F435619

General Info

Members Datasets Scaffolds Average Seq Length
404 250 808 257

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100023602|Ga0070665_1000236024
Length 292
Sequence MEMPQSLVRTRCWRPAMSDDPLLDNTAEVGLFKGARGPAPVVVESVGVRFGGLIALDDVSLRVPTGELTAIIGPNGAGKTTLLNAMSGAFRGQMVGRVMVSGTDVSGWRTWRFAAAGIARSFQHPPLIDSETVLENVMIGLHHSLGYNNLQTVIRPAWCNKRERQMQSLGMAALEFVGLARIANSVVGSIPYGARKLTDLARALVSSPRLIMLDEPTSGLGADAREDMSRILTSVLATKMTTLIVVEHHMDLVRAVANNVVGMQAGRVLITGSPSDVLDSDVFLAAIVGRSG

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
125 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
126 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
134 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
135 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
136 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
137 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
138 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
149 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
150 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
151 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
152 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
155 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
156 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
157 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
158 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
159 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
160 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
161 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
162 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
163 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
164 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
165 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
166 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
171 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
172 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
175 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
207 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
208 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
209 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
210 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
211 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
212 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
213 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
214 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
215 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
216 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
224 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
228 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
229 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
230 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
231 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
232 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
233 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
234 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
235 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
236 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
237 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
238 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
239 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
240 2818991441 Niallia circulans 3243 Isolate Rhizosphere
241 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
242 2857472729 Cohnella sp. R-74144 Isolate Unclassified
243 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
244 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
245 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
246 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
247 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
248 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
249 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
250 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.04
Metatranscriptomes 0.25
Isolates 3.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.49
Nodule 0.25
Rhizoplane 4.21
Rhizosphere 92.33
Stem 0
Stem Tuber 0
Unclassified 0.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100023602 3300005548 Bacteria 6193
2 JGI25151J46595_10053040 3300003187 Bacteria 1358
3 Ga0055532_1001941 3300003758 Bacteria 4874
4 Ga0070658_10077957 3300005327 Bacteria 2719
5 Ga0070676_10057538 3300005328 Bacteria 2301
6 Ga0070690_100209101 3300005330 Bacteria 1361
7 Ga0070670_100002715 3300005331 Bacteria 14617
8 Ga0070670_100030100 3300005331 Bacteria 4675
9 Ga0070670_100119638 3300005331 Bacteria 2272
10 Ga0070677_10002038 3300005333 Bacteria 6427
11 Ga0070666_10019327 3300005335 Bacteria 4397
12 Ga0068868_100215580 3300005338 Bacteria 1606
13 Ga0070660_100156321 3300005339 Bacteria 1835
14 Ga0070689_100009913 3300005340 Bacteria 6775
15 Ga0070661_100020109 3300005344 Bacteria 4759
16 Ga0070668_100011523 3300005347 Bacteria 6582
17 Ga0070669_100324247 3300005353 Bacteria 1244
18 Ga0070688_100084888 3300005365 Bacteria 2057
19 Ga0070659_100017342 3300005366 Bacteria 5416
20 Ga0070667_100026448 3300005367 Bacteria 4827
21 Ga0070667_100681705 3300005367 Bacteria 950
22 Ga0070713_100818890 3300005436 Bacteria 893
23 Ga0070710_10040819 3300005437 Bacteria 2559
24 Ga0070701_10014105 3300005438 Bacteria 3655
25 Ga0070700_100236707 3300005441 Bacteria 1302
26 Ga0070708_100183873 3300005445 Bacteria 1954
27 Ga0070708_100577638 3300005445 Bacteria 1060
28 Ga0070663_100027079 3300005455 Bacteria 3888
29 Ga0070662_100067717 3300005457 Bacteria 2622
30 Ga0070681_10009653 3300005458 Bacteria 9492
31 Ga0070681_10390237 3300005458 Bacteria 1303
32 Ga0070706_100051938 3300005467 Bacteria 3784
33 Ga0070699_100006657 3300005518 Bacteria 10047
34 Ga0070684_100114488 3300005535 Bacteria 2421
35 Ga0070684_100121167 3300005535 Bacteria 2353
36 Ga0070697_100255815 3300005536 Bacteria 1498
37 Ga0070695_100023430 3300005545 Bacteria 3794
38 Ga0070696_100023289 3300005546 Bacteria 4209
39 Ga0068855_100071246 3300005563 Bacteria 4043
40 Ga0068855_100355262 3300005563 Bacteria 1613
41 Ga0070664_100104667 3300005564 Bacteria 2464
42 Ga0070664_100168481 3300005564 Bacteria 1942
43 Ga0070664_100311600 3300005564 Bacteria 1424
44 Ga0068854_100257282 3300005578 Bacteria 1396
45 Ga0068854_100564544 3300005578 Bacteria 967
46 Ga0068856_100650055 3300005614 Bacteria 1075
47 Ga0070702_100022865 3300005615 Bacteria 3313
48 Ga0068852_100004945 3300005616 Bacteria 9469
49 Ga0068864_100035110 3300005618 Bacteria 4267
50 Ga0068861_100019025 3300005719 Bacteria 4900
51 Ga0068861_100156549 3300005719 Bacteria 1875
52 Ga0068870_10012805 3300005840 Bacteria 3926
53 Ga0068863_100030269 3300005841 Bacteria 5170
54 Ga0068858_100029634 3300005842 Bacteria 5083
55 Ga0068858_100597984 3300005842 Bacteria 1070
56 Ga0068860_100016393 3300005843 Bacteria 7224
57 Ga0068860_100023587 3300005843 Bacteria 5946
58 Ga0068860_100082323 3300005843 Bacteria 3061
59 Ga0068862_100284124 3300005844 Bacteria 1517
60 Ga0081455_10009711 3300005937 Bacteria 9867
61 Ga0081538_10008392 3300005981 Bacteria 8779
62 Ga0081538_10034292 3300005981 Bacteria 3357
63 Ga0070716_100415095 3300006173 Bacteria 972
64 Ga0070712_100001328 3300006175 Bacteria 14997
65 Ga0070712_100448325 3300006175 Bacteria 1074
66 Ga0068871_100510431 3300006358 Bacteria 1084
67 Ga0075431_100032266 3300006847 Bacteria 5396
68 Ga0075429_100067027 3300006880 Bacteria 3124
69 Ga0068865_100015475 3300006881 Bacteria 4866
70 Ga0068865_100095714 3300006881 Bacteria 2164
71 Ga0068865_100158230 3300006881 Bacteria 1725
72 Ga0075435_100684155 3300007076 Bacteria 891
73 Ga0105240_10014072 3300009093 Bacteria 10937
74 Ga0105240_10706943 3300009093 Bacteria 1100
75 Ga0111539_10007804 3300009094 Bacteria 13664
76 Ga0111539_10028521 3300009094 Bacteria 6808
77 Ga0111539_10129488 3300009094 Bacteria 2955
78 Ga0105247_10094899 3300009101 Bacteria 1899
79 Ga0114129_10005844 3300009147 Bacteria 17424
80 Ga0114129_10023428 3300009147 Bacteria 8754
81 Ga0114129_10133807 3300009147 Bacteria 3404
82 Ga0105243_10393592 3300009148 Bacteria 1285
83 Ga0105242_10181877 3300009176 Bacteria 1855
84 Ga0105242_10217109 3300009176 Bacteria 1707
85 Ga0105248_10422742 3300009177 Bacteria 1501
86 Ga0105238_10065016 3300009551 Bacteria 3648
87 Ga0105238_10290746 3300009551 Bacteria 1616
88 Ga0105249_10017881 3300009553 Bacteria 6299
89 Ga0105249_10091762 3300009553 Bacteria 2842
90 Ga0105246_10024022 3300011119 Bacteria 3953
91 Ga0157369_10003928 3300013105 Bacteria 17634
92 Ga0157374_10031842 3300013296 Bacteria 4797
93 Ga0157374_10243007 3300013296 Bacteria 1771
94 Ga0157378_10031296 3300013297 Bacteria 4701
95 Ga0157378_10139619 3300013297 Bacteria 2249
96 Ga0163162_10024055 3300013306 Bacteria 6011
97 Ga0163162_10354813 3300013306 Bacteria 1599
98 Ga0157372_10005735 3300013307 Bacteria 13224
99 Ga0163163_10029356 3300014325 Bacteria 5289
100 Ga0163163_10176180 3300014325 Bacteria 2185
101 Ga0157380_10199538 3300014326 Bacteria 1774
102 Ga0157377_10019019 3300014745 Bacteria 3582
103 Ga0157379_10040994 3300014968 Bacteria 4133
104 Ga0157379_10058745 3300014968 Bacteria 3439
105 Ga0157376_10253280 3300014969 Bacteria 1645
106 Ga0157376_10302780 3300014969 Bacteria 1514
107 Ga0206353_11863937 3300020082 Bacteria 1145
108 Ga0213875_10013664 3300021388 Bacteria 3978
109 Ga0209147_100098 3300025229 Bacteria 163978
110 Ga0209130_1004613 3300025284 Bacteria 5142
111 Ga0209675_1040323 3300025291 Bacteria 1028
112 Ga0209025_1004474 3300025294 Bacteria 12116
113 Ga0207697_10000400 3300025315 Bacteria 24424
114 Ga0207682_10015988 3300025893 Bacteria 2925
115 Ga0207688_10000843 3300025901 Bacteria 15416
116 Ga0207680_10020288 3300025903 Unclassified 3573
117 Ga0207645_10002410 3300025907 Bacteria 14721
118 Ga0207643_10000308 3300025908 Bacteria 33738
119 Ga0207705_10047464 3300025909 Bacteria 3088
120 Ga0207684_10092426 3300025910 Bacteria 2578
121 Ga0207707_10055600 3300025912 Bacteria 3442
122 Ga0207707_10292232 3300025912 Bacteria 1410
123 Ga0207695_10058767 3300025913 Bacteria 3991
124 Ga0207693_10007865 3300025915 Bacteria 8754
125 Ga0207657_10055444 3300025919 Bacteria 3423
126 Ga0207649_10051863 3300025920 Bacteria 2542
127 Ga0207649_10097260 3300025920 Bacteria 1941
128 Ga0207652_10081002 3300025921 Bacteria 2839
129 Ga0207652_10549471 3300025921 Bacteria 1038
130 Ga0207646_10265361 3300025922 Bacteria 1552
131 Ga0207694_10112907 3300025924 Bacteria 2163
132 Ga0207650_10005185 3300025925 Bacteria 8891
133 Ga0207650_10063725 3300025925 Bacteria 2757
134 Ga0207650_10094621 3300025925 Bacteria 2289
135 Ga0207650_10206009 3300025925 Bacteria 1578
136 Ga0207644_10072791 3300025931 Bacteria 2518
137 Ga0207644_10100084 3300025931 Bacteria 2176
138 Ga0207690_10069993 3300025932 Bacteria 2415
139 Ga0207690_10469353 3300025932 Bacteria 1014
140 Ga0207706_10002572 3300025933 Bacteria 17696
141 Ga0207706_10251879 3300025933 Bacteria 1542
142 Ga0207670_10011130 3300025936 Bacteria 5211
143 Ga0207669_10071996 3300025937 Bacteria 2174
144 Ga0207704_10130622 3300025938 Bacteria 1738
145 Ga0207704_10186435 3300025938 Bacteria 1505
146 Ga0207691_10009613 3300025940 Bacteria 9279
147 Ga0207689_10000892 3300025942 Bacteria 28687
148 Ga0207679_10090531 3300025945 Bacteria 2365
149 Ga0207667_10083083 3300025949 Bacteria 3317
150 Ga0207712_10388573 3300025961 Bacteria 1170
151 Ga0207668_10039103 3300025972 Bacteria 3190
152 Ga0207668_10209701 3300025972 Bacteria 1557
153 Ga0207640_10297514 3300025981 Bacteria 1275
154 Ga0207658_10009365 3300025986 Bacteria 6644
155 Ga0207703_10013217 3300026035 Bacteria 6431
156 Ga0207703_10122391 3300026035 Bacteria 2235
157 Ga0207703_10128690 3300026035 Bacteria 2184
158 Ga0207678_10001523 3300026067 Bacteria 21247
159 Ga0207708_10001590 3300026075 Bacteria 16974
160 Ga0207708_10295720 3300026075 Bacteria 1316
161 Ga0207641_10002224 3300026088 Bacteria 18198
162 Ga0207641_10501227 3300026088 Bacteria 1179
163 Ga0207648_10392890 3300026089 Bacteria 1256
164 Ga0207676_10148735 3300026095 Bacteria 2014
165 Ga0207676_10501969 3300026095 Bacteria 1152
166 Ga0207675_100000240 3300026118 Bacteria 52035
167 Ga0207683_10092025 3300026121 Bacteria 2702
168 Ga0207698_10069920 3300026142 Bacteria 2779
169 Ga0207428_10010430 3300027907 Bacteria 8299
170 Ga0268266_10008778 3300028379 Bacteria 8958
171 Ga0268266_10539576 3300028379 Bacteria 1116
172 Ga0268264_10003619 3300028381 Bacteria 13291
173 Ga0268264_10016974 3300028381 Bacteria 5960
174 Ga0265338_10020019 3300028800 Bacteria 7060
175 Ga0265325_10006615 3300031241 Bacteria 7019
176 Ga0265313_10013030 3300031595 Bacteria 5025
177 Ga0307413_10073865 3300031824 Bacteria 2157
178 Ga0307406_10277092 3300031901 Bacteria 1277
179 Ga0307409_100018006 3300031995 Bacteria 4730
180 Ga0307416_100002471 3300032002 Bacteria 10625
181 Ga0307416_100013175 3300032002 Bacteria 5611
182 Ga0307414_10312008 3300032004 Bacteria 1335
183 Ga0307411_10145107 3300032005 Bacteria 1756
184 Ga0373926_0113221 3300035083 Bacteria 1020
185 Ga0373953_0073020 3300035117 Bacteria 1418
186 Ga0373943_0022050 3300035170 Bacteria 2946
187 Ga0373943_0048962 3300035170 Bacteria 2073
188 Ga0373943_0120035 3300035170 Bacteria 1396
189 Ga0373946_0024552 3300035171 Bacteria 2363
190 Ga0373946_0026648 3300035171 Bacteria 2282
191 Ga0373931_0032911 3300035691 Bacteria 2685
192 Ga0373935_0045349 3300035692 Bacteria 2774
193 Ga0373935_0056849 3300035692 Bacteria 2495
194 Ga0373947_0023013 3300035725 Bacteria 3621
195 Ga0373937_0624496 3300036401 Bacteria 1022
196 Ga0373925_0020089 3300037068 Bacteria 4861
197 Ga0395899_0063572 3300037312 Bacteria 2715
198 Ga0395900_0002772 3300037418 Bacteria 19155
199 Ga0395898_0003463 3300037466 Bacteria 17637
200 Ga0395905_0080301 3300037471 Bacteria 3056
201 Ga0436364_0200832 3300037853 Bacteria 50854
202 Ga0395901_0002059 3300038443 Bacteria 20616
203 Ga0439435_0005083 3300042436 Bacteria 2875
204 Ga0451577_0122815 3300042876 Bacteria 2326
205 Ga0453683_0000108 3300044673 Bacteria 124178
206 Ga0453683_0000260 3300044673 Bacteria 69441
207 Ga0453683_0009071 3300044673 Bacteria 6643
208 Ga0466961_0147442 3300044693 Bacteria 1471
209 Ga0453684_0002925 3300044712 Bacteria 40026
210 Ga0453684_0017930 3300044712 Bacteria 10914
211 Ga0453684_0067595 3300044712 Bacteria 4544
212 Ga0453684_0139128 3300044712 Bacteria 2902
213 Ga0453684_0202576 3300044712 Bacteria 2312
214 Ga0453684_0873748 3300044712 Bacteria 965
215 Ga0451576_0028167 3300045051 Bacteria 6023
216 Ga0451576_0035401 3300045051 Bacteria 5297
217 Ga0451576_0309746 3300045051 Bacteria 1652
218 Ga0495629_0000576 3300046459 Bacteria 29777
219 Ga0495641_0107717 3300046461 Bacteria 1243
220 Ga0495580_0029123 3300046472 Bacteria 4009
221 Ga0495582_0021242 3300046473 Bacteria 3554
222 Ga0495618_0007006 3300046514 Bacteria 6830
223 Ga0495628_0071511 3300046516 Bacteria 2704
224 Ga0495630_0012453 3300046517 Bacteria 6175
225 Ga0495630_0118166 3300046517 Bacteria 2011
226 Ga0495652_0366244 3300046529 Bacteria 1028
227 Ga0495665_0101972 3300046531 Bacteria 1506
228 Ga0495640_0000157 3300046533 Bacteria 43506
229 Ga0495640_0146548 3300046533 Bacteria 1519
230 Ga0495586_0014647 3300046535 Bacteria 4168
231 Ga0495598_0056515 3300046537 Bacteria 1198
232 Ga0495667_0035163 3300046559 Bacteria 3349
233 Ga0495634_0020113 3300046642 Bacteria 4736
234 Ga0495634_0254701 3300046642 Bacteria 1072
235 Ga0495658_0052296 3300046683 Bacteria 2316
236 Ga0495658_0108672 3300046683 Bacteria 1665
237 Ga0495613_0078457 3300046689 Bacteria 2402
238 Ga0495624_0341849 3300046690 Bacteria 900
239 Ga0495600_0010701 3300046809 Bacteria 5702
240 Ga0495581_0010514 3300047315 Bacteria 5350
241 Ga0495674_0000289 3300047319 Bacteria 43526
242 Ga0495674_0237774 3300047319 Bacteria 1502
243 Ga0495674_0543302 3300047319 Bacteria 926
244 Ga0495676_0049868 3300047321 Bacteria 3362
245 Ga0495684_0001056 3300047471 Bacteria 22299
246 Ga0495684_0030972 3300047471 Bacteria 4107
247 Ga0496100_0222283 3300048903 Bacteria 1386
248 Ga0496101_0015299 3300048904 Bacteria 5167
249 Ga0496102_0159795 3300048905 Bacteria 2119
250 Ga0496103_0010526 3300048906 Bacteria 5475
251 Ga0496104_0013057 3300048907 Bacteria 7480
252 Ga0496105_0029233 3300048908 Bacteria 4510
253 Ga0496105_0137884 3300048908 Bacteria 2009
254 Ga0496106_0036662 3300048909 Bacteria 3667
255 Ga0496107_0254580 3300048910 Bacteria 1306
256 Ga0496108_0003797 3300048911 Bacteria 12091
257 Ga0496109_0001223 3300048912 Bacteria 21333
258 Ga0496109_0008561 3300048912 Bacteria 8704
259 Ga0496110_0011241 3300048913 Bacteria 7317
260 Ga0496111_0007455 3300048914 Bacteria 7173
261 Ga0496112_0159986 3300048915 Bacteria 2218
262 Ga0496113_0000569 3300048916 Bacteria 18382
263 Ga0496114_0124408 3300048917 Bacteria 2221
264 Ga0501031_0004522 3300049568 Bacteria 9010
265 Ga0501031_0023100 3300049568 Bacteria 4056
266 Ga0501031_0025328 3300049568 Bacteria 3871
267 Ga0501032_0002333 3300049569 Bacteria 14885
268 Ga0501032_0189770 3300049569 Bacteria 1343
269 Ga0501032_0207959 3300049569 Bacteria 1276
270 Ga0501033_0004749 3300049570 Bacteria 10872
271 Ga0501034_0210984 3300049571 Bacteria 1897
272 Ga0501034_0337377 3300049571 Bacteria 1438
273 Ga0501034_0376493 3300049571 Bacteria 1345
274 Ga0501036_0028550 3300049572 Bacteria 4714
275 Ga0501037_0002744 3300049573 Bacteria 12736
276 Ga0501037_0093130 3300049573 Bacteria 2179
277 Ga0501038_0002267 3300049574 Bacteria 17894
278 Ga0501038_0077990 3300049574 Bacteria 2796
279 Ga0501038_0084166 3300049574 Bacteria 2676
280 Ga0501038_0325340 3300049574 Bacteria 1202
281 Ga0501039_0006496 3300049575 Bacteria 8891
282 Ga0501039_0049119 3300049575 Bacteria 3261
283 Ga0501039_0064746 3300049575 Bacteria 2834
284 Ga0501040_0000090 3300049576 Bacteria 44991
285 Ga0501040_0035737 3300049576 Bacteria 3370
286 Ga0501040_0373981 3300049576 Bacteria 1022
287 Ga0501041_0000859 3300049577 Bacteria 16371
288 Ga0501041_0021082 3300049577 Bacteria 3903
289 Ga0501042_0001763 3300049578 Bacteria 12952
290 Ga0501042_0023469 3300049578 Bacteria 4317
291 Ga0501042_0046044 3300049578 Bacteria 3109
292 Ga0501043_0010919 3300049579 Bacteria 7114
293 Ga0501043_0089487 3300049579 Bacteria 2419
294 Ga0501043_0161315 3300049579 Bacteria 1751
295 Ga0501043_0379208 3300049579 Bacteria 1071
296 Ga0501046_0000691 3300049580 Bacteria 32754
297 Ga0501046_0014803 3300049580 Bacteria 6567
298 Ga0501046_0015779 3300049580 Bacteria 6338
299 Ga0501046_0121136 3300049580 Bacteria 1990
300 Ga0501046_0189431 3300049580 Bacteria 1535
301 Ga0501047_0292285 3300049581 Bacteria 1473
302 Ga0501048_0018798 3300049582 Bacteria 5080
303 Ga0501048_0024471 3300049582 Bacteria 4407
304 Ga0501048_0256561 3300049582 Bacteria 1242
305 Ga0501068_0003095 3300049584 Bacteria 8881
306 Ga0501068_0006080 3300049584 Bacteria 6635
307 Ga0501068_0031943 3300049584 Bacteria 3129
308 Ga0501069_0004609 3300049585 Bacteria 7130
309 Ga0501070_0005557 3300049586 Bacteria 10751
310 Ga0501070_0070779 3300049586 Bacteria 2888
311 Ga0501070_0083638 3300049586 Bacteria 2642
312 Ga0501070_0114793 3300049586 Bacteria 2225
313 Ga0501071_0000618 3300049587 Bacteria 18442
314 Ga0501071_0027776 3300049587 Bacteria 3983
315 Ga0501071_0208632 3300049587 Bacteria 1469
316 Ga0501072_0000127 3300049588 Bacteria 56633
317 Ga0501072_0007882 3300049588 Bacteria 8088
318 Ga0501072_0060561 3300049588 Bacteria 2984
319 Ga0501072_0489462 3300049588 Bacteria 973
320 Ga0501073_0007327 3300049589 Bacteria 8208
321 Ga0501073_0033992 3300049589 Bacteria 3630
322 Ga0501073_0076007 3300049589 Bacteria 2338
323 Ga0501074_0004776 3300049590 Bacteria 9717
324 Ga0501074_0064666 3300049590 Bacteria 2633
325 Ga0501074_0121908 3300049590 Bacteria 1865
326 Ga0501075_0000244 3300049591 Bacteria 29171
327 Ga0501075_0019247 3300049591 Bacteria 4950
328 Ga0501075_0056211 3300049591 Bacteria 2962
329 Ga0501075_0080010 3300049591 Bacteria 2473
330 Ga0501075_0108454 3300049591 Bacteria 2111
331 Ga0501075_0341870 3300049591 Bacteria 1140
332 Ga0501076_0000113 3300049592 Bacteria 44744
333 Ga0501076_0025869 3300049592 Bacteria 4543
334 Ga0501076_0274985 3300049592 Bacteria 1379
335 Ga0501077_0000098 3300049593 Bacteria 45623
336 Ga0501077_0005544 3300049593 Bacteria 7680
337 Ga0501077_0064602 3300049593 Bacteria 2321
338 Ga0501209_058482 3300049656 Bacteria 1070
339 Ga0501079_0000236 3300049741 Bacteria 33099
340 Ga0501079_0037094 3300049741 Bacteria 3755
341 Ga0501079_0136363 3300049741 Bacteria 1911
342 Ga0501079_0205614 3300049741 Bacteria 1538
343 Ga0501079_0238198 3300049741 Bacteria 1421
344 Ga0501080_0000188 3300049742 Bacteria 45004
345 Ga0501080_0019222 3300049742 Bacteria 6326
346 Ga0501080_0029165 3300049742 Bacteria 5137
347 Ga0501080_0202368 3300049742 Bacteria 1823
348 Ga0501080_0202866 3300049742 Bacteria 1820
349 Ga0501081_0000817 3300049743 Bacteria 18384
350 Ga0501081_0001979 3300049743 Bacteria 12764
351 Ga0501081_0120138 3300049743 Bacteria 1871
352 Ga0501081_0151144 3300049743 Bacteria 1668
353 Ga0501081_0156412 3300049743 Bacteria 1640
354 Ga0501083_0001925 3300049744 Bacteria 14271
355 Ga0501083_0007703 3300049744 Bacteria 7636
356 Ga0501083_0008131 3300049744 Bacteria 7420
357 Ga0501035_0016570 3300049822 Bacteria 6795
358 Ga0501035_0018132 3300049822 Bacteria 6486
359 Ga0501044_0013454 3300049823 Bacteria 8849
360 Ga0501045_0001007 3300049824 Bacteria 18491
361 Ga0501045_0002572 3300049824 Bacteria 12375
362 Ga0501045_0037886 3300049824 Bacteria 3506
363 nmdc:mga05p37_61116_c1 3300050507 Bacteria 4638
364 nmdc:mga06r32_62650_c1 3300050510 Bacteria 3583
365 nmdc:mga08y16_201002_c1 3300050511 Bacteria 2065
366 nmdc:mga08y16_304330_c1 3300050511 Bacteria 1643
367 nmdc:mga08y16_39270_c1 3300050511 Bacteria 4967
368 Ga0495601_0000139 3300053077 Bacteria 41000
369 Ga0495601_0057672 3300053077 Bacteria 2460
370 Ga0495612_0012576 3300053078 Bacteria 3411
371 Ga0495595_0001756 3300053084 Bacteria 8472
372 Ga0495619_0000221 3300053085 Bacteria 41281
373 Ga0495619_0010541 3300053085 Bacteria 5815
374 Ga0501084_0002315 3300054114 Bacteria 15297
375 Ga0501084_0005989 3300054114 Bacteria 10003
376 Ga0501084_0032891 3300054114 Bacteria 4339
377 Ga0501084_0102017 3300054114 Bacteria 2410
378 Ga0501084_0253498 3300054114 Bacteria 1485
379 Ga0590075_023535 3300059424 Bacteria 1544
380 Ga0590077_024742 3300059426 Bacteria 1291
381 Ga0501082_0000425 3300060353 Bacteria 37364
382 Ga0501082_0011730 3300060353 Bacteria 7534
383 Ga0501082_0132957 3300060353 Bacteria 2158
384 Ga0501082_0222079 3300060353 Bacteria 1644
385 Ga0530510_0000379 3300061734 Bacteria 28916
386 Ga0530510_0035930 3300061734 Bacteria 3571
387 Ga0530510_0045468 3300061734 Bacteria 3172
388 Ga0530510_0100995 3300061734 Bacteria 2109
389 Ga0530510_0123584 3300061734 Bacteria 1901
390 2511178492 2510917027 Bacteria 5287437
391 2556064729 2554235469 Bacteria 3590176
392 2587744430 2585428059 Bacteria 8696589
393 2712196731 2711768088 Bacteria 3195027
394 2819568539 2818991441 Bacteria 5062707
395 2857467721 2857465823 Bacteria 6772595
396 2857477672 2857472729 Bacteria 6568124
397 2857594754 2857591370 Bacteria 6569758
398 2883292952 2883291878 Bacteria 5894118
399 2883355895 2883354860 Bacteria 5865246
400 2915597413 2915597211 Bacteria 6475886
401 2915611370 2915606848 Bacteria 6032732
402 2929188865 2929183550 Bacteria 6377511
403 2936366726 2936361878 Bacteria 5632809
404 2956899774 2956897341 Bacteria 5447711
405 Ga0070665_100023602
406 JGI25151J46595_10053040
407 Ga0055532_1001941
408 Ga0070658_10077957
409 Ga0070676_10057538
410 Ga0070690_100209101
411 Ga0070670_100002715
412 Ga0070670_100030100
413 Ga0070670_100119638
414 Ga0070677_10002038
415 Ga0070666_10019327
416 Ga0068868_100215580
417 Ga0070660_100156321
418 Ga0070689_100009913
419 Ga0070661_100020109
420 Ga0070668_100011523
421 Ga0070669_100324247
422 Ga0070688_100084888
423 Ga0070659_100017342
424 Ga0070667_100026448
425 Ga0070667_100681705
426 Ga0070713_100818890
427 Ga0070710_10040819
428 Ga0070701_10014105
429 Ga0070700_100236707
430 Ga0070708_100183873
431 Ga0070708_100577638
432 Ga0070663_100027079
433 Ga0070662_100067717
434 Ga0070681_10009653
435 Ga0070681_10390237
436 Ga0070706_100051938
437 Ga0070699_100006657
438 Ga0070684_100114488
439 Ga0070684_100121167
440 Ga0070697_100255815
441 Ga0070695_100023430
442 Ga0070696_100023289
443 Ga0068855_100071246
444 Ga0068855_100355262
445 Ga0070664_100104667
446 Ga0070664_100168481
447 Ga0070664_100311600
448 Ga0068854_100257282
449 Ga0068854_100564544
450 Ga0068856_100650055
451 Ga0070702_100022865
452 Ga0068852_100004945
453 Ga0068864_100035110
454 Ga0068861_100019025
455 Ga0068861_100156549
456 Ga0068870_10012805
457 Ga0068863_100030269
458 Ga0068858_100029634
459 Ga0068858_100597984
460 Ga0068860_100016393
461 Ga0068860_100023587
462 Ga0068860_100082323
463 Ga0068862_100284124
464 Ga0081455_10009711
465 Ga0081538_10008392
466 Ga0081538_10034292
467 Ga0070716_100415095
468 Ga0070712_100001328
469 Ga0070712_100448325
470 Ga0068871_100510431
471 Ga0075431_100032266
472 Ga0075429_100067027
473 Ga0068865_100015475
474 Ga0068865_100095714
475 Ga0068865_100158230
476 Ga0075435_100684155
477 Ga0105240_10014072
478 Ga0105240_10706943
479 Ga0111539_10007804
480 Ga0111539_10028521
481 Ga0111539_10129488
482 Ga0105247_10094899
483 Ga0114129_10005844
484 Ga0114129_10023428
485 Ga0114129_10133807
486 Ga0105243_10393592
487 Ga0105242_10181877
488 Ga0105242_10217109
489 Ga0105248_10422742
490 Ga0105238_10065016
491 Ga0105238_10290746
492 Ga0105249_10017881
493 Ga0105249_10091762
494 Ga0105246_10024022
495 Ga0157369_10003928
496 Ga0157374_10031842
497 Ga0157374_10243007
498 Ga0157378_10031296
499 Ga0157378_10139619
500 Ga0163162_10024055
501 Ga0163162_10354813
502 Ga0157372_10005735
503 Ga0163163_10029356
504 Ga0163163_10176180
505 Ga0157380_10199538
506 Ga0157377_10019019
507 Ga0157379_10040994
508 Ga0157379_10058745
509 Ga0157376_10253280
510 Ga0157376_10302780
511 Ga0206353_11863937
512 Ga0213875_10013664
513 Ga0209147_100098
514 Ga0209130_1004613
515 Ga0209675_1040323
516 Ga0209025_1004474
517 Ga0207697_10000400
518 Ga0207682_10015988
519 Ga0207688_10000843
520 Ga0207680_10020288
521 Ga0207645_10002410
522 Ga0207643_10000308
523 Ga0207705_10047464
524 Ga0207684_10092426
525 Ga0207707_10055600
526 Ga0207707_10292232
527 Ga0207695_10058767
528 Ga0207693_10007865
529 Ga0207657_10055444
530 Ga0207649_10051863
531 Ga0207649_10097260
532 Ga0207652_10081002
533 Ga0207652_10549471
534 Ga0207646_10265361
535 Ga0207694_10112907
536 Ga0207650_10005185
537 Ga0207650_10063725
538 Ga0207650_10094621
539 Ga0207650_10206009
540 Ga0207644_10072791
541 Ga0207644_10100084
542 Ga0207690_10069993
543 Ga0207690_10469353
544 Ga0207706_10002572
545 Ga0207706_10251879
546 Ga0207670_10011130
547 Ga0207669_10071996
548 Ga0207704_10130622
549 Ga0207704_10186435
550 Ga0207691_10009613
551 Ga0207689_10000892
552 Ga0207679_10090531
553 Ga0207667_10083083
554 Ga0207712_10388573
555 Ga0207668_10039103
556 Ga0207668_10209701
557 Ga0207640_10297514
558 Ga0207658_10009365
559 Ga0207703_10013217
560 Ga0207703_10122391
561 Ga0207703_10128690
562 Ga0207678_10001523
563 Ga0207708_10001590
564 Ga0207708_10295720
565 Ga0207641_10002224
566 Ga0207641_10501227
567 Ga0207648_10392890
568 Ga0207676_10148735
569 Ga0207676_10501969
570 Ga0207675_100000240
571 Ga0207683_10092025
572 Ga0207698_10069920
573 Ga0207428_10010430
574 Ga0268266_10008778
575 Ga0268266_10539576
576 Ga0268264_10003619
577 Ga0268264_10016974
578 Ga0265338_10020019
579 Ga0265325_10006615
580 Ga0265313_10013030
581 Ga0307413_10073865
582 Ga0307406_10277092
583 Ga0307409_100018006
584 Ga0307416_100002471
585 Ga0307416_100013175
586 Ga0307414_10312008
587 Ga0307411_10145107
588 Ga0373926_0113221
589 Ga0373953_0073020
590 Ga0373943_0022050
591 Ga0373943_0048962
592 Ga0373943_0120035
593 Ga0373946_0024552
594 Ga0373946_0026648
595 Ga0373931_0032911
596 Ga0373935_0045349
597 Ga0373935_0056849
598 Ga0373947_0023013
599 Ga0373937_0624496
600 Ga0373925_0020089
601 Ga0395899_0063572
602 Ga0395900_0002772
603 Ga0395898_0003463
604 Ga0395905_0080301
605 Ga0436364_0200832
606 Ga0395901_0002059
607 Ga0439435_0005083
608 Ga0451577_0122815
609 Ga0453683_0000108
610 Ga0453683_0000260
611 Ga0453683_0009071
612 Ga0466961_0147442
613 Ga0453684_0002925
614 Ga0453684_0017930
615 Ga0453684_0067595
616 Ga0453684_0139128
617 Ga0453684_0202576
618 Ga0453684_0873748
619 Ga0451576_0028167
620 Ga0451576_0035401
621 Ga0451576_0309746
622 Ga0495629_0000576
623 Ga0495641_0107717
624 Ga0495580_0029123
625 Ga0495582_0021242
626 Ga0495618_0007006
627 Ga0495628_0071511
628 Ga0495630_0012453
629 Ga0495630_0118166
630 Ga0495652_0366244
631 Ga0495665_0101972
632 Ga0495640_0000157
633 Ga0495640_0146548
634 Ga0495586_0014647
635 Ga0495598_0056515
636 Ga0495667_0035163
637 Ga0495634_0020113
638 Ga0495634_0254701
639 Ga0495658_0052296
640 Ga0495658_0108672
641 Ga0495613_0078457
642 Ga0495624_0341849
643 Ga0495600_0010701
644 Ga0495581_0010514
645 Ga0495674_0000289
646 Ga0495674_0237774
647 Ga0495674_0543302
648 Ga0495676_0049868
649 Ga0495684_0001056
650 Ga0495684_0030972
651 Ga0496100_0222283
652 Ga0496101_0015299
653 Ga0496102_0159795
654 Ga0496103_0010526
655 Ga0496104_0013057
656 Ga0496105_0029233
657 Ga0496105_0137884
658 Ga0496106_0036662
659 Ga0496107_0254580
660 Ga0496108_0003797
661 Ga0496109_0001223
662 Ga0496109_0008561
663 Ga0496110_0011241
664 Ga0496111_0007455
665 Ga0496112_0159986
666 Ga0496113_0000569
667 Ga0496114_0124408
668 Ga0501031_0004522
669 Ga0501031_0023100
670 Ga0501031_0025328
671 Ga0501032_0002333
672 Ga0501032_0189770
673 Ga0501032_0207959
674 Ga0501033_0004749
675 Ga0501034_0210984
676 Ga0501034_0337377
677 Ga0501034_0376493
678 Ga0501036_0028550
679 Ga0501037_0002744
680 Ga0501037_0093130
681 Ga0501038_0002267
682 Ga0501038_0077990
683 Ga0501038_0084166
684 Ga0501038_0325340
685 Ga0501039_0006496
686 Ga0501039_0049119
687 Ga0501039_0064746
688 Ga0501040_0000090
689 Ga0501040_0035737
690 Ga0501040_0373981
691 Ga0501041_0000859
692 Ga0501041_0021082
693 Ga0501042_0001763
694 Ga0501042_0023469
695 Ga0501042_0046044
696 Ga0501043_0010919
697 Ga0501043_0089487
698 Ga0501043_0161315
699 Ga0501043_0379208
700 Ga0501046_0000691
701 Ga0501046_0014803
702 Ga0501046_0015779
703 Ga0501046_0121136
704 Ga0501046_0189431
705 Ga0501047_0292285
706 Ga0501048_0018798
707 Ga0501048_0024471
708 Ga0501048_0256561
709 Ga0501068_0003095
710 Ga0501068_0006080
711 Ga0501068_0031943
712 Ga0501069_0004609
713 Ga0501070_0005557
714 Ga0501070_0070779
715 Ga0501070_0083638
716 Ga0501070_0114793
717 Ga0501071_0000618
718 Ga0501071_0027776
719 Ga0501071_0208632
720 Ga0501072_0000127
721 Ga0501072_0007882
722 Ga0501072_0060561
723 Ga0501072_0489462
724 Ga0501073_0007327
725 Ga0501073_0033992
726 Ga0501073_0076007
727 Ga0501074_0004776
728 Ga0501074_0064666
729 Ga0501074_0121908
730 Ga0501075_0000244
731 Ga0501075_0019247
732 Ga0501075_0056211
733 Ga0501075_0080010
734 Ga0501075_0108454
735 Ga0501075_0341870
736 Ga0501076_0000113
737 Ga0501076_0025869
738 Ga0501076_0274985
739 Ga0501077_0000098
740 Ga0501077_0005544
741 Ga0501077_0064602
742 Ga0501209_058482
743 Ga0501079_0000236
744 Ga0501079_0037094
745 Ga0501079_0136363
746 Ga0501079_0205614
747 Ga0501079_0238198
748 Ga0501080_0000188
749 Ga0501080_0019222
750 Ga0501080_0029165
751 Ga0501080_0202368
752 Ga0501080_0202866
753 Ga0501081_0000817
754 Ga0501081_0001979
755 Ga0501081_0120138
756 Ga0501081_0151144
757 Ga0501081_0156412
758 Ga0501083_0001925
759 Ga0501083_0007703
760 Ga0501083_0008131
761 Ga0501035_0016570
762 Ga0501035_0018132
763 Ga0501044_0013454
764 Ga0501045_0001007
765 Ga0501045_0002572
766 Ga0501045_0037886
767 nmdc:mga05p37_61116_c1
768 nmdc:mga06r32_62650_c1
769 nmdc:mga08y16_201002_c1
770 nmdc:mga08y16_304330_c1
771 nmdc:mga08y16_39270_c1
772 Ga0495601_0000139
773 Ga0495601_0057672
774 Ga0495612_0012576
775 Ga0495595_0001756
776 Ga0495619_0000221
777 Ga0495619_0010541
778 Ga0501084_0002315
779 Ga0501084_0005989
780 Ga0501084_0032891
781 Ga0501084_0102017
782 Ga0501084_0253498
783 Ga0590075_023535
784 Ga0590077_024742
785 Ga0501082_0000425
786 Ga0501082_0011730
787 Ga0501082_0132957
788 Ga0501082_0222079
789 Ga0530510_0000379
790 Ga0530510_0035930
791 Ga0530510_0045468
792 Ga0530510_0100995
793 Ga0530510_0123584
794 2511178492
795 2556064729
796 2587744430
797 2712196731
798 2819568539
799 2857467721
800 2857477672
801 2857594754
802 2883292952
803 2883355895
804 2915597413
805 2915611370
806 2929188865
807 2936366726
808 2956899774

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

56

218

0.93

PF13476

AAA_23

AAA domain

51

153

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9585 13 259
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9466 13 259
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.94 13 248
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9387 11 249
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9379 11 249
ID Description Score Start End Superfamily
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9522 12 261 3.40.50.300
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9448 12 261 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.941 11 243 3.40.50.300
af_Q57554_4_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9407 12 258 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9394 13 243 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A562CLP5-F1-model_v4 Branched-chain amino acid transport system permease protein 0.97 10 263 GO:0005524
GO:0005886
GO:0015658
GO:0016887
AF-B3V6F8-F1-model_v4 Molybdate/tungstate import ATP-binding protein WtpC (EC 7.3.2.6) 0.9601 10 240 GO:0005524
GO:0016887
AF-A0A7W5HZD3-F1-model_v4 deleted 0.9594 13 248
AF-A0A7W3T3T6-F1-model_v4 ATP-binding cassette domain-containing protein 0.9563 14 262 GO:0005524
GO:0005886
GO:0016887
AF-A0A351C2K6-F1-model_v4 LPS export ABC transporter ATP-binding protein 0.9536 13 261 GO:0005524
GO:0016887
GO:0043190
GO:0055085

Map