F435707

General Info

Members Datasets Scaffolds Average Seq Length
404 213 808 222

Family's Representative Sequence

Representative Sequence 3300032133|Ga0316583_10001125|Ga0316583_100011254
Length 228
Sequence VVEGYVTAMAGRHSGIGMTSQRTRWRLIQRLQEKGIRDLSVLKVISEVPRHIFVDEALATRAYEDTALPIGYGQFISQPYIIARMTELLFAGKPLKRVLEVGSGSGYQTAILAYLAKEVYSVERIEALYKQLRYRFQELSLRNIRLKHGDGWLGWPEYGPYDGILVAAAASDVPPTLVEQLAPSGRMVIPIGSADKQVLTLISRVGGGFESEVIEPVSFVPLLSEQAK

Samples

Sample ID Description Type Environment
1 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
101 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
102 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
103 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
116 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
117 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
118 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
119 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
120 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
121 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
122 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
123 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
124 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
125 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
129 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
130 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
133 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
134 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
135 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
136 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
140 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
141 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
142 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
149 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
165 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
177 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
178 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
179 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
180 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
181 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
182 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
183 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
184 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
185 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
186 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
187 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
188 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
189 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
190 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
194 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
195 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
196 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
197 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
198 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
202 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
203 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
210 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
211 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
212 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
213 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.89
Rhizosphere 88.86
Stem 0
Stem Tuber 0
Unclassified 4.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316583_10001125 3300032133 Bacteria 8737
2 rootL2_10157051 3300003322 Bacteria 5173
3 Ga0070677_10018785 3300005333 Bacteria 2495
4 Ga0068869_100050894 3300005334 Bacteria 3004
5 Ga0070680_100103285 3300005336 Bacteria 2368
6 Ga0070689_100265266 3300005340 Bacteria 1420
7 Ga0070691_10086822 3300005341 Bacteria 1538
8 Ga0070671_100001564 3300005355 Bacteria 17217
9 Ga0070671_100169001 3300005355 Bacteria 1849
10 Ga0070674_100000378 3300005356 Bacteria 22336
11 Ga0070673_100033447 3300005364 Bacteria 3883
12 Ga0070673_100314662 3300005364 Bacteria 1382
13 Ga0070659_100095570 3300005366 Bacteria 2387
14 Ga0070659_100163288 3300005366 Bacteria 1822
15 Ga0070659_100187795 3300005366 Bacteria 1698
16 Ga0070711_100114204 3300005439 Bacteria 1987
17 Ga0070705_100002647 3300005440 Bacteria 8956
18 Ga0070694_100012674 3300005444 Bacteria 5248
19 Ga0070694_100033537 3300005444 Bacteria 3379
20 Ga0070694_100381552 3300005444 Bacteria 1099
21 Ga0070708_100066114 3300005445 Bacteria 3244
22 Ga0070708_100068628 3300005445 Bacteria 3187
23 Ga0070708_100212163 3300005445 Bacteria 1814
24 Ga0070678_100010489 3300005456 Bacteria 5666
25 Ga0070662_100130314 3300005457 Unclassified 1938
26 Ga0068867_100001672 3300005459 Bacteria 15445
27 Ga0068867_100496703 3300005459 Bacteria 1048
28 Ga0070706_100320454 3300005467 Bacteria 1446
29 Ga0070706_100403087 3300005467 Bacteria 1273
30 Ga0070707_100001911 3300005468 Bacteria 19959
31 Ga0070707_100010581 3300005468 Bacteria 8589
32 Ga0070698_100001952 3300005471 Bacteria 22900
33 Ga0070698_100028391 3300005471 Bacteria 5812
34 Ga0070698_100067423 3300005471 Bacteria 3599
35 Ga0070698_100298896 3300005471 Bacteria 1540
36 Ga0070699_100000719 3300005518 Bacteria 30756
37 Ga0070699_100001113 3300005518 Bacteria 25024
38 Ga0070699_100024753 3300005518 Bacteria 5175
39 Ga0070699_100034852 3300005518 Bacteria 4349
40 Ga0070699_100076867 3300005518 Bacteria 2906
41 Ga0070699_100284404 3300005518 Bacteria 1482
42 Ga0070679_100528925 3300005530 Bacteria 1123
43 Ga0070679_100537043 3300005530 Bacteria 1113
44 Ga0070684_100306406 3300005535 Bacteria 1458
45 Ga0070684_100332227 3300005535 Bacteria 1397
46 Ga0070684_100532646 3300005535 Bacteria 1089
47 Ga0070697_100064790 3300005536 Bacteria 2985
48 Ga0070697_100183580 3300005536 Bacteria 1774
49 Ga0070697_100288496 3300005536 Unclassified 1409
50 Ga0070697_100440255 3300005536 Bacteria 1134
51 Ga0070672_100649233 3300005543 Bacteria 921
52 Ga0070695_100014675 3300005545 Bacteria 4723
53 Ga0070695_100054515 3300005545 Unclassified 2574
54 Ga0070696_100004729 3300005546 Bacteria 9097
55 Ga0070696_100305914 3300005546 Bacteria 1219
56 Ga0070693_100064398 3300005547 Bacteria 2140
57 Ga0070665_100633069 3300005548 Bacteria 1083
58 Ga0070704_100002333 3300005549 Bacteria 10638
59 Ga0070704_100007403 3300005549 Bacteria 6534
60 Ga0070704_100040997 3300005549 Bacteria 3192
61 Ga0070704_100263939 3300005549 Bacteria 1420
62 Ga0070664_100029972 3300005564 Bacteria 4537
63 Ga0070664_100107543 3300005564 Bacteria 2432
64 Ga0070664_100485657 3300005564 Bacteria 1137
65 Ga0068854_100008522 3300005578 Bacteria 6597
66 Ga0070702_100001397 3300005615 Bacteria 9867
67 Ga0068859_100065768 3300005617 Bacteria 3659
68 Ga0068864_100893742 3300005618 Bacteria 877
69 Ga0068866_10000401 3300005718 Bacteria 20182
70 Ga0068861_100304300 3300005719 Bacteria 1382
71 Ga0068863_100127197 3300005841 Bacteria 2431
72 Ga0068863_101062340 3300005841 Bacteria 814
73 Ga0068858_100014878 3300005842 Bacteria 7319
74 Ga0068858_100095347 3300005842 Unclassified 2772
75 Ga0068862_100293387 3300005844 Bacteria 1494
76 Ga0070712_100193257 3300006175 Bacteria 1594
77 Ga0075428_100083293 3300006844 Bacteria 3490
78 Ga0075428_100181896 3300006844 Bacteria 2275
79 Ga0075428_100485943 3300006844 Bacteria 1321
80 Ga0075431_100076978 3300006847 Unclassified 3443
81 Ga0075431_100184052 3300006847 Bacteria 2143
82 Ga0075431_100383066 3300006847 Bacteria 1410
83 Ga0075434_100053720 3300006871 Bacteria 4003
84 Ga0075434_100270597 3300006871 Bacteria 1718
85 Ga0075434_100474079 3300006871 Bacteria 1273
86 Ga0075429_100001523 3300006880 Bacteria 19059
87 Ga0075429_100098237 3300006880 Bacteria 2555
88 Ga0075429_100290987 3300006880 Bacteria 1430
89 Ga0075429_100297423 3300006880 Unclassified 1413
90 Ga0068865_100011523 3300006881 Bacteria 5540
91 Ga0068865_100512550 3300006881 Bacteria 1002
92 Ga0075436_100065089 3300006914 Bacteria 2520
93 Ga0097620_100065768 3300006931 Bacteria 3659
94 Ga0075435_100038447 3300007076 Bacteria 3815
95 Ga0075435_100112011 3300007076 Bacteria 2270
96 Ga0075435_100268350 3300007076 Bacteria 1455
97 Ga0105240_10134820 3300009093 Bacteria 2958
98 Ga0111539_10186760 3300009094 Bacteria 2420
99 Ga0111539_11272139 3300009094 Bacteria 854
100 Ga0114129_10013533 3300009147 Bacteria 11626
101 Ga0114129_10057578 3300009147 Bacteria 5438
102 Ga0114129_10102705 3300009147 Bacteria 3953
103 Ga0114129_10632894 3300009147 Unclassified 1382
104 Ga0114129_10815330 3300009147 Bacteria 1189
105 Ga0105243_10002610 3300009148 Bacteria 15026
106 Ga0105241_10020522 3300009174 Bacteria 4882
107 Ga0105242_10001397 3300009176 Bacteria 19028
108 Ga0105242_10058908 3300009176 Bacteria 3150
109 Ga0105248_10000658 3300009177 Bacteria 39283
110 Ga0105248_10045262 3300009177 Bacteria 4935
111 Ga0105249_10101100 3300009553 Bacteria 2711
112 Ga0105249_10129182 3300009553 Bacteria 2410
113 Ga0105249_10339062 3300009553 Bacteria 1519
114 Ga0105239_10004859 3300010375 Bacteria 15900
115 Ga0105246_10154770 3300011119 Unclassified 1740
116 Ga0157378_10002774 3300013297 Bacteria 15611
117 Ga0163162_10062639 3300013306 Bacteria 3760
118 Ga0163162_11456811 3300013306 Bacteria 779
119 Ga0157372_10540385 3300013307 Bacteria 1359
120 Ga0157375_10219054 3300013308 Bacteria 2061
121 Ga0157375_10561601 3300013308 Bacteria 1302
122 Ga0157375_11226298 3300013308 Bacteria 880
123 Ga0163163_10187926 3300014325 Bacteria 2114
124 Ga0157380_10017279 3300014326 Bacteria 5337
125 Ga0157379_10152078 3300014968 Bacteria 2087
126 Ga0207682_10017218 3300025893 Bacteria 2822
127 Ga0207682_10043649 3300025893 Bacteria 1836
128 Ga0207682_10109966 3300025893 Bacteria 1212
129 Ga0207645_10000145 3300025907 Bacteria 55543
130 Ga0207684_10255848 3300025910 Bacteria 1511
131 Ga0207654_10098925 3300025911 Bacteria 1793
132 Ga0207707_10141107 3300025912 Bacteria 2106
133 Ga0207660_10122119 3300025917 Bacteria 1974
134 Ga0207646_10148784 3300025922 Bacteria 2111
135 Ga0207646_10307898 3300025922 Bacteria 1431
136 Ga0207644_10023176 3300025931 Bacteria 4249
137 Ga0207644_10339318 3300025931 Bacteria 1218
138 Ga0207706_10000146 3300025933 Bacteria 76821
139 Ga0207706_10243928 3300025933 Unclassified 1570
140 Ga0207709_10001445 3300025935 Bacteria 16588
141 Ga0207670_10211919 3300025936 Bacteria 1478
142 Ga0207669_10001017 3300025937 Bacteria 11970
143 Ga0207704_10009204 3300025938 Bacteria 4755
144 Ga0207704_10052589 3300025938 Bacteria 2470
145 Ga0207691_10851098 3300025940 Bacteria 765
146 Ga0207711_10015225 3300025941 Bacteria 6385
147 Ga0207661_10287896 3300025944 Bacteria 1470
148 Ga0207679_10038945 3300025945 Bacteria 3392
149 Ga0207679_10380730 3300025945 Bacteria 1237
150 Ga0207667_10146164 3300025949 Bacteria 2434
151 Ga0207651_10046086 3300025960 Bacteria 2929
152 Ga0207651_10089645 3300025960 Bacteria 2246
153 Ga0207651_10203301 3300025960 Bacteria 1589
154 Ga0207712_10018227 3300025961 Bacteria 4569
155 Ga0207658_10138086 3300025986 Bacteria 1969
156 Ga0207703_10029457 3300026035 Bacteria 4332
157 Ga0207703_10365923 3300026035 Bacteria 1331
158 Ga0207641_10434363 3300026088 Bacteria 1266
159 Ga0207641_10600388 3300026088 Bacteria 1077
160 Ga0207648_10001390 3300026089 Bacteria 26643
161 Ga0207676_10154066 3300026095 Bacteria 1983
162 Ga0207674_10550244 3300026116 Bacteria 1115
163 Ga0207675_100067571 3300026118 Bacteria 3341
164 Ga0207683_10005089 3300026121 Bacteria 11283
165 Ga0268266_10213781 3300028379 Bacteria 1770
166 Ga0268265_10039944 3300028380 Bacteria 3462
167 Ga0268264_10248767 3300028381 Bacteria 1650
168 Ga0307408_100004762 3300031548 Bacteria 9148
169 Ga0307408_100017983 3300031548 Bacteria 4741
170 Ga0316575_10015806 3300031665 Bacteria 2848
171 Ga0316579_10015392 3300031691 Bacteria 3321
172 Ga0316579_10156522 3300031691 Bacteria 1100
173 Ga0316576_10021273 3300031727 Bacteria 4484
174 Ga0316576_10666731 3300031727 Bacteria 755
175 Ga0316578_10037488 3300031728 Bacteria 2793
176 Ga0316578_10124889 3300031728 Bacteria 1547
177 Ga0307405_10039351 3300031731 Bacteria 2857
178 Ga0307405_10152531 3300031731 Bacteria 1626
179 Ga0307405_10538147 3300031731 Bacteria 943
180 Ga0307413_10002235 3300031824 Bacteria 7805
181 Ga0307413_10002805 3300031824 Bacteria 7180
182 Ga0307413_10003985 3300031824 Bacteria 6340
183 Ga0307413_10013524 3300031824 Bacteria 4107
184 Ga0307413_10070228 3300031824 Bacteria 2201
185 Ga0307413_10166659 3300031824 Bacteria 1555
186 Ga0307413_10195079 3300031824 Bacteria 1457
187 Ga0307413_10910101 3300031824 Bacteria 748
188 Ga0307410_10002605 3300031852 Bacteria 8771
189 Ga0307410_10008516 3300031852 Bacteria 5692
190 Ga0307410_10009816 3300031852 Bacteria 5391
191 Ga0307410_10078844 3300031852 Bacteria 2306
192 Ga0307410_10106158 3300031852 Bacteria 2023
193 Ga0307410_10111831 3300031852 Bacteria 1977
194 Ga0307410_10146112 3300031852 Bacteria 1755
195 Ga0307406_10021817 3300031901 Bacteria 3793
196 Ga0307406_10039984 3300031901 Bacteria 2913
197 Ga0307406_10438864 3300031901 Bacteria 1044
198 Ga0307407_10006601 3300031903 Bacteria 5178
199 Ga0307407_10008523 3300031903 Bacteria 4713
200 Ga0307407_10018926 3300031903 Bacteria 3496
201 Ga0307407_10097883 3300031903 Bacteria 1814
202 Ga0307407_10100823 3300031903 Bacteria 1791
203 Ga0307407_10143541 3300031903 Bacteria 1543
204 Ga0307407_10166875 3300031903 Bacteria 1446
205 Ga0307407_10242978 3300031903 Bacteria 1229
206 Ga0307412_10198934 3300031911 Bacteria 1520
207 Ga0307412_10272883 3300031911 Bacteria 1324
208 Ga0307409_100000308 3300031995 Bacteria 19988
209 Ga0307409_100028165 3300031995 Bacteria 3997
210 Ga0307409_100039948 3300031995 Bacteria 3487
211 Ga0307409_100041252 3300031995 Bacteria 3445
212 Ga0307409_100043722 3300031995 Bacteria 3367
213 Ga0307409_100081700 3300031995 Bacteria 2613
214 Ga0307409_100211802 3300031995 Bacteria 1742
215 Ga0307409_100689661 3300031995 Bacteria 1019
216 Ga0307409_100715156 3300031995 Bacteria 1002
217 Ga0307416_100001186 3300032002 Bacteria 13997
218 Ga0307416_100002892 3300032002 Bacteria 10004
219 Ga0307416_100005003 3300032002 Bacteria 8081
220 Ga0307416_100031523 3300032002 Bacteria 3992
221 Ga0307416_100046226 3300032002 Bacteria 3434
222 Ga0307416_100082117 3300032002 Bacteria 2728
223 Ga0307416_100088218 3300032002 Bacteria 2651
224 Ga0307416_100345759 3300032002 Bacteria 1502
225 Ga0307414_10020050 3300032004 Bacteria 4157
226 Ga0307414_10020144 3300032004 Bacteria 4151
227 Ga0307414_10029042 3300032004 Bacteria 3595
228 Ga0307414_10038035 3300032004 Bacteria 3227
229 Ga0307414_10069928 3300032004 Bacteria 2526
230 Ga0307414_10080673 3300032004 Bacteria 2380
231 Ga0307414_10135373 3300032004 Bacteria 1920
232 Ga0307411_10032167 3300032005 Bacteria 3238
233 Ga0307411_10040170 3300032005 Bacteria 2966
234 Ga0307411_10093078 3300032005 Bacteria 2109
235 Ga0307411_10211836 3300032005 Bacteria 1497
236 Ga0307411_10290600 3300032005 Bacteria 1306
237 Ga0307415_100000203 3300032126 Bacteria 26255
238 Ga0307415_100001513 3300032126 Bacteria 11158
239 Ga0307415_100068448 3300032126 Bacteria 2485
240 Ga0307415_100592337 3300032126 Bacteria 985
241 Ga0316583_10013165 3300032133 Bacteria 2985
242 Ga0316583_10069154 3300032133 Bacteria 1235
243 Ga0316585_10068049 3300032137 Bacteria 1154
244 Ga0316580_10026414 3300032139 Bacteria 1795
245 Ga0373948_0017140 3300034817 Bacteria 1347
246 Ga0373940_0014634 3300035088 Bacteria 1917
247 Ga0373940_0018678 3300035088 Bacteria 1743
248 Ga0373940_0071494 3300035088 Bacteria 1011
249 Ga0373944_0200275 3300035089 Unclassified 723
250 Ga0373960_0111248 3300035121 Bacteria 899
251 Ga0373946_0244589 3300035171 Unclassified 873
252 Ga0316574_0018456 3300035398 Bacteria 4100
253 Ga0316574_0088019 3300035398 Bacteria 1977
254 Ga0316574_0136168 3300035398 Bacteria 1581
255 Ga0373927_0010553 3300035695 Bacteria 6156
256 Ga0316582_0050447 3300036647 Bacteria 2636
257 Ga0316582_0106443 3300036647 Bacteria 1862
258 Ga0316584_0334177 3300036712 Bacteria 1090
259 Ga0373925_0057986 3300037068 Bacteria 2902
260 Ga0395905_0171193 3300037471 Bacteria 2040
261 Ga0242420_000745 3300038996 Bacteria 3919
262 Ga0451577_0031234 3300042876 Bacteria 4808
263 Ga0451577_0096287 3300042876 Bacteria 2642
264 Ga0451577_0874154 3300042876 Bacteria 810
265 Ga0453684_0357538 3300044712 Bacteria 1645
266 Ga0451576_0185331 3300045051 Bacteria 2173
267 Ga0495603_0065351 3300046455 Bacteria 2144
268 Ga0495580_0020505 3300046472 Bacteria 4890
269 Ga0495582_0212894 3300046473 Bacteria 1105
270 Ga0495594_0015226 3300046499 Bacteria 4040
271 Ga0495594_0022905 3300046499 Bacteria 3344
272 Ga0495594_0023945 3300046499 Bacteria 3275
273 Ga0495618_0013147 3300046514 Bacteria 5036
274 Ga0495628_0188240 3300046516 Bacteria 1559
275 Ga0495630_0022080 3300046517 Bacteria 4702
276 Ga0495630_0506639 3300046517 Unclassified 925
277 Ga0495666_0002485 3300046526 Bacteria 9162
278 Ga0495665_0031360 3300046531 Bacteria 2845
279 Ga0495640_0021377 3300046533 Bacteria 4750
280 Ga0495586_0018066 3300046535 Bacteria 3750
281 Ga0495586_0176679 3300046535 Bacteria 1207
282 Ga0495634_0032770 3300046642 Bacteria 3571
283 Ga0495635_0134874 3300046663 Bacteria 1683
284 Ga0495647_0010004 3300046681 Bacteria 3223
285 Ga0495658_0044915 3300046683 Bacteria 2477
286 Ga0495658_0072743 3300046683 Bacteria 2000
287 Ga0495613_0043177 3300046689 Bacteria 3335
288 Ga0495613_0350259 3300046689 Unclassified 1014
289 Ga0495581_0155551 3300047315 Bacteria 1336
290 Ga0495676_0359014 3300047321 Bacteria 973
291 Ga0495680_0021515 3300047322 Bacteria 5397
292 Ga0496100_0199370 3300048903 Bacteria 1458
293 Ga0496102_0012149 3300048905 Bacteria 7443
294 Ga0496102_0028989 3300048905 Bacteria 4948
295 Ga0496102_0064336 3300048905 Bacteria 3360
296 Ga0496103_0146768 3300048906 Bacteria 1510
297 Ga0496104_0038899 3300048907 Bacteria 4452
298 Ga0496104_0177167 3300048907 Bacteria 2042
299 Ga0496104_0217891 3300048907 Bacteria 1821
300 Ga0496106_0144773 3300048909 Bacteria 1871
301 Ga0496106_0145980 3300048909 Bacteria 1864
302 Ga0496106_0160469 3300048909 Bacteria 1778
303 Ga0496106_0214720 3300048909 Bacteria 1533
304 Ga0496106_0261022 3300048909 Bacteria 1386
305 Ga0496107_0023061 3300048910 Bacteria 4400
306 Ga0496107_0423958 3300048910 Bacteria 989
307 Ga0496108_0001782 3300048911 Bacteria 17164
308 Ga0496108_0002171 3300048911 Bacteria 15736
309 Ga0496108_0014418 3300048911 Bacteria 6454
310 Ga0496108_0175059 3300048911 Bacteria 1857
311 Ga0496108_0233929 3300048911 Bacteria 1598
312 Ga0496109_0001037 3300048912 Bacteria 22996
313 Ga0496109_0043387 3300048912 Bacteria 4076
314 Ga0496109_0092037 3300048912 Unclassified 2804
315 Ga0496109_0182764 3300048912 Bacteria 1970
316 Ga0496109_0528398 3300048912 Bacteria 1113
317 Ga0496109_0898070 3300048912 Unclassified 824
318 Ga0496109_1144009 3300048912 Bacteria 715
319 Ga0496110_0003421 3300048913 Bacteria 12142
320 Ga0496110_0018453 3300048913 Bacteria 5851
321 Ga0496110_0019329 3300048913 Bacteria 5730
322 Ga0496110_0030640 3300048913 Bacteria 4638
323 Ga0496110_0465416 3300048913 Bacteria 1152
324 Ga0496111_0005733 3300048914 Bacteria 8009
325 Ga0496111_0127674 3300048914 Unclassified 1880
326 Ga0496111_0170690 3300048914 Bacteria 1616
327 Ga0496111_0224978 3300048914 Bacteria 1394
328 Ga0496112_0000129 3300048915 Bacteria 47173
329 Ga0496112_0023489 3300048915 Bacteria 5892
330 Ga0496112_0024531 3300048915 Bacteria 5776
331 Ga0496112_0338558 3300048915 Bacteria 1448
332 Ga0496113_0000062 3300048916 Bacteria 46801
333 Ga0496113_0010759 3300048916 Bacteria 6066
334 Ga0496113_0103595 3300048916 Bacteria 2207
335 Ga0496114_0351332 3300048917 Bacteria 1304
336 Ga0501298_001135 3300049521 Bacteria 3847
337 Ga0501033_0429518 3300049570 Bacteria 919
338 Ga0501034_0415973 3300049571 Bacteria 1266
339 Ga0501036_0118092 3300049572 Bacteria 2239
340 Ga0501038_0026870 3300049574 Bacteria 5125
341 Ga0501039_0050777 3300049575 Bacteria 3209
342 Ga0501040_0085523 3300049576 Bacteria 2189
343 Ga0501041_0024554 3300049577 Bacteria 3619
344 Ga0501042_0150954 3300049578 Bacteria 1675
345 Ga0501043_0314326 3300049579 Bacteria 1195
346 Ga0501046_0181873 3300049580 Bacteria 1571
347 Ga0501048_0043066 3300049582 Bacteria 3231
348 Ga0501067_0005771 3300049583 Bacteria 6869
349 Ga0501067_0100025 3300049583 Bacteria 1610
350 Ga0501068_0103745 3300049584 Bacteria 1764
351 Ga0501071_0077382 3300049587 Bacteria 2430
352 Ga0501072_0145704 3300049588 Bacteria 1888
353 Ga0501072_0176416 3300049588 Bacteria 1705
354 Ga0501072_0439845 3300049588 Unclassified 1033
355 Ga0501075_0132847 3300049591 Bacteria 1896
356 Ga0501076_0006362 3300049592 Bacteria 8563
357 Ga0501076_0038649 3300049592 Bacteria 3747
358 Ga0501077_0002060 3300049593 Bacteria 12127
359 Ga0501199_015296 3300049650 Bacteria 858
360 Ga0501209_011657 3300049656 Bacteria 1849
361 Ga0501228_010796 3300049666 Bacteria 914
362 Ga0501235_002157 3300049669 Bacteria 4224
363 Ga0501243_036798 3300049675 Bacteria 850
364 Ga0501247_003274 3300049677 Bacteria 1728
365 Ga0501257_007542 3300049686 Bacteria 2430
366 Ga0501221_011796 3300049704 Bacteria 1580
367 Ga0501079_0164820 3300049741 Bacteria 1728
368 Ga0501080_0880391 3300049742 Bacteria 781
369 Ga0501081_0022300 3300049743 Bacteria 4235
370 Ga0501081_0151627 3300049743 Bacteria 1665
371 Ga0501081_0173668 3300049743 Bacteria 1557
372 Ga0501083_0209425 3300049744 Bacteria 1271
373 Ga0501263_001259 3300049760 Bacteria 2332
374 Ga0501268_000906 3300049765 Bacteria 3468
375 Ga0501268_040932 3300049765 Bacteria 872
376 Ga0501270_026549 3300049767 Bacteria 925
377 Ga0501272_000650 3300049769 Bacteria 3108
378 Ga0501045_0017965 3300049824 Bacteria 5023
379 nmdc:mga05p37_13173_c1 3300050507 Bacteria 9899
380 nmdc:mga05p37_46497_c1 3300050507 Bacteria 5336
381 nmdc:mga05p37_63536_c1 3300050507 Bacteria 4543
382 nmdc:mga05p37_706172_c1 3300050507 Bacteria 1119
383 nmdc:mga09592_1219_c1 3300050508 Bacteria 20601
384 nmdc:mga09592_34639_c1 3300050508 Unclassified 4221
385 nmdc:mga0qj67_66558_c1 3300050509 Bacteria 2869
386 nmdc:mga06r32_3480_c1 3300050510 Bacteria 14060
387 nmdc:mga06r32_58360_c1 3300050510 Unclassified 3709
388 nmdc:mga0n895_115794_c1 3300050512 Unclassified 2699
389 nmdc:mga0n895_283453_c1 3300050512 Bacteria 1680
390 nmdc:mga0n895_468904_c1 3300050512 Bacteria 1270
391 nmdc:mga0rr50_197583_c1 3300050513 Bacteria 1651
392 nmdc:mga0rr50_41196_c1 3300050513 Bacteria 3363
393 nmdc:mga08x19_61847_c1 3300050514 Bacteria 2427
394 nmdc:mga0a205_66587_c1 3300050515 Bacteria 3480
395 Ga0501084_0032468 3300054114 Bacteria 4367
396 Ga0590071_001519 3300059421 Bacteria 6088
397 Ga0590071_003383 3300059421 Bacteria 3924
398 Ga0590071_017430 3300059421 Bacteria 1687
399 Ga0590075_023589 3300059424 Bacteria 1542
400 Ga0590077_004266 3300059426 Bacteria 2944
401 Ga0501082_0016812 3300060353 Bacteria 6300
402 Ga0501082_0089354 3300060353 Bacteria 2660
403 Ga0501082_0228713 3300060353 Bacteria 1619
404 Ga0530510_0181720 3300061734 Bacteria 1560
405 Ga0316583_10001125
406 rootL2_10157051
407 Ga0070677_10018785
408 Ga0068869_100050894
409 Ga0070680_100103285
410 Ga0070689_100265266
411 Ga0070691_10086822
412 Ga0070671_100001564
413 Ga0070671_100169001
414 Ga0070674_100000378
415 Ga0070673_100033447
416 Ga0070673_100314662
417 Ga0070659_100095570
418 Ga0070659_100163288
419 Ga0070659_100187795
420 Ga0070711_100114204
421 Ga0070705_100002647
422 Ga0070694_100012674
423 Ga0070694_100033537
424 Ga0070694_100381552
425 Ga0070708_100066114
426 Ga0070708_100068628
427 Ga0070708_100212163
428 Ga0070678_100010489
429 Ga0070662_100130314
430 Ga0068867_100001672
431 Ga0068867_100496703
432 Ga0070706_100320454
433 Ga0070706_100403087
434 Ga0070707_100001911
435 Ga0070707_100010581
436 Ga0070698_100001952
437 Ga0070698_100028391
438 Ga0070698_100067423
439 Ga0070698_100298896
440 Ga0070699_100000719
441 Ga0070699_100001113
442 Ga0070699_100024753
443 Ga0070699_100034852
444 Ga0070699_100076867
445 Ga0070699_100284404
446 Ga0070679_100528925
447 Ga0070679_100537043
448 Ga0070684_100306406
449 Ga0070684_100332227
450 Ga0070684_100532646
451 Ga0070697_100064790
452 Ga0070697_100183580
453 Ga0070697_100288496
454 Ga0070697_100440255
455 Ga0070672_100649233
456 Ga0070695_100014675
457 Ga0070695_100054515
458 Ga0070696_100004729
459 Ga0070696_100305914
460 Ga0070693_100064398
461 Ga0070665_100633069
462 Ga0070704_100002333
463 Ga0070704_100007403
464 Ga0070704_100040997
465 Ga0070704_100263939
466 Ga0070664_100029972
467 Ga0070664_100107543
468 Ga0070664_100485657
469 Ga0068854_100008522
470 Ga0070702_100001397
471 Ga0068859_100065768
472 Ga0068864_100893742
473 Ga0068866_10000401
474 Ga0068861_100304300
475 Ga0068863_100127197
476 Ga0068863_101062340
477 Ga0068858_100014878
478 Ga0068858_100095347
479 Ga0068862_100293387
480 Ga0070712_100193257
481 Ga0075428_100083293
482 Ga0075428_100181896
483 Ga0075428_100485943
484 Ga0075431_100076978
485 Ga0075431_100184052
486 Ga0075431_100383066
487 Ga0075434_100053720
488 Ga0075434_100270597
489 Ga0075434_100474079
490 Ga0075429_100001523
491 Ga0075429_100098237
492 Ga0075429_100290987
493 Ga0075429_100297423
494 Ga0068865_100011523
495 Ga0068865_100512550
496 Ga0075436_100065089
497 Ga0097620_100065768
498 Ga0075435_100038447
499 Ga0075435_100112011
500 Ga0075435_100268350
501 Ga0105240_10134820
502 Ga0111539_10186760
503 Ga0111539_11272139
504 Ga0114129_10013533
505 Ga0114129_10057578
506 Ga0114129_10102705
507 Ga0114129_10632894
508 Ga0114129_10815330
509 Ga0105243_10002610
510 Ga0105241_10020522
511 Ga0105242_10001397
512 Ga0105242_10058908
513 Ga0105248_10000658
514 Ga0105248_10045262
515 Ga0105249_10101100
516 Ga0105249_10129182
517 Ga0105249_10339062
518 Ga0105239_10004859
519 Ga0105246_10154770
520 Ga0157378_10002774
521 Ga0163162_10062639
522 Ga0163162_11456811
523 Ga0157372_10540385
524 Ga0157375_10219054
525 Ga0157375_10561601
526 Ga0157375_11226298
527 Ga0163163_10187926
528 Ga0157380_10017279
529 Ga0157379_10152078
530 Ga0207682_10017218
531 Ga0207682_10043649
532 Ga0207682_10109966
533 Ga0207645_10000145
534 Ga0207684_10255848
535 Ga0207654_10098925
536 Ga0207707_10141107
537 Ga0207660_10122119
538 Ga0207646_10148784
539 Ga0207646_10307898
540 Ga0207644_10023176
541 Ga0207644_10339318
542 Ga0207706_10000146
543 Ga0207706_10243928
544 Ga0207709_10001445
545 Ga0207670_10211919
546 Ga0207669_10001017
547 Ga0207704_10009204
548 Ga0207704_10052589
549 Ga0207691_10851098
550 Ga0207711_10015225
551 Ga0207661_10287896
552 Ga0207679_10038945
553 Ga0207679_10380730
554 Ga0207667_10146164
555 Ga0207651_10046086
556 Ga0207651_10089645
557 Ga0207651_10203301
558 Ga0207712_10018227
559 Ga0207658_10138086
560 Ga0207703_10029457
561 Ga0207703_10365923
562 Ga0207641_10434363
563 Ga0207641_10600388
564 Ga0207648_10001390
565 Ga0207676_10154066
566 Ga0207674_10550244
567 Ga0207675_100067571
568 Ga0207683_10005089
569 Ga0268266_10213781
570 Ga0268265_10039944
571 Ga0268264_10248767
572 Ga0307408_100004762
573 Ga0307408_100017983
574 Ga0316575_10015806
575 Ga0316579_10015392
576 Ga0316579_10156522
577 Ga0316576_10021273
578 Ga0316576_10666731
579 Ga0316578_10037488
580 Ga0316578_10124889
581 Ga0307405_10039351
582 Ga0307405_10152531
583 Ga0307405_10538147
584 Ga0307413_10002235
585 Ga0307413_10002805
586 Ga0307413_10003985
587 Ga0307413_10013524
588 Ga0307413_10070228
589 Ga0307413_10166659
590 Ga0307413_10195079
591 Ga0307413_10910101
592 Ga0307410_10002605
593 Ga0307410_10008516
594 Ga0307410_10009816
595 Ga0307410_10078844
596 Ga0307410_10106158
597 Ga0307410_10111831
598 Ga0307410_10146112
599 Ga0307406_10021817
600 Ga0307406_10039984
601 Ga0307406_10438864
602 Ga0307407_10006601
603 Ga0307407_10008523
604 Ga0307407_10018926
605 Ga0307407_10097883
606 Ga0307407_10100823
607 Ga0307407_10143541
608 Ga0307407_10166875
609 Ga0307407_10242978
610 Ga0307412_10198934
611 Ga0307412_10272883
612 Ga0307409_100000308
613 Ga0307409_100028165
614 Ga0307409_100039948
615 Ga0307409_100041252
616 Ga0307409_100043722
617 Ga0307409_100081700
618 Ga0307409_100211802
619 Ga0307409_100689661
620 Ga0307409_100715156
621 Ga0307416_100001186
622 Ga0307416_100002892
623 Ga0307416_100005003
624 Ga0307416_100031523
625 Ga0307416_100046226
626 Ga0307416_100082117
627 Ga0307416_100088218
628 Ga0307416_100345759
629 Ga0307414_10020050
630 Ga0307414_10020144
631 Ga0307414_10029042
632 Ga0307414_10038035
633 Ga0307414_10069928
634 Ga0307414_10080673
635 Ga0307414_10135373
636 Ga0307411_10032167
637 Ga0307411_10040170
638 Ga0307411_10093078
639 Ga0307411_10211836
640 Ga0307411_10290600
641 Ga0307415_100000203
642 Ga0307415_100001513
643 Ga0307415_100068448
644 Ga0307415_100592337
645 Ga0316583_10013165
646 Ga0316583_10069154
647 Ga0316585_10068049
648 Ga0316580_10026414
649 Ga0373948_0017140
650 Ga0373940_0014634
651 Ga0373940_0018678
652 Ga0373940_0071494
653 Ga0373944_0200275
654 Ga0373960_0111248
655 Ga0373946_0244589
656 Ga0316574_0018456
657 Ga0316574_0088019
658 Ga0316574_0136168
659 Ga0373927_0010553
660 Ga0316582_0050447
661 Ga0316582_0106443
662 Ga0316584_0334177
663 Ga0373925_0057986
664 Ga0395905_0171193
665 Ga0242420_000745
666 Ga0451577_0031234
667 Ga0451577_0096287
668 Ga0451577_0874154
669 Ga0453684_0357538
670 Ga0451576_0185331
671 Ga0495603_0065351
672 Ga0495580_0020505
673 Ga0495582_0212894
674 Ga0495594_0015226
675 Ga0495594_0022905
676 Ga0495594_0023945
677 Ga0495618_0013147
678 Ga0495628_0188240
679 Ga0495630_0022080
680 Ga0495630_0506639
681 Ga0495666_0002485
682 Ga0495665_0031360
683 Ga0495640_0021377
684 Ga0495586_0018066
685 Ga0495586_0176679
686 Ga0495634_0032770
687 Ga0495635_0134874
688 Ga0495647_0010004
689 Ga0495658_0044915
690 Ga0495658_0072743
691 Ga0495613_0043177
692 Ga0495613_0350259
693 Ga0495581_0155551
694 Ga0495676_0359014
695 Ga0495680_0021515
696 Ga0496100_0199370
697 Ga0496102_0012149
698 Ga0496102_0028989
699 Ga0496102_0064336
700 Ga0496103_0146768
701 Ga0496104_0038899
702 Ga0496104_0177167
703 Ga0496104_0217891
704 Ga0496106_0144773
705 Ga0496106_0145980
706 Ga0496106_0160469
707 Ga0496106_0214720
708 Ga0496106_0261022
709 Ga0496107_0023061
710 Ga0496107_0423958
711 Ga0496108_0001782
712 Ga0496108_0002171
713 Ga0496108_0014418
714 Ga0496108_0175059
715 Ga0496108_0233929
716 Ga0496109_0001037
717 Ga0496109_0043387
718 Ga0496109_0092037
719 Ga0496109_0182764
720 Ga0496109_0528398
721 Ga0496109_0898070
722 Ga0496109_1144009
723 Ga0496110_0003421
724 Ga0496110_0018453
725 Ga0496110_0019329
726 Ga0496110_0030640
727 Ga0496110_0465416
728 Ga0496111_0005733
729 Ga0496111_0127674
730 Ga0496111_0170690
731 Ga0496111_0224978
732 Ga0496112_0000129
733 Ga0496112_0023489
734 Ga0496112_0024531
735 Ga0496112_0338558
736 Ga0496113_0000062
737 Ga0496113_0010759
738 Ga0496113_0103595
739 Ga0496114_0351332
740 Ga0501298_001135
741 Ga0501033_0429518
742 Ga0501034_0415973
743 Ga0501036_0118092
744 Ga0501038_0026870
745 Ga0501039_0050777
746 Ga0501040_0085523
747 Ga0501041_0024554
748 Ga0501042_0150954
749 Ga0501043_0314326
750 Ga0501046_0181873
751 Ga0501048_0043066
752 Ga0501067_0005771
753 Ga0501067_0100025
754 Ga0501068_0103745
755 Ga0501071_0077382
756 Ga0501072_0145704
757 Ga0501072_0176416
758 Ga0501072_0439845
759 Ga0501075_0132847
760 Ga0501076_0006362
761 Ga0501076_0038649
762 Ga0501077_0002060
763 Ga0501199_015296
764 Ga0501209_011657
765 Ga0501228_010796
766 Ga0501235_002157
767 Ga0501243_036798
768 Ga0501247_003274
769 Ga0501257_007542
770 Ga0501221_011796
771 Ga0501079_0164820
772 Ga0501080_0880391
773 Ga0501081_0022300
774 Ga0501081_0151627
775 Ga0501081_0173668
776 Ga0501083_0209425
777 Ga0501263_001259
778 Ga0501268_000906
779 Ga0501268_040932
780 Ga0501270_026549
781 Ga0501272_000650
782 Ga0501045_0017965
783 nmdc:mga05p37_13173_c1
784 nmdc:mga05p37_46497_c1
785 nmdc:mga05p37_63536_c1
786 nmdc:mga05p37_706172_c1
787 nmdc:mga09592_1219_c1
788 nmdc:mga09592_34639_c1
789 nmdc:mga0qj67_66558_c1
790 nmdc:mga06r32_3480_c1
791 nmdc:mga06r32_58360_c1
792 nmdc:mga0n895_115794_c1
793 nmdc:mga0n895_283453_c1
794 nmdc:mga0n895_468904_c1
795 nmdc:mga0rr50_197583_c1
796 nmdc:mga0rr50_41196_c1
797 nmdc:mga08x19_61847_c1
798 nmdc:mga0a205_66587_c1
799 Ga0501084_0032468
800 Ga0590071_001519
801 Ga0590071_003383
802 Ga0590071_017430
803 Ga0590075_023589
804 Ga0590077_004266
805 Ga0501082_0016812
806 Ga0501082_0089354
807 Ga0501082_0228713
808 Ga0530510_0181720

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

22

227

0.98

PF00398

RrnaAD

Ribosomal RNA adenine dimethylase

73

155

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lbf-assembly3.cif.gz_C crystal structure of protein l-isoaspartyl methyltransferase from escherichia coli 0.9622 15 211
4l7v-assembly1.cif.gz_A crystal structure of protein l-isoaspartyl-o-methyltransferase of vibrio cholerae 0.9572 16 211
4o29-assembly1.cif.gz_A protein-l-isoaspartate o-methyltransferase from pyrobaculum aerophilum in complex with s-adenosyl-l-homocysteine 0.9542 15 211
1jg3-assembly1.cif.gz_A crystal structure of l-isoaspartyl (d-aspartyl) o-methyltransferase with adenosine & vyp(isp)ha substrate 0.9536 13 205
3lbf-assembly4.cif.gz_D crystal structure of protein l-isoaspartyl methyltransferase from escherichia coli 0.947 15 211
ID Description Score Start End Superfamily
4l7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9572 16 211 3.40.50.150
af_K7LTE4_237_888_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9549 71 140 3.40.50.150
4o29A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9542 15 211 3.40.50.150
1jg3A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9536 13 205 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9513 82 140 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2T2VGC3-F1-model_v4 Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77) (L-isoaspartyl protein carboxyl methyltransferase) (Protein L-isoaspartyl methyltransferase) (Protein-beta-aspartate methyltransferase) 0.988 24 120 GO:0004719
GO:0005737
GO:0032259
GO:0036211
AF-A0A7V9C9T6-F1-model_v4 Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77) (L-isoaspartyl protein carboxyl methyltransferase) (Protein L-isoaspartyl methyltransferase) (Protein-beta-aspartate methyltransferase) 0.984 20 121 GO:0004719
GO:0005737
GO:0032259
GO:0036211
AF-A0A059WPI4-F1-model_v4 Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77) (L-isoaspartyl protein carboxyl methyltransferase) (Protein L-isoaspartyl methyltransferase) (Protein-beta-aspartate methyltransferase) 0.9811 12 145 GO:0004719
GO:0005737
GO:0032259
GO:0036211
AF-Q9EV73-F1-model_v4 Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77) (L-isoaspartyl protein carboxyl methyltransferase) (Protein L-isoaspartyl methyltransferase) (Protein-beta-aspartate methyltransferase) 0.9803 13 118 GO:0004719
GO:0005737
GO:0032259
GO:0036211
AF-A0A1V4RP14-F1-model_v4 Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77) (L-isoaspartyl protein carboxyl methyltransferase) (Protein L-isoaspartyl methyltransferase) (Protein-beta-aspartate methyltransferase) 0.979 12 116 GO:0004719
GO:0005737
GO:0032259
GO:0036211

Map