F435597

General Info

Members Datasets Scaffolds Average Seq Length
404 218 808 123

Family's Representative Sequence

Representative Sequence 3300005343|Ga0070687_100712650|Ga0070687_1007126501
Length 132
Sequence MRGGRRPRLASIAIFEYYSLPVGELQTFKAQFFRALAHPVRIRILEILVRGGRTVQELQEALTLDQPIVSQQLAVLRNQGIVASRKQGLSVRYALRDPLVGTLLDVARQIFDNQLGTSRGLLRELRRERRRG

Samples

Sample ID Description Type Environment
1 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
137 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
138 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
139 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
140 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
141 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
142 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
143 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
144 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
145 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
155 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
156 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
157 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
158 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
159 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
160 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
161 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
165 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
166 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
167 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
168 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
169 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
170 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
171 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
172 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
173 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
176 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
186 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
187 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
190 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
191 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
192 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
193 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
194 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
195 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
196 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
197 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
198 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
199 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
202 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
203 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
204 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
209 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
214 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
215 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
218 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.25
Rhizosphere 99.75
Stem 0
Stem Tuber 0
Unclassified 24.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070687_100712650 3300005343 Bacteria 702
2 SwRhRL2b_contig_710807 2162886007 Unclassified 1057
3 MBSR1b_contig_4074373 2162886012 Bacteria 1595
4 MBSR1b_contig_7300111 2162886012 Bacteria 981
5 MBSR1b_contig_8117833 2162886012 Bacteria 823
6 MBSR1b_contig_8669839 2162886012 Bacteria 1706
7 MBSR1b_contig_9742135 2162886012 Unclassified 1444
8 Ga0065704_10101459 3300005289 Bacteria 2237
9 Ga0065704_10276141 3300005289 Bacteria 932
10 Ga0065712_10461777 3300005290 Unclassified 677
11 Ga0065715_10089829 3300005293 Bacteria 8389
12 Ga0065715_10104911 3300005293 Bacteria 2927
13 Ga0065707_10000927 3300005295 Bacteria 10729
14 Ga0065707_10007718 3300005295 Bacteria 3476
15 Ga0065707_10136162 3300005295 Bacteria 1838
16 Ga0065707_10494468 3300005295 Bacteria 762
17 Ga0070676_11028219 3300005328 Unclassified 620
18 Ga0070690_101724935 3300005330 Unclassified 509
19 Ga0070677_10105876 3300005333 Unclassified 1248
20 Ga0068869_100266099 3300005334 Unclassified 1374
21 Ga0070666_10809212 3300005335 Bacteria 690
22 Ga0070680_100047621 3300005336 Bacteria 3491
23 Ga0070680_101607684 3300005336 Bacteria 563
24 Ga0070682_101611817 3300005337 Bacteria 561
25 Ga0070660_100334152 3300005339 Bacteria 1246
26 Ga0070689_100656487 3300005340 Unclassified 913
27 Ga0070692_10007824 3300005345 Bacteria 4734
28 Ga0070692_11122301 3300005345 Bacteria 556
29 Ga0070668_100663480 3300005347 Bacteria 917
30 Ga0070668_100984683 3300005347 Bacteria 757
31 Ga0070669_100007872 3300005353 Bacteria 7618
32 Ga0070669_100018495 3300005353 Bacteria 4980
33 Ga0070675_100007917 3300005354 Bacteria 8238
34 Ga0070675_100011663 3300005354 Bacteria 6887
35 Ga0070675_100226146 3300005354 Bacteria 1631
36 Ga0070675_100951045 3300005354 Bacteria 788
37 Ga0070671_100201079 3300005355 Bacteria 1689
38 Ga0070673_100335599 3300005364 Bacteria 1338
39 Ga0070688_100021644 3300005365 Bacteria 3758
40 Ga0070659_100431665 3300005366 Unclassified 1115
41 Ga0070667_101844956 3300005367 Bacteria 569
42 Ga0070667_102069085 3300005367 Unclassified 536
43 Ga0070701_10003949 3300005438 Bacteria 5931
44 Ga0070711_100811179 3300005439 Bacteria 794
45 Ga0070705_100027173 3300005440 Bacteria 3122
46 Ga0070705_100196238 3300005440 Unclassified 1380
47 Ga0070700_100031624 3300005441 Bacteria 3173
48 Ga0070694_100071255 3300005444 Bacteria 2395
49 Ga0070694_100100579 3300005444 Bacteria 2045
50 Ga0070694_100290296 3300005444 Bacteria 1250
51 Ga0070694_100385254 3300005444 Unclassified 1094
52 Ga0070678_101593011 3300005456 Bacteria 613
53 Ga0070662_100235877 3300005457 Unclassified 1465
54 Ga0070662_100622139 3300005457 Bacteria 909
55 Ga0070681_10113963 3300005458 Bacteria 2642
56 Ga0070681_10392949 3300005458 Bacteria 1298
57 Ga0068867_100002978 3300005459 Bacteria 11940
58 Ga0070685_10127891 3300005466 Bacteria 1585
59 Ga0070706_100443299 3300005467 Bacteria 1208
60 Ga0070707_100023499 3300005468 Bacteria 5831
61 Ga0070707_100134806 3300005468 Bacteria 2402
62 Ga0070698_100273619 3300005471 Bacteria 1620
63 Ga0070698_100987266 3300005471 Unclassified 789
64 Ga0070699_100037501 3300005518 Bacteria 4196
65 Ga0070697_100013508 3300005536 Bacteria 6406
66 Ga0070672_100110233 3300005543 Bacteria 2242
67 Ga0070672_100668087 3300005543 Unclassified 908
68 Ga0070686_100116395 3300005544 Bacteria 1829
69 Ga0070695_100142406 3300005545 Bacteria 1664
70 Ga0070695_101310584 3300005545 Bacteria 598
71 Ga0070695_101423578 3300005545 Bacteria 575
72 Ga0070695_101707932 3300005545 Bacteria 527
73 Ga0070696_100313896 3300005546 Unclassified 1204
74 Ga0070696_101128138 3300005546 Bacteria 660
75 Ga0070696_101678562 3300005546 Unclassified 547
76 Ga0070704_100010151 3300005549 Bacteria 5726
77 Ga0070704_100031896 3300005549 Bacteria 3548
78 Ga0070704_101529195 3300005549 Unclassified 614
79 Ga0070664_101491205 3300005564 Bacteria 640
80 Ga0068857_100006691 3300005577 Bacteria 9909
81 Ga0068857_100889439 3300005577 Unclassified 854
82 Ga0068856_100369004 3300005614 Bacteria 1454
83 Ga0068856_101835294 3300005614 Unclassified 618
84 Ga0068856_102270377 3300005614 Bacteria 551
85 Ga0068852_100131039 3300005616 Bacteria 2309
86 Ga0068859_100009052 3300005617 Bacteria 10059
87 Ga0068859_100217466 3300005617 Unclassified 1998
88 Ga0068864_101944005 3300005618 Bacteria 594
89 Ga0068866_10254481 3300005718 Bacteria 1076
90 Ga0068861_100007731 3300005719 Bacteria 7383
91 Ga0068870_10037442 3300005840 Bacteria 2500
92 Ga0068858_100128233 3300005842 Bacteria 2377
93 Ga0068860_100018197 3300005843 Bacteria 6839
94 Ga0068860_100931373 3300005843 Bacteria 885
95 Ga0068862_100003827 3300005844 Bacteria 12815
96 Ga0068862_100760818 3300005844 Bacteria 943
97 Ga0068862_101577252 3300005844 Bacteria 663
98 Ga0070716_100544109 3300006173 Unclassified 864
99 Ga0075428_100004423 3300006844 Bacteria 15517
100 Ga0075428_100494057 3300006844 Unclassified 1309
101 Ga0075428_100611774 3300006844 Bacteria 1163
102 Ga0075428_101155214 3300006844 Bacteria 817
103 Ga0075428_101286577 3300006844 Bacteria 769
104 Ga0075428_102522869 3300006844 Bacteria 526
105 Ga0075430_100002771 3300006846 Bacteria 14643
106 Ga0075431_100009903 3300006847 Bacteria 9571
107 Ga0075431_100237984 3300006847 Unclassified 1853
108 Ga0075433_10036795 3300006852 Bacteria 4219
109 Ga0075433_10162734 3300006852 Unclassified 1986
110 Ga0075433_11343315 3300006852 Bacteria 619
111 Ga0075433_11376873 3300006852 Bacteria 610
112 Ga0075434_100024484 3300006871 Bacteria 5901
113 Ga0075434_100171858 3300006871 Bacteria 2187
114 Ga0075434_100244879 3300006871 Unclassified 1813
115 Ga0075434_100871631 3300006871 Bacteria 915
116 Ga0075434_101579161 3300006871 Unclassified 665
117 Ga0075434_101853473 3300006871 Unclassified 609
118 Ga0075429_100060073 3300006880 Bacteria 3312
119 Ga0075436_100735394 3300006914 Unclassified 732
120 Ga0097620_100009052 3300006931 Bacteria 10059
121 Ga0097620_100217478 3300006931 Unclassified 1998
122 Ga0075435_100003559 3300007076 Bacteria 10579
123 Ga0075435_100064071 3300007076 Unclassified 2986
124 Ga0105240_10254635 3300009093 Bacteria 2028
125 Ga0111539_10001431 3300009094 Bacteria 31830
126 Ga0111539_10004622 3300009094 Bacteria 17970
127 Ga0111539_10005230 3300009094 Bacteria 16809
128 Ga0111539_10022282 3300009094 Bacteria 7786
129 Ga0111539_10024996 3300009094 Bacteria 7319
130 Ga0111539_10122872 3300009094 Unclassified 3043
131 Ga0111539_10219524 3300009094 Bacteria 2214
132 Ga0111539_11241898 3300009094 Bacteria 865
133 Ga0105245_11191380 3300009098 Bacteria 809
134 Ga0114129_10131901 3300009147 Unclassified 3430
135 Ga0114129_10143350 3300009147 Bacteria 3273
136 Ga0114129_10176639 3300009147 Bacteria 2909
137 Ga0114129_10887641 3300009147 Bacteria 1131
138 Ga0114129_10951587 3300009147 Unclassified 1085
139 Ga0114129_12348235 3300009147 Bacteria 639
140 Ga0105243_10112555 3300009148 Bacteria 2280
141 Ga0105243_10623646 3300009148 Bacteria 1041
142 Ga0105241_11878481 3300009174 Bacteria 586
143 Ga0105248_10155999 3300009177 Unclassified 2576
144 Ga0105248_10479944 3300009177 Bacteria 1401
145 Ga0105248_13108487 3300009177 Unclassified 528
146 Ga0105237_11613892 3300009545 Bacteria 655
147 Ga0105249_10007865 3300009553 Bacteria 9287
148 Ga0105249_10013273 3300009553 Bacteria 7271
149 Ga0105249_10935289 3300009553 Bacteria 934
150 Ga0105249_11212507 3300009553 Unclassified 826
151 Ga0105246_10154058 3300011119 Bacteria 1743
152 Ga0105246_10189992 3300011119 Bacteria 1589
153 Ga0157369_11371672 3300013105 Bacteria 720
154 Ga0157378_10195187 3300013297 Bacteria 1912
155 Ga0157378_11030131 3300013297 Bacteria 858
156 Ga0157372_11522766 3300013307 Unclassified 770
157 Ga0157375_10014850 3300013308 Bacteria 6959
158 Ga0157375_10315237 3300013308 Bacteria 1728
159 Ga0157375_11085478 3300013308 Bacteria 936
160 Ga0163163_12720609 3300014325 Unclassified 552
161 Ga0157380_10520784 3300014326 Unclassified 1160
162 Ga0157380_10951562 3300014326 Bacteria 889
163 Ga0157377_10027665 3300014745 Bacteria 3047
164 Ga0157377_10078912 3300014745 Unclassified 1920
165 Ga0157377_10089891 3300014745 Bacteria 1811
166 Ga0206354_10991109 3300020081 Bacteria 771
167 Ga0207682_10243196 3300025893 Unclassified 837
168 Ga0207688_10037948 3300025901 Bacteria 2673
169 Ga0207645_10852281 3300025907 Bacteria 619
170 Ga0207643_10001372 3300025908 Bacteria 14024
171 Ga0207643_10568396 3300025908 Unclassified 728
172 Ga0207684_10386503 3300025910 Unclassified 1203
173 Ga0207654_11101395 3300025911 Bacteria 578
174 Ga0207707_11610066 3300025912 Unclassified 511
175 Ga0207695_10192456 3300025913 Bacteria 1957
176 Ga0207671_11202094 3300025914 Bacteria 593
177 Ga0207662_10018852 3300025918 Bacteria 3918
178 Ga0207649_10550043 3300025920 Unclassified 883
179 Ga0207649_11194642 3300025920 Unclassified 601
180 Ga0207652_11742216 3300025921 Unclassified 528
181 Ga0207646_10126568 3300025922 Unclassified 2297
182 Ga0207681_10038171 3300025923 Bacteria 3180
183 Ga0207681_10059300 3300025923 Bacteria 2623
184 Ga0207681_10170432 3300025923 Bacteria 1649
185 Ga0207681_10507306 3300025923 Bacteria 988
186 Ga0207650_10709176 3300025925 Bacteria 850
187 Ga0207659_10002451 3300025926 Bacteria 11063
188 Ga0207659_10008731 3300025926 Bacteria 6308
189 Ga0207659_10016324 3300025926 Bacteria 4830
190 Ga0207706_10319270 3300025933 Bacteria 1352
191 Ga0207706_10331886 3300025933 Unclassified 1323
192 Ga0207706_10348641 3300025933 Bacteria 1287
193 Ga0207709_10043651 3300025935 Unclassified 2704
194 Ga0207670_10075381 3300025936 Bacteria 2345
195 Ga0207670_10206933 3300025936 Bacteria 1494
196 Ga0207669_10350374 3300025937 Bacteria 1140
197 Ga0207704_10578154 3300025938 Bacteria 917
198 Ga0207665_10413455 3300025939 Unclassified 1029
199 Ga0207691_10105186 3300025940 Bacteria 2514
200 Ga0207691_10142816 3300025940 Bacteria 2109
201 Ga0207691_10298010 3300025940 Bacteria 1386
202 Ga0207689_10219114 3300025942 Unclassified 1572
203 Ga0207679_10029765 3300025945 Bacteria 3805
204 Ga0207679_10208858 3300025945 Bacteria 1636
205 Ga0207667_10622680 3300025949 Bacteria 1087
206 Ga0207651_10116117 3300025960 Bacteria 2020
207 Ga0207651_10177519 3300025960 Bacteria 1686
208 Ga0207651_11028947 3300025960 Unclassified 737
209 Ga0207712_10002818 3300025961 Bacteria 11133
210 Ga0207712_10499250 3300025961 Bacteria 1040
211 Ga0207668_10275116 3300025972 Bacteria 1378
212 Ga0207658_10095648 3300025986 Bacteria 2315
213 Ga0207703_10330823 3300026035 Bacteria 1397
214 Ga0207708_10056659 3300026075 Bacteria 2990
215 Ga0207702_11105784 3300026078 Bacteria 787
216 Ga0207648_10001970 3300026089 Bacteria 22417
217 Ga0207648_10121644 3300026089 Bacteria 2295
218 Ga0207648_11432769 3300026089 Bacteria 649
219 Ga0207676_10658548 3300026095 Unclassified 1011
220 Ga0207676_10845467 3300026095 Bacteria 895
221 Ga0207676_11639745 3300026095 Bacteria 641
222 Ga0207676_11868889 3300026095 Bacteria 599
223 Ga0207674_10004707 3300026116 Bacteria 16364
224 Ga0207683_10078474 3300026121 Unclassified 2926
225 Ga0207698_10029151 3300026142 Bacteria 3948
226 Ga0209968_1048408 3300027526 Bacteria 735
227 Ga0209998_10115095 3300027717 Bacteria 674
228 Ga0207428_10002913 3300027907 Bacteria 16956
229 Ga0207428_10006044 3300027907 Bacteria 11190
230 Ga0207428_10017842 3300027907 Bacteria 6083
231 Ga0207428_10023096 3300027907 Bacteria 5235
232 Ga0207428_10704036 3300027907 Bacteria 722
233 Ga0268265_10001742 3300028380 Bacteria 17503
234 Ga0268265_10276930 3300028380 Bacteria 1499
235 Ga0268265_10441237 3300028380 Bacteria 1213
236 Ga0268264_10105338 3300028381 Bacteria 2460
237 Ga0268264_11120990 3300028381 Bacteria 795
238 Ga0307405_10039378 3300031731 Bacteria 2856
239 Ga0307413_10255555 3300031824 Bacteria 1303
240 Ga0307410_11044506 3300031852 Bacteria 706
241 Ga0307409_100787689 3300031995 Bacteria 957
242 Ga0307409_100850602 3300031995 Bacteria 923
243 Ga0307416_101173940 3300032002 Bacteria 873
244 Ga0307416_101192390 3300032002 Bacteria 867
245 Ga0307416_102676003 3300032002 Bacteria 596
246 Ga0307411_10276133 3300032005 Bacteria 1335
247 Ga0307415_100629367 3300032126 Bacteria 959
248 Ga0307415_100892190 3300032126 Bacteria 819
249 Ga0373926_0195917 3300035083 Bacteria 777
250 Ga0373934_0001312 3300035086 Bacteria 9072
251 Ga0373949_0249667 3300035090 Unclassified 548
252 Ga0373953_0007656 3300035117 Bacteria 3628
253 Ga0373954_0090117 3300035118 Bacteria 1472
254 Ga0373954_0158584 3300035118 Bacteria 1107
255 Ga0373956_0018396 3300035119 Bacteria 2958
256 Ga0373956_0526520 3300035119 Bacteria 564
257 Ga0373943_0077385 3300035170 Bacteria 1699
258 Ga0373946_0650822 3300035171 Unclassified 549
259 Ga0373955_0497489 3300035172 Unclassified 744
260 Ga0373924_0130330 3300035410 Bacteria 1094
261 Ga0373924_0300745 3300035410 Bacteria 713
262 Ga0373935_0763962 3300035692 Bacteria 713
263 Ga0373927_0217629 3300035695 Bacteria 1255
264 Ga0373933_0063993 3300035724 Bacteria 2224
265 Ga0373947_0121309 3300035725 Bacteria 1661
266 Ga0373937_0001494 3300036401 Bacteria 19622
267 Ga0373937_0147956 3300036401 Unclassified 2199
268 Ga0373925_0189363 3300037068 Bacteria 1632
269 Ga0373925_0236497 3300037068 Bacteria 1462
270 Ga0373925_0397180 3300037068 Bacteria 1124
271 Ga0395898_0660591 3300037466 Bacteria 988
272 Ga0395905_0885659 3300037471 Bacteria 796
273 Ga0439453_0015044 3300041408 Bacteria 1334
274 Ga0439450_080901 3300042008 Bacteria 808
275 Ga0439457_044580 3300042014 Unclassified 990
276 Ga0439446_0027550 3300042156 Unclassified 1631
277 Ga0439435_0014454 3300042436 Bacteria 1950
278 Ga0439435_0101237 3300042436 Bacteria 886
279 Ga0439460_0075956 3300042461 Bacteria 1048
280 Ga0451577_0013974 3300042876 Bacteria 7495
281 Ga0453684_0231289 3300044712 Unclassified 2134
282 Ga0451576_0132021 3300045051 Bacteria 2603
283 Ga0451576_0345628 3300045051 Unclassified 1557
284 Ga0451576_0832834 3300045051 Unclassified 969
285 Ga0495651_0018223 3300046462 Bacteria 5437
286 Ga0495651_0296086 3300046462 Bacteria 1087
287 Ga0495653_0446571 3300046463 Unclassified 814
288 Ga0495644_0451035 3300046523 Bacteria 512
289 Ga0495640_0525570 3300046533 Bacteria 719
290 Ga0495598_0009564 3300046537 Bacteria 2296
291 Ga0495609_0147023 3300046538 Bacteria 1004
292 Ga0495621_0059965 3300046539 Unclassified 1379
293 Ga0495621_0089928 3300046539 Bacteria 1156
294 Ga0495667_0554689 3300046559 Bacteria 718
295 Ga0495635_0429741 3300046663 Bacteria 875
296 Ga0495659_0009972 3300046664 Bacteria 3039
297 Ga0495659_0026978 3300046664 Bacteria 1978
298 Ga0495659_0238454 3300046664 Bacteria 755
299 Ga0495599_0164565 3300046678 Bacteria 1370
300 Ga0495599_0350548 3300046678 Bacteria 885
301 Ga0495658_1118063 3300046683 Unclassified 502
302 Ga0495581_0559637 3300047315 Unclassified 663
303 Ga0495636_0062831 3300047318 Bacteria 1572
304 Ga0495636_0653329 3300047318 Unclassified 517
305 Ga0495680_0250166 3300047322 Bacteria 1256
306 Ga0496106_1127730 3300048909 Unclassified 614
307 Ga0501036_0111317 3300049572 Bacteria 2314
308 Ga0501039_0090911 3300049575 Bacteria 2379
309 Ga0501039_0342616 3300049575 Bacteria 1175
310 Ga0501039_0678860 3300049575 Unclassified 806
311 Ga0501041_0092152 3300049577 Bacteria 1871
312 Ga0501042_0070860 3300049578 Bacteria 2494
313 Ga0501042_0073662 3300049578 Bacteria 2443
314 Ga0501042_0397976 3300049578 Bacteria 998
315 Ga0501042_0589686 3300049578 Bacteria 808
316 Ga0501046_0120047 3300049580 Bacteria 2001
317 Ga0501046_0513773 3300049580 Bacteria 857
318 Ga0501048_0110582 3300049582 Unclassified 1940
319 Ga0501048_0405056 3300049582 Bacteria 975
320 Ga0501048_0830793 3300049582 Unclassified 664
321 Ga0501048_0987906 3300049582 Bacteria 606
322 Ga0501067_0186110 3300049583 Bacteria 1156
323 Ga0501068_0044411 3300049584 Bacteria 2676
324 Ga0501068_0632633 3300049584 Unclassified 698
325 Ga0501071_0033486 3300049587 Bacteria 3651
326 Ga0501071_0052917 3300049587 Unclassified 2928
327 Ga0501071_0174984 3300049587 Unclassified 1607
328 Ga0501071_1306388 3300049587 Unclassified 560
329 Ga0501072_0013402 3300049588 Bacteria 6274
330 Ga0501072_0292543 3300049588 Unclassified 1295
331 Ga0501072_0685917 3300049588 Bacteria 805
332 Ga0501073_0126867 3300049589 Unclassified 1769
333 Ga0501074_0308657 3300049590 Bacteria 1124
334 Ga0501075_0213130 3300049591 Bacteria 1473
335 Ga0501075_0371999 3300049591 Unclassified 1089
336 Ga0501075_0797274 3300049591 Bacteria 719
337 Ga0501076_0051249 3300049592 Unclassified 3267
338 Ga0501076_0224435 3300049592 Bacteria 1535
339 Ga0501076_0374327 3300049592 Unclassified 1170
340 Ga0501077_0168857 3300049593 Bacteria 1390
341 Ga0501202_140712 3300049652 Unclassified 623
342 Ga0501223_123812 3300049663 Bacteria 548
343 Ga0501224_046124 3300049664 Bacteria 663
344 Ga0501233_060441 3300049668 Bacteria 939
345 Ga0501235_200827 3300049669 Bacteria 540
346 Ga0501079_0113667 3300049741 Bacteria 2104
347 Ga0501079_0259003 3300049741 Unclassified 1360
348 Ga0501080_0066711 3300049742 Bacteria 3347
349 Ga0501080_1449412 3300049742 Bacteria 585
350 Ga0501081_0073714 3300049743 Bacteria 2381
351 Ga0501081_0260220 3300049743 Unclassified 1268
352 Ga0501081_0484310 3300049743 Bacteria 921
353 Ga0501081_1243054 3300049743 Bacteria 564
354 Ga0501270_094528 3300049767 Bacteria 615
355 Ga0501283_016702 3300049779 Bacteria 1142
356 Ga0501035_0466447 3300049822 Bacteria 1043
357 Ga0501045_0108207 3300049824 Unclassified 2060
358 Ga0501045_0284361 3300049824 Bacteria 1231
359 Ga0501045_1415907 3300049824 Bacteria 505
360 Ga0501212_113407 3300049851 Unclassified 519
361 nmdc:mga05p37_1324194_c1 3300050507 Bacteria 732
362 nmdc:mga05p37_54251_c1 3300050507 Unclassified 4931
363 nmdc:mga05p37_848406_c1 3300050507 Bacteria 992
364 nmdc:mga09592_1208775_c1 3300050508 Unclassified 624
365 nmdc:mga09592_1572667_c1 3300050508 Unclassified 533
366 nmdc:mga09592_26432_c1 3300050508 Bacteria 4808
367 nmdc:mga09592_658434_c1 3300050508 Unclassified 894
368 nmdc:mga0qj67_16586_c1 3300050509 Bacteria 5590
369 nmdc:mga0qj67_825312_c1 3300050509 Bacteria 733
370 nmdc:mga06r32_11137_c1 3300050510 Bacteria 8098
371 nmdc:mga06r32_1116259_c1 3300050510 Bacteria 737
372 nmdc:mga06r32_45095_c1 3300050510 Bacteria 4201
373 nmdc:mga06r32_653744_c1 3300050510 Bacteria 1019
374 nmdc:mga08y16_10423_c1 3300050511 Bacteria 9749
375 nmdc:mga08y16_117888_c1 3300050511 Bacteria 2763
376 nmdc:mga08y16_132405_c1 3300050511 Unclassified 2592
377 nmdc:mga08y16_1436564_c1 3300050511 Bacteria 652
378 nmdc:mga08y16_17190_c1 3300050511 Bacteria 7612
379 nmdc:mga08y16_27820_c1 3300050511 Bacteria 5959
380 nmdc:mga08y16_29533_c1 3300050511 Bacteria 5775
381 nmdc:mga08y16_905382_c1 3300050511 Bacteria 868
382 nmdc:mga08y16_9120_c1 3300050511 Bacteria 10414
383 nmdc:mga0n895_1396760_c1 3300050512 Unclassified 669
384 nmdc:mga0n895_1590308_c1 3300050512 Unclassified 618
385 nmdc:mga0n895_209398_c1 3300050512 Bacteria 1980
386 nmdc:mga0n895_287635_c1 3300050512 Bacteria 1666
387 nmdc:mga0n895_485528_c1 3300050512 Bacteria 1245
388 nmdc:mga0rr50_194130_c1 3300050513 Bacteria 1665
389 nmdc:mga0rr50_27365_c1 3300050513 Bacteria 3991
390 nmdc:mga0a205_107469_c1 3300050515 Unclassified 2688
391 nmdc:mga0a205_93630_c1 3300050515 Bacteria 2903
392 Ga0495619_0046360 3300053085 Bacteria 2858
393 Ga0501084_0093838 3300054114 Bacteria 2520
394 Ga0501084_0367919 3300054114 Bacteria 1215
395 Ga0501084_0462936 3300054114 Bacteria 1072
396 Ga0501082_0126904 3300060353 Bacteria 2213
397 Ga0501082_0792118 3300060353 Unclassified 829
398 Ga0501082_0847148 3300060353 Bacteria 800
399 Ga0501082_0991022 3300060353 Archaea 735
400 Ga0501082_1265849 3300060353 Bacteria 644
401 Ga0530510_0399557 3300061734 Bacteria 1036
402 Ga0530510_1032791 3300061734 Unclassified 629
403 Ga0530510_1190190 3300061734 Unclassified 584
404 Ga0530510_1389206 3300061734 Bacteria 539
405 Ga0070687_100712650
406 SwRhRL2b_contig_710807
407 MBSR1b_contig_4074373
408 MBSR1b_contig_7300111
409 MBSR1b_contig_8117833
410 MBSR1b_contig_8669839
411 MBSR1b_contig_9742135
412 Ga0065704_10101459
413 Ga0065704_10276141
414 Ga0065712_10461777
415 Ga0065715_10089829
416 Ga0065715_10104911
417 Ga0065707_10000927
418 Ga0065707_10007718
419 Ga0065707_10136162
420 Ga0065707_10494468
421 Ga0070676_11028219
422 Ga0070690_101724935
423 Ga0070677_10105876
424 Ga0068869_100266099
425 Ga0070666_10809212
426 Ga0070680_100047621
427 Ga0070680_101607684
428 Ga0070682_101611817
429 Ga0070660_100334152
430 Ga0070689_100656487
431 Ga0070692_10007824
432 Ga0070692_11122301
433 Ga0070668_100663480
434 Ga0070668_100984683
435 Ga0070669_100007872
436 Ga0070669_100018495
437 Ga0070675_100007917
438 Ga0070675_100011663
439 Ga0070675_100226146
440 Ga0070675_100951045
441 Ga0070671_100201079
442 Ga0070673_100335599
443 Ga0070688_100021644
444 Ga0070659_100431665
445 Ga0070667_101844956
446 Ga0070667_102069085
447 Ga0070701_10003949
448 Ga0070711_100811179
449 Ga0070705_100027173
450 Ga0070705_100196238
451 Ga0070700_100031624
452 Ga0070694_100071255
453 Ga0070694_100100579
454 Ga0070694_100290296
455 Ga0070694_100385254
456 Ga0070678_101593011
457 Ga0070662_100235877
458 Ga0070662_100622139
459 Ga0070681_10113963
460 Ga0070681_10392949
461 Ga0068867_100002978
462 Ga0070685_10127891
463 Ga0070706_100443299
464 Ga0070707_100023499
465 Ga0070707_100134806
466 Ga0070698_100273619
467 Ga0070698_100987266
468 Ga0070699_100037501
469 Ga0070697_100013508
470 Ga0070672_100110233
471 Ga0070672_100668087
472 Ga0070686_100116395
473 Ga0070695_100142406
474 Ga0070695_101310584
475 Ga0070695_101423578
476 Ga0070695_101707932
477 Ga0070696_100313896
478 Ga0070696_101128138
479 Ga0070696_101678562
480 Ga0070704_100010151
481 Ga0070704_100031896
482 Ga0070704_101529195
483 Ga0070664_101491205
484 Ga0068857_100006691
485 Ga0068857_100889439
486 Ga0068856_100369004
487 Ga0068856_101835294
488 Ga0068856_102270377
489 Ga0068852_100131039
490 Ga0068859_100009052
491 Ga0068859_100217466
492 Ga0068864_101944005
493 Ga0068866_10254481
494 Ga0068861_100007731
495 Ga0068870_10037442
496 Ga0068858_100128233
497 Ga0068860_100018197
498 Ga0068860_100931373
499 Ga0068862_100003827
500 Ga0068862_100760818
501 Ga0068862_101577252
502 Ga0070716_100544109
503 Ga0075428_100004423
504 Ga0075428_100494057
505 Ga0075428_100611774
506 Ga0075428_101155214
507 Ga0075428_101286577
508 Ga0075428_102522869
509 Ga0075430_100002771
510 Ga0075431_100009903
511 Ga0075431_100237984
512 Ga0075433_10036795
513 Ga0075433_10162734
514 Ga0075433_11343315
515 Ga0075433_11376873
516 Ga0075434_100024484
517 Ga0075434_100171858
518 Ga0075434_100244879
519 Ga0075434_100871631
520 Ga0075434_101579161
521 Ga0075434_101853473
522 Ga0075429_100060073
523 Ga0075436_100735394
524 Ga0097620_100009052
525 Ga0097620_100217478
526 Ga0075435_100003559
527 Ga0075435_100064071
528 Ga0105240_10254635
529 Ga0111539_10001431
530 Ga0111539_10004622
531 Ga0111539_10005230
532 Ga0111539_10022282
533 Ga0111539_10024996
534 Ga0111539_10122872
535 Ga0111539_10219524
536 Ga0111539_11241898
537 Ga0105245_11191380
538 Ga0114129_10131901
539 Ga0114129_10143350
540 Ga0114129_10176639
541 Ga0114129_10887641
542 Ga0114129_10951587
543 Ga0114129_12348235
544 Ga0105243_10112555
545 Ga0105243_10623646
546 Ga0105241_11878481
547 Ga0105248_10155999
548 Ga0105248_10479944
549 Ga0105248_13108487
550 Ga0105237_11613892
551 Ga0105249_10007865
552 Ga0105249_10013273
553 Ga0105249_10935289
554 Ga0105249_11212507
555 Ga0105246_10154058
556 Ga0105246_10189992
557 Ga0157369_11371672
558 Ga0157378_10195187
559 Ga0157378_11030131
560 Ga0157372_11522766
561 Ga0157375_10014850
562 Ga0157375_10315237
563 Ga0157375_11085478
564 Ga0163163_12720609
565 Ga0157380_10520784
566 Ga0157380_10951562
567 Ga0157377_10027665
568 Ga0157377_10078912
569 Ga0157377_10089891
570 Ga0206354_10991109
571 Ga0207682_10243196
572 Ga0207688_10037948
573 Ga0207645_10852281
574 Ga0207643_10001372
575 Ga0207643_10568396
576 Ga0207684_10386503
577 Ga0207654_11101395
578 Ga0207707_11610066
579 Ga0207695_10192456
580 Ga0207671_11202094
581 Ga0207662_10018852
582 Ga0207649_10550043
583 Ga0207649_11194642
584 Ga0207652_11742216
585 Ga0207646_10126568
586 Ga0207681_10038171
587 Ga0207681_10059300
588 Ga0207681_10170432
589 Ga0207681_10507306
590 Ga0207650_10709176
591 Ga0207659_10002451
592 Ga0207659_10008731
593 Ga0207659_10016324
594 Ga0207706_10319270
595 Ga0207706_10331886
596 Ga0207706_10348641
597 Ga0207709_10043651
598 Ga0207670_10075381
599 Ga0207670_10206933
600 Ga0207669_10350374
601 Ga0207704_10578154
602 Ga0207665_10413455
603 Ga0207691_10105186
604 Ga0207691_10142816
605 Ga0207691_10298010
606 Ga0207689_10219114
607 Ga0207679_10029765
608 Ga0207679_10208858
609 Ga0207667_10622680
610 Ga0207651_10116117
611 Ga0207651_10177519
612 Ga0207651_11028947
613 Ga0207712_10002818
614 Ga0207712_10499250
615 Ga0207668_10275116
616 Ga0207658_10095648
617 Ga0207703_10330823
618 Ga0207708_10056659
619 Ga0207702_11105784
620 Ga0207648_10001970
621 Ga0207648_10121644
622 Ga0207648_11432769
623 Ga0207676_10658548
624 Ga0207676_10845467
625 Ga0207676_11639745
626 Ga0207676_11868889
627 Ga0207674_10004707
628 Ga0207683_10078474
629 Ga0207698_10029151
630 Ga0209968_1048408
631 Ga0209998_10115095
632 Ga0207428_10002913
633 Ga0207428_10006044
634 Ga0207428_10017842
635 Ga0207428_10023096
636 Ga0207428_10704036
637 Ga0268265_10001742
638 Ga0268265_10276930
639 Ga0268265_10441237
640 Ga0268264_10105338
641 Ga0268264_11120990
642 Ga0307405_10039378
643 Ga0307413_10255555
644 Ga0307410_11044506
645 Ga0307409_100787689
646 Ga0307409_100850602
647 Ga0307416_101173940
648 Ga0307416_101192390
649 Ga0307416_102676003
650 Ga0307411_10276133
651 Ga0307415_100629367
652 Ga0307415_100892190
653 Ga0373926_0195917
654 Ga0373934_0001312
655 Ga0373949_0249667
656 Ga0373953_0007656
657 Ga0373954_0090117
658 Ga0373954_0158584
659 Ga0373956_0018396
660 Ga0373956_0526520
661 Ga0373943_0077385
662 Ga0373946_0650822
663 Ga0373955_0497489
664 Ga0373924_0130330
665 Ga0373924_0300745
666 Ga0373935_0763962
667 Ga0373927_0217629
668 Ga0373933_0063993
669 Ga0373947_0121309
670 Ga0373937_0001494
671 Ga0373937_0147956
672 Ga0373925_0189363
673 Ga0373925_0236497
674 Ga0373925_0397180
675 Ga0395898_0660591
676 Ga0395905_0885659
677 Ga0439453_0015044
678 Ga0439450_080901
679 Ga0439457_044580
680 Ga0439446_0027550
681 Ga0439435_0014454
682 Ga0439435_0101237
683 Ga0439460_0075956
684 Ga0451577_0013974
685 Ga0453684_0231289
686 Ga0451576_0132021
687 Ga0451576_0345628
688 Ga0451576_0832834
689 Ga0495651_0018223
690 Ga0495651_0296086
691 Ga0495653_0446571
692 Ga0495644_0451035
693 Ga0495640_0525570
694 Ga0495598_0009564
695 Ga0495609_0147023
696 Ga0495621_0059965
697 Ga0495621_0089928
698 Ga0495667_0554689
699 Ga0495635_0429741
700 Ga0495659_0009972
701 Ga0495659_0026978
702 Ga0495659_0238454
703 Ga0495599_0164565
704 Ga0495599_0350548
705 Ga0495658_1118063
706 Ga0495581_0559637
707 Ga0495636_0062831
708 Ga0495636_0653329
709 Ga0495680_0250166
710 Ga0496106_1127730
711 Ga0501036_0111317
712 Ga0501039_0090911
713 Ga0501039_0342616
714 Ga0501039_0678860
715 Ga0501041_0092152
716 Ga0501042_0070860
717 Ga0501042_0073662
718 Ga0501042_0397976
719 Ga0501042_0589686
720 Ga0501046_0120047
721 Ga0501046_0513773
722 Ga0501048_0110582
723 Ga0501048_0405056
724 Ga0501048_0830793
725 Ga0501048_0987906
726 Ga0501067_0186110
727 Ga0501068_0044411
728 Ga0501068_0632633
729 Ga0501071_0033486
730 Ga0501071_0052917
731 Ga0501071_0174984
732 Ga0501071_1306388
733 Ga0501072_0013402
734 Ga0501072_0292543
735 Ga0501072_0685917
736 Ga0501073_0126867
737 Ga0501074_0308657
738 Ga0501075_0213130
739 Ga0501075_0371999
740 Ga0501075_0797274
741 Ga0501076_0051249
742 Ga0501076_0224435
743 Ga0501076_0374327
744 Ga0501077_0168857
745 Ga0501202_140712
746 Ga0501223_123812
747 Ga0501224_046124
748 Ga0501233_060441
749 Ga0501235_200827
750 Ga0501079_0113667
751 Ga0501079_0259003
752 Ga0501080_0066711
753 Ga0501080_1449412
754 Ga0501081_0073714
755 Ga0501081_0260220
756 Ga0501081_0484310
757 Ga0501081_1243054
758 Ga0501270_094528
759 Ga0501283_016702
760 Ga0501035_0466447
761 Ga0501045_0108207
762 Ga0501045_0284361
763 Ga0501045_1415907
764 Ga0501212_113407
765 nmdc:mga05p37_1324194_c1
766 nmdc:mga05p37_54251_c1
767 nmdc:mga05p37_848406_c1
768 nmdc:mga09592_1208775_c1
769 nmdc:mga09592_1572667_c1
770 nmdc:mga09592_26432_c1
771 nmdc:mga09592_658434_c1
772 nmdc:mga0qj67_16586_c1
773 nmdc:mga0qj67_825312_c1
774 nmdc:mga06r32_11137_c1
775 nmdc:mga06r32_1116259_c1
776 nmdc:mga06r32_45095_c1
777 nmdc:mga06r32_653744_c1
778 nmdc:mga08y16_10423_c1
779 nmdc:mga08y16_117888_c1
780 nmdc:mga08y16_132405_c1
781 nmdc:mga08y16_1436564_c1
782 nmdc:mga08y16_17190_c1
783 nmdc:mga08y16_27820_c1
784 nmdc:mga08y16_29533_c1
785 nmdc:mga08y16_905382_c1
786 nmdc:mga08y16_9120_c1
787 nmdc:mga0n895_1396760_c1
788 nmdc:mga0n895_1590308_c1
789 nmdc:mga0n895_209398_c1
790 nmdc:mga0n895_287635_c1
791 nmdc:mga0n895_485528_c1
792 nmdc:mga0rr50_194130_c1
793 nmdc:mga0rr50_27365_c1
794 nmdc:mga0a205_107469_c1
795 nmdc:mga0a205_93630_c1
796 Ga0495619_0046360
797 Ga0501084_0093838
798 Ga0501084_0367919
799 Ga0501084_0462936
800 Ga0501082_0126904
801 Ga0501082_0792118
802 Ga0501082_0847148
803 Ga0501082_0991022
804 Ga0501082_1265849
805 Ga0530510_0399557
806 Ga0530510_1032791
807 Ga0530510_1190190
808 Ga0530510_1389206

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

38

84

0.97

PF12840

HTH_20

Helix-turn-helix domain

36

85

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1r1u-assembly1.cif.gz_B crystal structure of the metal-sensing transcriptional repressor czra from staphylococcus aureus in the apo-form 0.9653 16 105
6cda-assembly1.cif.gz_A-2 crystal structure of l34a czra in the zn(ii)bound state 0.9624 17 105
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.9623 34 90
6cdb-assembly1.cif.gz_A crystal structure of v66l czra in the zn(ii)bound state 0.962 17 105
1r1u-assembly2.cif.gz_D crystal structure of the metal-sensing transcriptional repressor czra from staphylococcus aureus in the apo-form 0.9595 16 105
ID Description Score Start End Superfamily
af_Q58721_1_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9873 17 100 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9819 31 87 1.10.10.10
af_O53838_4_115_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9725 17 100 1.10.10.10
af_Q58793_245_317_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9705 27 90 1.10.10.10
af_B4FTK6_47_112_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9655 46 90 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2W4XDU6-F1-model_v4 ArsR family transcriptional regulator 0.9781 17 105 GO:0003700
AF-A0A7W4NQF2-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9758 19 104 GO:0003700
AF-A0A1V2IEP3-F1-model_v4 HTH arsR-type domain-containing protein 0.9757 19 106 GO:0003700
AF-A0A7C2IZL3-F1-model_v4 Transcriptional regulator 0.9755 16 103 GO:0003700
AF-A0A1J5AXB2-F1-model_v4 HTH arsR-type domain-containing protein 0.9748 17 97 GO:0003700
GO:0016491

Map