F435668

General Info

Members Datasets Scaffolds Average Seq Length
404 231 808 93

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10445992|Ga0163163_104459922
Length 110
Sequence MGQVWGRNDPVQELKMERMGAIIEAIQDKLTATFHPTRLEVQDDSARHRGHAGASPGGESHFNVLIESEAFRGAPRVARQRMVYKALAVELAGPVHALSVKAFAPGESES

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
68 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
110 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
113 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
121 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
122 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
123 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
124 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
130 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
131 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
134 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
135 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
136 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
137 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
138 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
139 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
140 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
141 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
142 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
143 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
144 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
145 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
146 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
147 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
148 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
149 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
150 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
151 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
152 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
153 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
154 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
156 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
157 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
158 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
159 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
160 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
161 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
162 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
163 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
166 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
182 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
183 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
184 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
185 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
186 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
187 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
195 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
199 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
200 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
201 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
202 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
203 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
204 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
205 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
206 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
207 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
208 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
209 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
210 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
211 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
212 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
213 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
214 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
215 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
216 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
217 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
218 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
219 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
220 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
221 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
222 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
223 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
224 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
225 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
226 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
227 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
228 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
229 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
230 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
231 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.38
Nodule 0
Rhizoplane 5.45
Rhizosphere 77.23
Stem 0
Stem Tuber 0
Unclassified 0.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_10445992 3300014325 Bacteria 1354
2 JGI24751J29686_10099793 3300002459 Bacteria 606
3 Ga0070658_10473660 3300005327 Bacteria 1080
4 Ga0070658_10605263 3300005327 Bacteria 950
5 Ga0070658_10759659 3300005327 Bacteria 842
6 Ga0070676_10894178 3300005328 Bacteria 661
7 Ga0070683_101759092 3300005329 Bacteria 596
8 Ga0070690_101285100 3300005330 Bacteria 586
9 Ga0070670_100177622 3300005331 Bacteria 1848
10 Ga0070670_101142654 3300005331 Bacteria 711
11 Ga0070666_10183360 3300005335 Bacteria 1469
12 Ga0068868_100274960 3300005338 Bacteria 1424
13 Ga0070660_100144697 3300005339 Bacteria 1908
14 Ga0070660_100631411 3300005339 Bacteria 896
15 Ga0070691_10052153 3300005341 Bacteria 1956
16 Ga0070661_100886678 3300005344 Bacteria 736
17 Ga0070668_100003571 3300005347 Bacteria 11470
18 Ga0070668_100006664 3300005347 Bacteria 8557
19 Ga0070668_100038043 3300005347 Bacteria 3676
20 Ga0070668_100053405 3300005347 Bacteria 3116
21 Ga0070668_100519739 3300005347 Bacteria 1033
22 Ga0070669_100084726 3300005353 Bacteria 2366
23 Ga0070671_100174745 3300005355 Bacteria 1817
24 Ga0070671_100450997 3300005355 Bacteria 1104
25 Ga0070673_100658840 3300005364 Bacteria 959
26 Ga0070659_100002104 3300005366 Bacteria 14194
27 Ga0070659_100048376 3300005366 Bacteria 3340
28 Ga0070667_100005948 3300005367 Bacteria 10151
29 Ga0070667_100022761 3300005367 Bacteria 5196
30 Ga0070667_100022887 3300005367 Bacteria 5181
31 Ga0070667_100183751 3300005367 Bacteria 1850
32 Ga0070667_101145296 3300005367 Bacteria 727
33 Ga0070663_101822091 3300005455 Bacteria 546
34 Ga0070678_100145159 3300005456 Bacteria 1904
35 Ga0070662_100292233 3300005457 Bacteria 1321
36 Ga0070681_10003748 3300005458 Bacteria 14267
37 Ga0070681_10026625 3300005458 Bacteria 5812
38 Ga0068853_100220566 3300005539 Bacteria 1732
39 Ga0068853_100580737 3300005539 Bacteria 1063
40 Ga0070686_101334786 3300005544 Bacteria 600
41 Ga0070696_101031579 3300005546 Bacteria 688
42 Ga0070665_100000762 3300005548 Bacteria 42638
43 Ga0070665_100000831 3300005548 Bacteria 40349
44 Ga0070665_100099472 3300005548 Bacteria 2912
45 Ga0068855_100004289 3300005563 Bacteria 17423
46 Ga0068855_100058400 3300005563 Bacteria 4518
47 Ga0070664_100663224 3300005564 Bacteria 970
48 Ga0070664_101304479 3300005564 Bacteria 686
49 Ga0070664_101611750 3300005564 Bacteria 615
50 Ga0068857_100234057 3300005577 Bacteria 1681
51 Ga0068854_100969905 3300005578 Bacteria 751
52 Ga0068856_101930825 3300005614 Bacteria 601
53 Ga0068852_100124994 3300005616 Bacteria 2360
54 Ga0068852_101613887 3300005616 Bacteria 671
55 Ga0068859_100000231 3300005617 Bacteria 55036
56 Ga0068859_100007203 3300005617 Bacteria 11289
57 Ga0068859_100173234 3300005617 Bacteria 2240
58 Ga0068859_101024816 3300005617 Bacteria 907
59 Ga0068859_101919022 3300005617 Bacteria 654
60 Ga0068859_102752019 3300005617 Bacteria 540
61 Ga0068859_102901641 3300005617 Bacteria 525
62 Ga0068864_100000060 3300005618 Bacteria 124506
63 Ga0068864_100023724 3300005618 Bacteria 5154
64 Ga0068864_100107358 3300005618 Bacteria 2483
65 Ga0068864_100207038 3300005618 Bacteria 1805
66 Ga0068864_100218507 3300005618 Bacteria 1758
67 Ga0068861_100340173 3300005719 Bacteria 1313
68 Ga0068861_100574193 3300005719 Bacteria 1031
69 Ga0068861_100642695 3300005719 Bacteria 979
70 Ga0068861_100812047 3300005719 Bacteria 879
71 Ga0068861_100979539 3300005719 Bacteria 806
72 Ga0068861_101315402 3300005719 Bacteria 703
73 Ga0068863_100000023 3300005841 Bacteria 186490
74 Ga0068863_100065080 3300005841 Bacteria 3449
75 Ga0068863_100384895 3300005841 Bacteria 1370
76 Ga0068863_100403285 3300005841 Bacteria 1338
77 Ga0068863_101325836 3300005841 Bacteria 727
78 Ga0068858_100000363 3300005842 Bacteria 47852
79 Ga0068858_100015412 3300005842 Bacteria 7188
80 Ga0068858_100104051 3300005842 Bacteria 2649
81 Ga0068858_100840104 3300005842 Bacteria 897
82 Ga0068860_100000100 3300005843 Bacteria 144580
83 Ga0068860_100016918 3300005843 Bacteria 7107
84 Ga0068860_100244899 3300005843 Bacteria 1744
85 Ga0068860_102167835 3300005843 Bacteria 577
86 Ga0068860_102379489 3300005843 Bacteria 550
87 Ga0068862_100005988 3300005844 Bacteria 10125
88 Ga0068862_100046307 3300005844 Bacteria 3711
89 Ga0068862_100170022 3300005844 Bacteria 1951
90 Ga0068862_100266301 3300005844 Bacteria 1566
91 Ga0068862_100746026 3300005844 Bacteria 952
92 Ga0068862_101771229 3300005844 Bacteria 627
93 Ga0070717_10769130 3300006028 Bacteria 876
94 Ga0075368_10004696 3300006042 Bacteria 4646
95 Ga0075368_10579488 3300006042 Bacteria 506
96 Ga0075363_100086363 3300006048 Bacteria 1722
97 Ga0075364_10002235 3300006051 Bacteria 10852
98 Ga0075367_10003359 3300006178 Bacteria 7611
99 Ga0075366_10022236 3300006195 Bacteria 3688
100 Ga0068871_101274493 3300006358 Bacteria 691
101 Ga0075429_100749639 3300006880 Bacteria 855
102 Ga0097620_100000231 3300006931 Bacteria 55036
103 Ga0097620_100007203 3300006931 Bacteria 11289
104 Ga0097620_100173234 3300006931 Bacteria 2240
105 Ga0097620_101024648 3300006931 Bacteria 907
106 Ga0097620_101919032 3300006931 Bacteria 654
107 Ga0097620_102749968 3300006931 Bacteria 540
108 Ga0097620_102901810 3300006931 Bacteria 525
109 Ga0105251_10334268 3300009011 Bacteria 690
110 Ga0105240_10152369 3300009093 Bacteria 2752
111 Ga0105240_10553468 3300009093 Bacteria 1272
112 Ga0105240_10760040 3300009093 Bacteria 1053
113 Ga0105240_10888424 3300009093 Bacteria 959
114 Ga0105247_10596262 3300009101 Bacteria 819
115 Ga0105247_10724191 3300009101 Bacteria 751
116 Ga0105248_10015078 3300009177 Bacteria 8510
117 Ga0105248_10024261 3300009177 Bacteria 6743
118 Ga0105248_10028848 3300009177 Bacteria 6186
119 Ga0105248_10830487 3300009177 Bacteria 1043
120 Ga0105248_11870932 3300009177 Bacteria 681
121 Ga0105238_11193415 3300009551 Bacteria 785
122 Ga0105249_10048049 3300009553 Bacteria 3891
123 Ga0105249_10290910 3300009553 Bacteria 1635
124 Ga0105032_106703 3300009979 Bacteria 960
125 Ga0105239_11059107 3300010375 Bacteria 933
126 Ga0105246_11755425 3300011119 Bacteria 591
127 Ga0157370_10600466 3300013104 Bacteria 1008
128 Ga0157369_10563666 3300013105 Bacteria 1177
129 Ga0157374_11513007 3300013296 Bacteria 694
130 Ga0157374_12274436 3300013296 Bacteria 569
131 Ga0163162_11582866 3300013306 Bacteria 747
132 Ga0157375_10245084 3300013308 Bacteria 1952
133 Ga0157375_11003584 3300013308 Bacteria 974
134 Ga0163163_10027161 3300014325 Bacteria 5480
135 Ga0163163_10034426 3300014325 Bacteria 4905
136 Ga0163163_11703683 3300014325 Bacteria 691
137 Ga0157380_11603074 3300014326 Bacteria 706
138 Ga0157379_10127801 3300014968 Bacteria 2287
139 Ga0157379_10494056 3300014968 Bacteria 1134
140 Ga0157379_11574722 3300014968 Bacteria 641
141 Ga0163161_10593282 3300017792 Bacteria 912
142 Ga0163161_10994912 3300017792 Bacteria 716
143 Ga0213876_10010958 3300021384 Bacteria 4857
144 Ga0213875_10257644 3300021388 Bacteria 823
145 Ga0207710_10351134 3300025900 Bacteria 751
146 Ga0207645_10471203 3300025907 Bacteria 849
147 Ga0207705_10079419 3300025909 Bacteria 2389
148 Ga0207707_10047576 3300025912 Bacteria 3735
149 Ga0207707_10566337 3300025912 Bacteria 964
150 Ga0207695_10002540 3300025913 Bacteria 26801
151 Ga0207695_10009375 3300025913 Bacteria 12105
152 Ga0207695_10882383 3300025913 Bacteria 774
153 Ga0207660_10007187 3300025917 Bacteria 7207
154 Ga0207660_10163773 3300025917 Bacteria 1718
155 Ga0207657_10009884 3300025919 Bacteria 9552
156 Ga0207657_10054525 3300025919 Bacteria 3457
157 Ga0207657_10201087 3300025919 Bacteria 1603
158 Ga0207652_10189006 3300025921 Bacteria 1852
159 Ga0207652_10500481 3300025921 Bacteria 1094
160 Ga0207681_10031662 3300025923 Bacteria 3456
161 Ga0207694_10057589 3300025924 Bacteria 3021
162 Ga0207650_10033654 3300025925 Bacteria 3713
163 Ga0207650_10887415 3300025925 Bacteria 757
164 Ga0207644_10231017 3300025931 Bacteria 1470
165 Ga0207644_10260868 3300025931 Bacteria 1385
166 Ga0207644_10783602 3300025931 Bacteria 797
167 Ga0207690_10002155 3300025932 Bacteria 12039
168 Ga0207706_10046625 3300025933 Bacteria 3837
169 Ga0207691_11179023 3300025940 Bacteria 635
170 Ga0207711_10008220 3300025941 Bacteria 8735
171 Ga0207711_10020729 3300025941 Bacteria 5485
172 Ga0207711_10039910 3300025941 Bacteria 3993
173 Ga0207711_10738587 3300025941 Bacteria 918
174 Ga0207679_10592271 3300025945 Bacteria 998
175 Ga0207679_10601431 3300025945 Bacteria 991
176 Ga0207667_10026930 3300025949 Bacteria 6272
177 Ga0207667_10080217 3300025949 Bacteria 3381
178 Ga0207667_10324624 3300025949 Bacteria 1572
179 Ga0207651_10601175 3300025960 Bacteria 961
180 Ga0207712_10293240 3300025961 Bacteria 1332
181 Ga0207668_10000018 3300025972 Bacteria 158577
182 Ga0207668_10007408 3300025972 Bacteria 6521
183 Ga0207668_10055949 3300025972 Bacteria 2745
184 Ga0207668_10223221 3300025972 Bacteria 1514
185 Ga0207640_10531716 3300025981 Bacteria 984
186 Ga0207658_10009178 3300025986 Bacteria 6708
187 Ga0207658_10052307 3300025986 Bacteria 3013
188 Ga0207658_10145543 3300025986 Bacteria 1924
189 Ga0207658_10155286 3300025986 Bacteria 1869
190 Ga0207658_10465664 3300025986 Bacteria 1121
191 Ga0207658_10473202 3300025986 Bacteria 1112
192 Ga0207703_10000373 3300026035 Bacteria 47832
193 Ga0207703_10011403 3300026035 Bacteria 6913
194 Ga0207703_10658619 3300026035 Bacteria 994
195 Ga0207639_10127852 3300026041 Bacteria 2098
196 Ga0207639_10272386 3300026041 Bacteria 1485
197 Ga0207678_10544306 3300026067 Bacteria 1015
198 Ga0207678_10657998 3300026067 Bacteria 921
199 Ga0207702_11988926 3300026078 Bacteria 572
200 Ga0207641_10000067 3300026088 Bacteria 155379
201 Ga0207641_10063325 3300026088 Bacteria 3159
202 Ga0207641_10349247 3300026088 Bacteria 1409
203 Ga0207641_10840782 3300026088 Bacteria 909
204 Ga0207641_11840580 3300026088 Bacteria 607
205 Ga0207641_11910513 3300026088 Bacteria 595
206 Ga0207648_10429951 3300026089 Bacteria 1200
207 Ga0207676_10000243 3300026095 Bacteria 47468
208 Ga0207676_10005960 3300026095 Bacteria 8594
209 Ga0207676_10014693 3300026095 Bacteria 5640
210 Ga0207676_10270237 3300026095 Bacteria 1539
211 Ga0207674_10876926 3300026116 Bacteria 865
212 Ga0207675_100373334 3300026118 Bacteria 1401
213 Ga0207675_100404840 3300026118 Bacteria 1345
214 Ga0207683_10132548 3300026121 Bacteria 2242
215 Ga0207698_10309949 3300026142 Bacteria 1473
216 Ga0209981_1002264 3300027378 Bacteria 2448
217 Ga0209999_1002235 3300027543 Bacteria 3401
218 Ga0209983_1008218 3300027665 Bacteria 2134
219 Ga0209813_10008236 3300027866 Bacteria 2626
220 Ga0209813_10495239 3300027866 Bacteria 506
221 Ga0268266_10000003 3300028379 Bacteria 1701703
222 Ga0268266_10001678 3300028379 Bacteria 25491
223 Ga0268265_10001898 3300028380 Bacteria 16616
224 Ga0268265_10078490 3300028380 Bacteria 2597
225 Ga0268265_10083049 3300028380 Bacteria 2535
226 Ga0268265_10150249 3300028380 Bacteria 1963
227 Ga0268265_10268570 3300028380 Bacteria 1520
228 Ga0268265_10354342 3300028380 Bacteria 1341
229 Ga0268265_10839348 3300028380 Bacteria 898
230 Ga0268264_10000002 3300028381 Bacteria 1153045
231 Ga0268264_10189458 3300028381 Bacteria 1874
232 Ga0268264_11167358 3300028381 Bacteria 779
233 Ga0268264_11658859 3300028381 Bacteria 650
234 Ga0307517_10001099 3300028786 Bacteria 45677
235 Ga0307517_10167076 3300028786 Bacteria 1458
236 Ga0307517_10231821 3300028786 Bacteria 1107
237 Ga0307513_10000208 3300031456 Bacteria 84906
238 Ga0307513_10001617 3300031456 Bacteria 32329
239 Ga0307513_10011300 3300031456 Bacteria 11110
240 Ga0307408_101037791 3300031548 Bacteria 757
241 Ga0307408_101084098 3300031548 Bacteria 742
242 Ga0307508_10284507 3300031616 Bacteria 1247
243 Ga0265314_10570552 3300031711 Bacteria 586
244 Ga0307405_11347903 3300031731 Unclassified 622
245 Ga0307413_10454511 3300031824 Bacteria 1017
246 Ga0307410_10488047 3300031852 Bacteria 1012
247 Ga0307410_10660569 3300031852 Bacteria 878
248 Ga0307406_10527805 3300031901 Bacteria 962
249 Ga0307409_100241157 3300031995 Bacteria 1646
250 Ga0307416_101101912 3300032002 Bacteria 899
251 Ga0307416_102920014 3300032002 Bacteria 572
252 Ga0307510_10061230 3300033180 Bacteria 3862
253 Ga0373936_0030009 3300035113 Bacteria 2143
254 Ga0373946_0021820 3300035171 Bacteria 2486
255 Ga0373962_0407518 3300035242 Bacteria 501
256 Ga0373947_0159238 3300035725 Bacteria 1459
257 Ga0373925_0000277 3300037068 Bacteria 53450
258 Ga0395905_0376236 3300037471 Bacteria 1314
259 Ga0436364_1242010 3300037853 Bacteria 3049
260 Ga0395901_0546150 3300038443 Bacteria 1175
261 Ga0436365_0027492 3300039437 Bacteria 5937
262 Ga0436365_0176775 3300039437 Bacteria 1029
263 Ga0436365_1578205 3300039437 Bacteria 2356
264 Ga0451807_2632547 3300041486 Bacteria 675
265 Ga0466960_0321882 3300044901 Bacteria 876
266 Ga0466958_0218784 3300045836 Bacteria 1215
267 Ga0495629_0013138 3300046459 Bacteria 5980
268 Ga0495629_0316796 3300046459 Bacteria 1067
269 Ga0495629_0792620 3300046459 Bacteria 625
270 Ga0495638_0096454 3300046460 Bacteria 1775
271 Ga0495638_0171883 3300046460 Bacteria 1243
272 Ga0495664_0861642 3300046477 Bacteria 531
273 Ga0495584_0654405 3300046491 Bacteria 536
274 Ga0495585_0389431 3300046492 Bacteria 672
275 Ga0495583_0183153 3300046506 Bacteria 857
276 Ga0495583_0187928 3300046506 Bacteria 843
277 Ga0495606_0053137 3300046507 Bacteria 2630
278 Ga0495610_0111507 3300046512 Bacteria 1211
279 Ga0495620_0047533 3300046515 Bacteria 1846
280 Ga0495630_0420946 3300046517 Bacteria 1023
281 Ga0495643_0021841 3300046522 Bacteria 3663
282 Ga0495644_0314581 3300046523 Bacteria 614
283 Ga0495644_0410312 3300046523 Bacteria 537
284 Ga0495648_0450322 3300046524 Bacteria 563
285 Ga0495663_0101892 3300046525 Bacteria 946
286 Ga0495642_0012690 3300046528 Bacteria 3250
287 Ga0495642_0272438 3300046528 Bacteria 741
288 Ga0495654_0078567 3300046530 Bacteria 1551
289 Ga0495609_0073258 3300046538 Bacteria 1503
290 Ga0495597_0003430 3300046542 Bacteria 9259
291 Ga0495597_0076637 3300046542 Unclassified 1434
292 Ga0495645_0754043 3300046543 Bacteria 587
293 Ga0495622_0057618 3300046557 Bacteria 1801
294 Ga0495668_0043069 3300046616 Bacteria 2512
295 Ga0495668_0067614 3300046616 Bacteria 1966
296 Ga0495668_0080526 3300046616 Bacteria 1787
297 Ga0495668_0299289 3300046616 Bacteria 882
298 Ga0495611_0034079 3300046648 Bacteria 2249
299 Ga0495625_0003341 3300046660 Bacteria 16142
300 Ga0495625_0108330 3300046660 Bacteria 1901
301 Ga0495625_0410196 3300046660 Bacteria 845
302 Ga0495625_0413334 3300046660 Bacteria 840
303 Ga0495625_0558657 3300046660 Bacteria 692
304 Ga0495659_0066237 3300046664 Bacteria 1345
305 Ga0495657_0554917 3300046675 Bacteria 667
306 Ga0495669_0046495 3300046684 Bacteria 1937
307 Ga0495669_0062193 3300046684 Bacteria 1691
308 Ga0495669_0230217 3300046684 Bacteria 889
309 Ga0495669_0276989 3300046684 Bacteria 807
310 Ga0495669_0381646 3300046684 Bacteria 682
311 Ga0495581_0213875 3300047315 Bacteria 1127
312 Ga0495636_0010843 3300047318 Bacteria 3604
313 Ga0495672_0519607 3300047320 Bacteria 526
314 Ga0495687_055909 3300047443 Bacteria 1648
315 Ga0495681_0284290 3300047470 Bacteria 644
316 Ga0495686_0081517 3300047472 Bacteria 1976
317 Ga0495686_0541332 3300047472 Bacteria 609
318 Ga0495686_0715429 3300047472 Bacteria 510
319 Ga0495593_0028418 3300047673 Bacteria 3071
320 Ga0495602_0331372 3300048088 Bacteria 1104
321 Ga0496100_0246820 3300048903 Bacteria 1319
322 Ga0496100_1246301 3300048903 Bacteria 587
323 Ga0496101_0041395 3300048904 Bacteria 3285
324 Ga0496101_0334901 3300048904 Bacteria 1188
325 Ga0496101_0379681 3300048904 Bacteria 1112
326 Ga0496102_0012184 3300048905 Bacteria 7434
327 Ga0496103_0130655 3300048906 Bacteria 1604
328 Ga0496105_0362559 3300048908 Bacteria 1156
329 Ga0496105_1042377 3300048908 Bacteria 610
330 Ga0496106_0086191 3300048909 Bacteria 2419
331 Ga0496106_0680100 3300048909 Bacteria 821
332 Ga0496107_1006865 3300048910 Bacteria 604
333 Ga0496108_0159430 3300048911 Bacteria 1949
334 Ga0496109_0086791 3300048912 Bacteria 2890
335 Ga0496110_0331536 3300048913 Bacteria 1386
336 Ga0496110_0474223 3300048913 Bacteria 1140
337 Ga0496111_0645583 3300048914 Bacteria 772
338 Ga0496112_0032080 3300048915 Bacteria 5099
339 Ga0496113_0116465 3300048916 Bacteria 2085
340 Ga0496115_0002467 3300048918 Bacteria 13293
341 Ga0496115_0029763 3300048918 Bacteria 4292
342 Ga0496116_0214392 3300048919 Bacteria 994
343 Ga0496118_0079236 3300048921 Bacteria 2319
344 Ga0496121_0000053 3300048924 Bacteria 312611
345 Ga0496122_0007409 3300048925 Bacteria 12213
346 Ga0496123_0002155 3300048926 Bacteria 25154
347 Ga0496124_0009654 3300048927 Bacteria 9884
348 Ga0501032_0657752 3300049569 Bacteria 665
349 Ga0501033_0019584 3300049570 Bacteria 5116
350 Ga0501036_1552728 3300049572 Bacteria 535
351 Ga0501037_0197893 3300049573 Bacteria 1421
352 Ga0501043_1034371 3300049579 Bacteria 583
353 Ga0501047_0154487 3300049581 Bacteria 2169
354 Ga0501047_0258907 3300049581 Bacteria 1588
355 Ga0501048_0255742 3300049582 Bacteria 1244
356 Ga0501048_1143365 3300049582 Bacteria 560
357 Ga0501257_063324 3300049686 Bacteria 937
358 Ga0501257_094926 3300049686 Bacteria 778
359 Ga0501273_079714 3300049770 Bacteria 543
360 Ga0501035_1389236 3300049822 Bacteria 539
361 Ga0501044_0003119 3300049823 Bacteria 18782
362 nmdc:mga03n38_60443_c1 3300050490 Bacteria 1723
363 nmdc:mga00v17_1417_c1 3300050491 Bacteria 10795
364 nmdc:mga0k408_105898_c1 3300050493 Bacteria 1661
365 nmdc:mga06z11_8733_c1 3300050494 Bacteria 4243
366 nmdc:mga04h51_36011_c1 3300050495 Bacteria 1590
367 nmdc:mga04h51_529495_c1 3300050495 Bacteria 506
368 nmdc:mga07m45_226604_c1 3300050496 Bacteria 1088
369 nmdc:mga07m45_486737_c1 3300050496 Bacteria 715
370 nmdc:mga09592_663087_c1 3300050508 Bacteria 890
371 Ga0500578_0232603 3300053086 Bacteria 1116
372 Ga0500643_024901 3300053087 Bacteria 1892
373 Ga0500643_114921 3300053087 Bacteria 726
374 Ga0500646_0019449 3300053090 Bacteria 1797
375 Ga0500583_0004464 3300053092 Bacteria 4568
376 Ga0500651_0079301 3300053093 Bacteria 2035
377 Ga0500566_0035581 3300053094 Bacteria 2893
378 Ga0500641_0273703 3300053096 Bacteria 702
379 Ga0500641_0377475 3300053096 Bacteria 563
380 Ga0500555_004787 3300053103 Bacteria 3842
381 Ga0500556_0000630 3300053104 Bacteria 22279
382 Ga0500556_0010714 3300053104 Bacteria 2697
383 Ga0500569_002691 3300053109 Bacteria 3539
384 Ga0500594_0211789 3300053118 Bacteria 639
385 Ga0500595_003335 3300053119 Bacteria 7548
386 Ga0500608_002477 3300053122 Bacteria 6726
387 Ga0500608_009700 3300053122 Bacteria 4100
388 Ga0500614_002456 3300053123 Bacteria 4132
389 Ga0500642_0000001 3300053130 Bacteria 1468402
390 Ga0500642_0164833 3300053130 Bacteria 1038
391 Ga0500655_073137 3300053133 Bacteria 700
392 Ga0500658_0034736 3300053134 Bacteria 1992
393 Ga0500559_0111706 3300053136 Bacteria 1266
394 Ga0500577_0484414 3300053142 Unclassified 540
395 Ga0500590_056110 3300053148 Bacteria 1990
396 Ga0500619_026196 3300053154 Bacteria 1734
397 Ga0500639_174793 3300053163 Bacteria 958
398 Ga0500637_0104934 3300053178 Bacteria 1638
399 Ga0500657_132703 3300053728 Bacteria 962
400 Ga0500625_038228 3300053729 Bacteria 2267
401 Ga0500645_000831 3300053730 Bacteria 18380
402 Ga0500645_092284 3300053730 Bacteria 858
403 Ga0500596_001262 3300053735 Bacteria 5114
404 Ga0500596_051468 3300053735 Bacteria 674
405 Ga0163163_10445992
406 JGI24751J29686_10099793
407 Ga0070658_10473660
408 Ga0070658_10605263
409 Ga0070658_10759659
410 Ga0070676_10894178
411 Ga0070683_101759092
412 Ga0070690_101285100
413 Ga0070670_100177622
414 Ga0070670_101142654
415 Ga0070666_10183360
416 Ga0068868_100274960
417 Ga0070660_100144697
418 Ga0070660_100631411
419 Ga0070691_10052153
420 Ga0070661_100886678
421 Ga0070668_100003571
422 Ga0070668_100006664
423 Ga0070668_100038043
424 Ga0070668_100053405
425 Ga0070668_100519739
426 Ga0070669_100084726
427 Ga0070671_100174745
428 Ga0070671_100450997
429 Ga0070673_100658840
430 Ga0070659_100002104
431 Ga0070659_100048376
432 Ga0070667_100005948
433 Ga0070667_100022761
434 Ga0070667_100022887
435 Ga0070667_100183751
436 Ga0070667_101145296
437 Ga0070663_101822091
438 Ga0070678_100145159
439 Ga0070662_100292233
440 Ga0070681_10003748
441 Ga0070681_10026625
442 Ga0068853_100220566
443 Ga0068853_100580737
444 Ga0070686_101334786
445 Ga0070696_101031579
446 Ga0070665_100000762
447 Ga0070665_100000831
448 Ga0070665_100099472
449 Ga0068855_100004289
450 Ga0068855_100058400
451 Ga0070664_100663224
452 Ga0070664_101304479
453 Ga0070664_101611750
454 Ga0068857_100234057
455 Ga0068854_100969905
456 Ga0068856_101930825
457 Ga0068852_100124994
458 Ga0068852_101613887
459 Ga0068859_100000231
460 Ga0068859_100007203
461 Ga0068859_100173234
462 Ga0068859_101024816
463 Ga0068859_101919022
464 Ga0068859_102752019
465 Ga0068859_102901641
466 Ga0068864_100000060
467 Ga0068864_100023724
468 Ga0068864_100107358
469 Ga0068864_100207038
470 Ga0068864_100218507
471 Ga0068861_100340173
472 Ga0068861_100574193
473 Ga0068861_100642695
474 Ga0068861_100812047
475 Ga0068861_100979539
476 Ga0068861_101315402
477 Ga0068863_100000023
478 Ga0068863_100065080
479 Ga0068863_100384895
480 Ga0068863_100403285
481 Ga0068863_101325836
482 Ga0068858_100000363
483 Ga0068858_100015412
484 Ga0068858_100104051
485 Ga0068858_100840104
486 Ga0068860_100000100
487 Ga0068860_100016918
488 Ga0068860_100244899
489 Ga0068860_102167835
490 Ga0068860_102379489
491 Ga0068862_100005988
492 Ga0068862_100046307
493 Ga0068862_100170022
494 Ga0068862_100266301
495 Ga0068862_100746026
496 Ga0068862_101771229
497 Ga0070717_10769130
498 Ga0075368_10004696
499 Ga0075368_10579488
500 Ga0075363_100086363
501 Ga0075364_10002235
502 Ga0075367_10003359
503 Ga0075366_10022236
504 Ga0068871_101274493
505 Ga0075429_100749639
506 Ga0097620_100000231
507 Ga0097620_100007203
508 Ga0097620_100173234
509 Ga0097620_101024648
510 Ga0097620_101919032
511 Ga0097620_102749968
512 Ga0097620_102901810
513 Ga0105251_10334268
514 Ga0105240_10152369
515 Ga0105240_10553468
516 Ga0105240_10760040
517 Ga0105240_10888424
518 Ga0105247_10596262
519 Ga0105247_10724191
520 Ga0105248_10015078
521 Ga0105248_10024261
522 Ga0105248_10028848
523 Ga0105248_10830487
524 Ga0105248_11870932
525 Ga0105238_11193415
526 Ga0105249_10048049
527 Ga0105249_10290910
528 Ga0105032_106703
529 Ga0105239_11059107
530 Ga0105246_11755425
531 Ga0157370_10600466
532 Ga0157369_10563666
533 Ga0157374_11513007
534 Ga0157374_12274436
535 Ga0163162_11582866
536 Ga0157375_10245084
537 Ga0157375_11003584
538 Ga0163163_10027161
539 Ga0163163_10034426
540 Ga0163163_11703683
541 Ga0157380_11603074
542 Ga0157379_10127801
543 Ga0157379_10494056
544 Ga0157379_11574722
545 Ga0163161_10593282
546 Ga0163161_10994912
547 Ga0213876_10010958
548 Ga0213875_10257644
549 Ga0207710_10351134
550 Ga0207645_10471203
551 Ga0207705_10079419
552 Ga0207707_10047576
553 Ga0207707_10566337
554 Ga0207695_10002540
555 Ga0207695_10009375
556 Ga0207695_10882383
557 Ga0207660_10007187
558 Ga0207660_10163773
559 Ga0207657_10009884
560 Ga0207657_10054525
561 Ga0207657_10201087
562 Ga0207652_10189006
563 Ga0207652_10500481
564 Ga0207681_10031662
565 Ga0207694_10057589
566 Ga0207650_10033654
567 Ga0207650_10887415
568 Ga0207644_10231017
569 Ga0207644_10260868
570 Ga0207644_10783602
571 Ga0207690_10002155
572 Ga0207706_10046625
573 Ga0207691_11179023
574 Ga0207711_10008220
575 Ga0207711_10020729
576 Ga0207711_10039910
577 Ga0207711_10738587
578 Ga0207679_10592271
579 Ga0207679_10601431
580 Ga0207667_10026930
581 Ga0207667_10080217
582 Ga0207667_10324624
583 Ga0207651_10601175
584 Ga0207712_10293240
585 Ga0207668_10000018
586 Ga0207668_10007408
587 Ga0207668_10055949
588 Ga0207668_10223221
589 Ga0207640_10531716
590 Ga0207658_10009178
591 Ga0207658_10052307
592 Ga0207658_10145543
593 Ga0207658_10155286
594 Ga0207658_10465664
595 Ga0207658_10473202
596 Ga0207703_10000373
597 Ga0207703_10011403
598 Ga0207703_10658619
599 Ga0207639_10127852
600 Ga0207639_10272386
601 Ga0207678_10544306
602 Ga0207678_10657998
603 Ga0207702_11988926
604 Ga0207641_10000067
605 Ga0207641_10063325
606 Ga0207641_10349247
607 Ga0207641_10840782
608 Ga0207641_11840580
609 Ga0207641_11910513
610 Ga0207648_10429951
611 Ga0207676_10000243
612 Ga0207676_10005960
613 Ga0207676_10014693
614 Ga0207676_10270237
615 Ga0207674_10876926
616 Ga0207675_100373334
617 Ga0207675_100404840
618 Ga0207683_10132548
619 Ga0207698_10309949
620 Ga0209981_1002264
621 Ga0209999_1002235
622 Ga0209983_1008218
623 Ga0209813_10008236
624 Ga0209813_10495239
625 Ga0268266_10000003
626 Ga0268266_10001678
627 Ga0268265_10001898
628 Ga0268265_10078490
629 Ga0268265_10083049
630 Ga0268265_10150249
631 Ga0268265_10268570
632 Ga0268265_10354342
633 Ga0268265_10839348
634 Ga0268264_10000002
635 Ga0268264_10189458
636 Ga0268264_11167358
637 Ga0268264_11658859
638 Ga0307517_10001099
639 Ga0307517_10167076
640 Ga0307517_10231821
641 Ga0307513_10000208
642 Ga0307513_10001617
643 Ga0307513_10011300
644 Ga0307408_101037791
645 Ga0307408_101084098
646 Ga0307508_10284507
647 Ga0265314_10570552
648 Ga0307405_11347903
649 Ga0307413_10454511
650 Ga0307410_10488047
651 Ga0307410_10660569
652 Ga0307406_10527805
653 Ga0307409_100241157
654 Ga0307416_101101912
655 Ga0307416_102920014
656 Ga0307510_10061230
657 Ga0373936_0030009
658 Ga0373946_0021820
659 Ga0373962_0407518
660 Ga0373947_0159238
661 Ga0373925_0000277
662 Ga0395905_0376236
663 Ga0436364_1242010
664 Ga0395901_0546150
665 Ga0436365_0027492
666 Ga0436365_0176775
667 Ga0436365_1578205
668 Ga0451807_2632547
669 Ga0466960_0321882
670 Ga0466958_0218784
671 Ga0495629_0013138
672 Ga0495629_0316796
673 Ga0495629_0792620
674 Ga0495638_0096454
675 Ga0495638_0171883
676 Ga0495664_0861642
677 Ga0495584_0654405
678 Ga0495585_0389431
679 Ga0495583_0183153
680 Ga0495583_0187928
681 Ga0495606_0053137
682 Ga0495610_0111507
683 Ga0495620_0047533
684 Ga0495630_0420946
685 Ga0495643_0021841
686 Ga0495644_0314581
687 Ga0495644_0410312
688 Ga0495648_0450322
689 Ga0495663_0101892
690 Ga0495642_0012690
691 Ga0495642_0272438
692 Ga0495654_0078567
693 Ga0495609_0073258
694 Ga0495597_0003430
695 Ga0495597_0076637
696 Ga0495645_0754043
697 Ga0495622_0057618
698 Ga0495668_0043069
699 Ga0495668_0067614
700 Ga0495668_0080526
701 Ga0495668_0299289
702 Ga0495611_0034079
703 Ga0495625_0003341
704 Ga0495625_0108330
705 Ga0495625_0410196
706 Ga0495625_0413334
707 Ga0495625_0558657
708 Ga0495659_0066237
709 Ga0495657_0554917
710 Ga0495669_0046495
711 Ga0495669_0062193
712 Ga0495669_0230217
713 Ga0495669_0276989
714 Ga0495669_0381646
715 Ga0495581_0213875
716 Ga0495636_0010843
717 Ga0495672_0519607
718 Ga0495687_055909
719 Ga0495681_0284290
720 Ga0495686_0081517
721 Ga0495686_0541332
722 Ga0495686_0715429
723 Ga0495593_0028418
724 Ga0495602_0331372
725 Ga0496100_0246820
726 Ga0496100_1246301
727 Ga0496101_0041395
728 Ga0496101_0334901
729 Ga0496101_0379681
730 Ga0496102_0012184
731 Ga0496103_0130655
732 Ga0496105_0362559
733 Ga0496105_1042377
734 Ga0496106_0086191
735 Ga0496106_0680100
736 Ga0496107_1006865
737 Ga0496108_0159430
738 Ga0496109_0086791
739 Ga0496110_0331536
740 Ga0496110_0474223
741 Ga0496111_0645583
742 Ga0496112_0032080
743 Ga0496113_0116465
744 Ga0496115_0002467
745 Ga0496115_0029763
746 Ga0496116_0214392
747 Ga0496118_0079236
748 Ga0496121_0000053
749 Ga0496122_0007409
750 Ga0496123_0002155
751 Ga0496124_0009654
752 Ga0501032_0657752
753 Ga0501033_0019584
754 Ga0501036_1552728
755 Ga0501037_0197893
756 Ga0501043_1034371
757 Ga0501047_0154487
758 Ga0501047_0258907
759 Ga0501048_0255742
760 Ga0501048_1143365
761 Ga0501257_063324
762 Ga0501257_094926
763 Ga0501273_079714
764 Ga0501035_1389236
765 Ga0501044_0003119
766 nmdc:mga03n38_60443_c1
767 nmdc:mga00v17_1417_c1
768 nmdc:mga0k408_105898_c1
769 nmdc:mga06z11_8733_c1
770 nmdc:mga04h51_36011_c1
771 nmdc:mga04h51_529495_c1
772 nmdc:mga07m45_226604_c1
773 nmdc:mga07m45_486737_c1
774 nmdc:mga09592_663087_c1
775 Ga0500578_0232603
776 Ga0500643_024901
777 Ga0500643_114921
778 Ga0500646_0019449
779 Ga0500583_0004464
780 Ga0500651_0079301
781 Ga0500566_0035581
782 Ga0500641_0273703
783 Ga0500641_0377475
784 Ga0500555_004787
785 Ga0500556_0000630
786 Ga0500556_0010714
787 Ga0500569_002691
788 Ga0500594_0211789
789 Ga0500595_003335
790 Ga0500608_002477
791 Ga0500608_009700
792 Ga0500614_002456
793 Ga0500642_0000001
794 Ga0500642_0164833
795 Ga0500655_073137
796 Ga0500658_0034736
797 Ga0500559_0111706
798 Ga0500577_0484414
799 Ga0500590_056110
800 Ga0500619_026196
801 Ga0500639_174793
802 Ga0500637_0104934
803 Ga0500657_132703
804 Ga0500625_038228
805 Ga0500645_000831
806 Ga0500645_092284
807 Ga0500596_001262
808 Ga0500596_051468

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01722

BolA

BolA-like protein

30

107

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pui-assembly2.cif.gz_B bola domain of sufe1 from arabidopsis thaliana 0.9295 1 87
4pui-assembly1.cif.gz_A bola domain of sufe1 from arabidopsis thaliana 0.9192 1 87
3o2e-assembly1.cif.gz_A crystal structure of a bol-like protein from babesia bovis 0.9115 6 88
4pug-assembly2.cif.gz_B bola1 from arabidopsis thaliana 0.9053 1 90
4pug-assembly2.cif.gz_B bola1 from arabidopsis thaliana 0.8848 1 90
ID Description Score Start End Superfamily
4puiA01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9267 2 87 3.30.300.90
af_Q67VQ4_70_166_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.9252 4 89 3.10.20.90
af_Q8I3V0_1_83_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.9245 4 89 3.10.20.90
af_Q682I1_66_160_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9227 5 90 3.30.300.90
af_P39724_22_112_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.9206 3 86 3.10.20.90
ID Description Score Start End GO Terms
AF-A0A258C5Z9-F1-model_v4 deleted 0.9707 1 88
AF-A0A2N0ATQ0-F1-model_v4 BolA family transcriptional regulator 0.9597 9 87 GO:0016226
AF-A0A6A5KV05-F1-model_v4 deleted 0.9579 4 89
AF-A0A1I2HW31-F1-model_v4 Transcriptional regulator, BolA protein family 0.9552 4 87 GO:0016226
AF-A0A3N8P9R4-F1-model_v4 BolA family transcriptional regulator 0.955 4 89 GO:0016226

Map