555 Ga0163163_11700976
556 Ga0157380_10141401
557 Ga0157380_10233784
558 Ga0157377_10632787
559 Ga0157379_10390096
560 Ga0157379_10959705
561 Ga0157376_10037409
562 Ga0157376_10242881
563 Ga0163161_10054773
564 Ga0163161_10470527
565 Ga0163161_11234897
566 Ga0197907_10951524
567 Ga0206356_10789575
568 Ga0207656_10018083
569 Ga0207682_10312045
570 Ga0207692_10011685
571 Ga0207692_10064240
572 Ga0207688_10081469
573 Ga0207688_10316424
574 Ga0207680_10926622
575 Ga0207685_10013495
576 Ga0207699_10078001
577 Ga0207699_10482846
578 Ga0207705_10383062
579 Ga0207707_10038353
580 Ga0207707_10067370
581 Ga0207695_10093742
582 Ga0207695_10821255
583 Ga0207671_10060833
584 Ga0207693_10027604
585 Ga0207693_10130976
586 Ga0207663_10054591
587 Ga0207663_11214297
588 Ga0207660_10143526
589 Ga0207660_10763188
590 Ga0207660_10808109
591 Ga0207657_10002309
592 Ga0207649_10084076
593 Ga0207652_10068093
594 Ga0207652_10526366
595 Ga0207646_10046406
596 Ga0207646_11675993
597 Ga0207694_10016998
598 Ga0207694_10421507
599 Ga0207687_10022551
600 Ga0207700_10029590
601 Ga0207700_10156341
602 Ga0207664_10886368
603 Ga0207644_10034099
604 Ga0207644_10552290
605 Ga0207706_10456970
606 Ga0207670_10871976
607 Ga0207669_10072112
608 Ga0207669_10079818
609 Ga0207665_10039121
610 Ga0207665_10274571
611 Ga0207665_10606845
612 Ga0207665_11099834
613 Ga0207689_10406830
614 Ga0207661_10046432
615 Ga0207679_10030855
616 Ga0207667_10006322
617 Ga0207667_10024168
618 Ga0207667_10804353
619 Ga0207651_10077619
620 Ga0207651_10521397
621 Ga0207651_11451668
622 Ga0207712_10034113
623 Ga0207640_10370214
624 Ga0207658_10646832
625 Ga0207677_10010183
626 Ga0207677_11950562
627 Ga0207677_12058465
628 Ga0207639_10074760
629 Ga0207639_10081421
630 Ga0207678_10069659
631 Ga0207678_10081245
632 Ga0207708_10003321
633 Ga0207702_11400022
634 Ga0207641_10271076
635 Ga0207641_12470136
636 Ga0207648_10097531
637 Ga0207648_11624595
638 Ga0207676_10051561
639 Ga0207676_11213016
640 Ga0207674_10012507
641 Ga0207674_10585788
642 Ga0207683_10029392
643 Ga0207683_10074116
644 Ga0207683_10099241
645 Ga0207698_10062250
646 Ga0207698_10795833
647 Ga0209179_1091613
648 Ga0209588_1008002
649 Ga0268266_10449071
650 Ga0268265_11253258
651 Ga0265336_10103680
652 Ga0307517_10327549
653 Ga0307517_10365006
654 Ga0265338_10332372
655 Ga0265328_10101077
656 Ga0307408_100855628
657 Ga0307411_12191989
658 Ga0307510_10446661
659 Ga0373930_0205631
660 Ga0373934_0299780
661 Ga0373944_0271729
662 Ga0373945_0005563
663 Ga0373954_0025256
664 Ga0373943_0016307
665 Ga0373946_0000788
666 Ga0373955_0068233
667 Ga0373955_0648083
668 Ga0373962_0398733
669 Ga0373935_0002501
670 Ga0373935_1165907
671 Ga0373927_0000564
672 Ga0373927_0016306
673 Ga0373947_0002584
674 Ga0373947_0004169
675 Ga0373937_0647048
676 Ga0373925_0009074
677 Ga0373925_0455806
678 Ga0451845_0514505
679 Ga0439445_0261412
680 Ga0495592_0045390
681 Ga0495603_0000072
682 Ga0495603_0004634
683 Ga0495603_0006194
684 Ga0495629_0000136
685 Ga0495638_0333497
686 Ga0495641_0001701
687 Ga0495651_0490127
688 Ga0495580_0002073
689 Ga0495582_0000015
690 Ga0495582_0506342
691 Ga0495639_0000025
692 Ga0495639_0083996
693 Ga0495662_0000508
694 Ga0495584_0506647
695 Ga0495594_0000156
696 Ga0495628_0040802
697 Ga0495628_0616902
698 Ga0495630_0093600
699 Ga0495637_0124110
700 Ga0495643_0165767
701 Ga0495644_0035536
702 Ga0495666_0059308
703 Ga0495666_0344106
704 Ga0495666_0412550
705 Ga0495652_0149733
706 Ga0495665_0000548
707 Ga0495640_0004382
708 Ga0495621_0395987
709 Ga0495622_0011784
710 Ga0495667_0027548
711 Ga0495634_0000723
712 Ga0495625_0082430
713 Ga0495635_0000143
714 Ga0495659_0104195
715 Ga0495588_0005599
716 Ga0495599_0854732
717 Ga0495647_0001357
718 Ga0495658_0008358
719 Ga0495658_0705040
720 Ga0495669_0001205
721 Ga0495669_0075390
722 Ga0495669_0170234
723 Ga0495613_0004768
724 Ga0495624_0000331
725 Ga0495670_0809658
726 Ga0495581_0000056
727 Ga0495581_0364778
728 Ga0495674_0000332
729 Ga0495672_0066225
730 Ga0495676_0074932
731 Ga0495676_0260454
732 Ga0495675_0820164
733 Ga0495673_0011929
734 Ga0495593_0000037
735 Ga0495614_0024024
736 Ga0496100_0026931
737 Ga0496100_0702199
738 Ga0496101_0028752
739 Ga0496101_0537305
740 Ga0496101_0760101
741 Ga0496102_0019481
742 Ga0496102_0156788
743 Ga0496102_0308944
744 Ga0496103_0057295
745 Ga0496104_0079884
746 Ga0496104_0514480
747 Ga0496105_0041877
748 Ga0496106_0020661
749 Ga0496107_0002957
750 Ga0496107_0338944
751 Ga0496107_0475375
752 Ga0496108_1795187
753 Ga0496110_0943222
754 Ga0496111_0027263
755 Ga0496111_0082868
756 Ga0496112_0102120
757 Ga0496112_1237836
758 Ga0496113_0030438
759 Ga0496113_0301247
760 Ga0496113_0879956
761 Ga0496114_0029306
762 Ga0496114_1421742
763 Ga0496114_1635644
764 Ga0496114_1799480
765 Ga0496115_0001085
766 Ga0496115_0368043
767 Ga0496115_1037967
768 Ga0496125_0521412
769 Ga0496126_0110682
770 Ga0501032_0568842
771 Ga0501034_0106763
772 Ga0501034_1258890
773 Ga0501042_1022870
774 Ga0501046_1111193
775 Ga0501069_0435780
776 Ga0501070_0033033
777 Ga0501079_0997072
778 Ga0501044_0288203
779 nmdc:mga0qj67_1000407_c1
780 nmdc:mga0qj67_1098082_c1
781 nmdc:mga0qj67_823828_c1
782 nmdc:mga0rr50_241546_c1
783 nmdc:mga0rr50_75974_c1
784 nmdc:mga08x19_6_c2
785 Ga0500635_0005372
786 Ga0495619_0020901
787 Ga0500643_055556
788 Ga0500643_104448
789 Ga0500644_0001565
790 Ga0500646_0387404
791 Ga0500651_0029503
792 Ga0500566_0179545
793 Ga0500650_0110357
794 Ga0500554_009233
795 Ga0500595_000001
796 Ga0500642_0130553
797 Ga0500652_012496
798 Ga0500603_001308
799 Ga0500616_0000001
800 Ga0500616_0094160
801 Ga0500638_209775
802 Ga0500637_0026990
803 Ga0500645_000590
804 2513694169
805 2723849455
806 8006970450
807 8007000083
808 8056677831

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07237

DUF1428

Protein of unknown function (DUF1428)

26

129

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2okq-assembly1.cif.gz_A crystal structure of unknown conserved ybaa protein from shigella flexneri 0.833 1 112
2okq-assembly1.cif.gz_B crystal structure of unknown conserved ybaa protein from shigella flexneri 0.8243 1 112
2okq-assembly1.cif.gz_A crystal structure of unknown conserved ybaa protein from shigella flexneri 0.7567 1 112
2omo-assembly2.cif.gz_C putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea 0.7513 2 98
1tz0-assembly1.cif.gz_A crystal structure of putative antibiotic biosythesis monooxygenase from bacillus cereus 0.7486 2 84
ID Description Score Start End Superfamily
af_P0AAQ6_1_117_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8379 1 112 3.30.70.100
af_P0AAQ6_1_117_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7789 1 112 3.30.70.100
af_P9WLA3_114_212_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7387 2 88 3.30.70.100
af_Q55CR9_1_97_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7315 2 96 3.30.70.100
4dpoB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7297 2 94 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A1Q4BAH8-F1-model_v4 RNA signal recognition particle 0.8986 3 90
AF-A0A520Y529-F1-model_v4 DUF1428 domain-containing protein 0.8881 1 91
AF-A0A658NKC3-F1-model_v4 DUF1428 domain-containing protein 0.8821 9 91
AF-A0A1Q4BAH8-F1-model_v4 RNA signal recognition particle 0.8796 3 90
AF-A0A7W0H0N0-F1-model_v4 DUF1428 family protein 0.8747 2 112

Map