F435535

General Info

Members Datasets Scaffolds Average Seq Length
403 293 806 381

Family's Representative Sequence

Representative Sequence 3300050491|nmdc:mga00v17_306_c1|nmdc:mga00v17_306_c1_23560_24873
Length 437
Sequence LTRRCGRQIKRFILSIENDIDMTTVSPHDASLSNRGHAPADRDQTLAGHDVTRASGNDSLSHRNDEIVWVRVSSCYLPLSQPISDAKVLTGRQKPMTEIAMLFAEIETRDGHRGLGFSYAKRAGGPGQFAHAKEIAPALIGEDPSDIAKIWTKLCWAGASVGRSGLSVQAIGAFDVALYDLKARRAGLSLSKFLGSQRDSVQCYNTSGGFLHTPLEQLLVNVQASRERGIGGIKLKVGQPDRALDVRRVEAVRKQFGDDMPLMVDANQQWDRPTAQRMCRIFEQFNLVWIEEPLDAYDFEGHAALAGNFDTAIATGEMLVSAAEHAELIRHRAADYLMPDAPRVGGITPFLKIAAQAEQAGLSLGPHFAMELHVHLGAVYATEPWVEHFDWLEPLFNERLEIRDGRMLVPTRPGLGLSLSEQAHAWTRESAEVGRRA

Samples

Sample ID Description Type Environment
1 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
5 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
47 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
48 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
65 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
96 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
101 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
102 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
103 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
104 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
105 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
106 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
109 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
110 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
125 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
126 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
127 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
128 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
129 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
130 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
131 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
132 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
133 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
134 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
135 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
136 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
137 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
138 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
139 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
140 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
141 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
142 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
143 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
144 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
145 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
146 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
147 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
148 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
149 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
150 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
151 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
152 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
153 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
154 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
155 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
156 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
157 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
158 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
159 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
160 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
161 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
164 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
165 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
166 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
167 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
168 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
169 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
170 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
171 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
172 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
173 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
174 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
175 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
184 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
185 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
186 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
187 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
188 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
189 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
190 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
203 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
204 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
205 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
206 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
214 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
215 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
216 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
217 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
218 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
219 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
222 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
223 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
224 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
225 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
226 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
227 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
228 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
229 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
230 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
231 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
232 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
233 2561511199 Enterobacter sp. R4-368 Isolate Nodule
234 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
235 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
236 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
237 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
238 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
239 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
240 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
241 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
242 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
243 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
244 2643221594 Achromobacter sp. Root170 Isolate Unclassified
245 2643221609 Acidovorax sp. Root217 Isolate Unclassified
246 2643221611 Acidovorax sp. Root219 Isolate Unclassified
247 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
248 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
249 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
250 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
251 2721755523 Delftia sp. HK171 Isolate Unclassified
252 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
253 2738541277 Variovorax sp. GV051 Isolate Unclassified
254 2738543012 Acidovorax sp. CF301 Isolate Unclassified
255 2738543019 Variovorax sp. GV040 Isolate Unclassified
256 2739367898 Nocardioides sp. CF479 Isolate Unclassified
257 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
258 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
259 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
260 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
261 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
262 2816332133 Acidovorax radicis 2721A Isolate Unclassified
263 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
264 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
265 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
266 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
267 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
268 2855730933 Achromobacter sp. HZ28 Isolate Nodule
269 2855767633 Achromobacter sp. HZ34 Isolate Nodule
270 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
271 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
272 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
273 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
274 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
275 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
276 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
277 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
278 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
279 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
280 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
281 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
282 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
283 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
284 2928070936 Variovorax gossypii 1167 Isolate Unclassified
285 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
286 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
287 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
288 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
289 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
290 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
291 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
292 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
293 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.62
Metatranscriptomes 0
Isolates 16.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.87
Nodule 1.99
Rhizoplane 5.71
Rhizosphere 61.54
Stem 0
Stem Tuber 0.74
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga00v17_306_c1 3300050491 Bacteria 28159
2 JGI24751J29686_10004756 3300002459 Bacteria 2759
3 JGI25151J46595_10007862 3300003187 Bacteria 5181
4 Ga0055524_1000085 3300003775 Bacteria 117478
5 Ga0055524_1033898 3300003775 Bacteria 1421
6 Ga0055534_1004543 3300003784 Bacteria 3985
7 Ga0055530_10001191 3300003791 Bacteria 20125
8 Ga0055540_1000056 3300003792 Bacteria 139732
9 Ga0055531_10002398 3300003794 Bacteria 12587
10 Ga0058692_1000411 3300003856 Bacteria 19901
11 Ga0070676_10036232 3300005328 Bacteria 2841
12 Ga0070670_100000509 3300005331 Bacteria 31134
13 Ga0070670_100161535 3300005331 Bacteria 1942
14 Ga0070666_10068843 3300005335 Bacteria 2406
15 Ga0068868_100034550 3300005338 Bacteria 3904
16 Ga0070668_100162169 3300005347 Bacteria 1815
17 Ga0070669_100015447 3300005353 Bacteria 5440
18 Ga0070669_100075082 3300005353 Bacteria 2506
19 Ga0070675_100003522 3300005354 Bacteria 11871
20 Ga0070671_100006034 3300005355 Bacteria 9654
21 Ga0070671_100048027 3300005355 Bacteria 3549
22 Ga0070671_100069253 3300005355 Bacteria 2943
23 Ga0070674_100069123 3300005356 Bacteria 2490
24 Ga0070674_100198130 3300005356 Bacteria 1549
25 Ga0070673_100004724 3300005364 Bacteria 8650
26 Ga0070667_100052327 3300005367 Bacteria 3445
27 Ga0070713_100138416 3300005436 Bacteria 2154
28 Ga0070700_100062821 3300005441 Bacteria 2347
29 Ga0070678_100004250 3300005456 Bacteria 8095
30 Ga0068867_100010732 3300005459 Bacteria 6460
31 Ga0068867_100039797 3300005459 Bacteria 3429
32 Ga0068867_100053524 3300005459 Bacteria 2981
33 Ga0070707_100400547 3300005468 Bacteria 1332
34 Ga0070699_100087429 3300005518 Bacteria 2721
35 Ga0068853_100048547 3300005539 Bacteria 3647
36 Ga0070672_100002485 3300005543 Bacteria 11726
37 Ga0070672_100045341 3300005543 Bacteria 3400
38 Ga0070696_100006772 3300005546 Bacteria 7650
39 Ga0070665_100009219 3300005548 Bacteria 9998
40 Ga0070665_100019623 3300005548 Bacteria 6785
41 Ga0068864_100017875 3300005618 Bacteria 5915
42 Ga0068861_100093302 3300005719 Bacteria 2380
43 Ga0068863_100000256 3300005841 Bacteria 55559
44 Ga0068858_100026823 3300005842 Bacteria 5352
45 Ga0081539_10000155 3300005985 Bacteria 159271
46 Ga0075365_10029298 3300006038 Bacteria 3517
47 Ga0075368_10065601 3300006042 Bacteria 1459
48 Ga0075363_100008905 3300006048 Bacteria 4697
49 Ga0075364_10000592 3300006051 Bacteria 18724
50 Ga0075364_10000665 3300006051 Bacteria 17807
51 Ga0075364_10002347 3300006051 Bacteria 10630
52 Ga0075364_10005678 3300006051 Bacteria 7273
53 Ga0075364_10022219 3300006051 Bacteria 4004
54 Ga0075367_10014443 3300006178 Bacteria 4274
55 Ga0075367_10121911 3300006178 Bacteria 1607
56 Ga0075366_10010070 3300006195 Bacteria 5299
57 Ga0075366_10017765 3300006195 Bacteria 4100
58 Ga0097621_100029243 3300006237 Bacteria 4350
59 Ga0075370_10038036 3300006353 Bacteria 2707
60 Ga0075370_10070381 3300006353 Bacteria 2001
61 Ga0068871_100003669 3300006358 Bacteria 10557
62 Ga0075428_100247677 3300006844 Bacteria 1921
63 Ga0079104_1000007 3300006946 Bacteria 390531
64 Ga0079104_1001781 3300006946 Bacteria 13458
65 Ga0105251_10000032 3300009011 Bacteria 120825
66 Ga0105250_10000241 3300009092 Bacteria 45446
67 Ga0105250_10049437 3300009092 Bacteria 1686
68 Ga0111539_10008419 3300009094 Bacteria 13122
69 Ga0105243_10004088 3300009148 Bacteria 11620
70 Ga0105243_10121904 3300009148 Bacteria 2199
71 Ga0105242_10000164 3300009176 Bacteria 49988
72 Ga0105242_10044652 3300009176 Bacteria 3590
73 Ga0105238_10194386 3300009551 Bacteria 2005
74 Ga0105238_10257413 3300009551 Bacteria 1724
75 Ga0105246_10070567 3300011119 Bacteria 2457
76 Ga0157371_10000157 3300013102 Bacteria 99794
77 Ga0157378_10043252 3300013297 Bacteria 3999
78 Ga0163162_10052297 3300013306 Bacteria 4102
79 Ga0163162_10116022 3300013306 Bacteria 2778
80 Ga0163162_10190296 3300013306 Bacteria 2179
81 Ga0163162_10301400 3300013306 Bacteria 1734
82 Ga0157375_10051363 3300013308 Bacteria 4048
83 Ga0157375_10064033 3300013308 Bacteria 3660
84 Ga0163163_10047273 3300014325 Bacteria 4229
85 Ga0157380_10136004 3300014326 Bacteria 2104
86 Ga0182008_10034019 3300014497 Bacteria 2556
87 Ga0157379_10048367 3300014968 Bacteria 3796
88 Ga0157379_10088586 3300014968 Bacteria 2776
89 Ga0182007_10015940 3300015262 Bacteria 2787
90 Ga0163161_10009037 3300017792 Bacteria 6892
91 Ga0213872_10003908 3300021361 Bacteria 8082
92 Ga0209565_1007265 3300025263 Bacteria 3003
93 Ga0209130_1005211 3300025284 Bacteria 4596
94 Ga0209675_1003411 3300025291 Bacteria 7571
95 Ga0209675_1006227 3300025291 Bacteria 4829
96 Ga0209676_1024737 3300025292 Bacteria 1937
97 Ga0209676_1026654 3300025292 Bacteria 1832
98 Ga0209025_1000028 3300025294 Bacteria 490678
99 Ga0209025_1000868 3300025294 Bacteria 47781
100 Ga0209050_1001130 3300025298 Bacteria 32162
101 Ga0209256_1000036 3300025299 Bacteria 386664
102 Ga0209256_1000127 3300025299 Bacteria 164393
103 Ga0209051_1000068 3300025303 Bacteria 220063
104 Ga0209051_1001275 3300025303 Bacteria 22419
105 Ga0209051_1001318 3300025303 Bacteria 21725
106 Ga0209051_1007096 3300025303 Bacteria 6192
107 Ga0209051_1010768 3300025303 Bacteria 4578
108 Ga0209257_1000146 3300025304 Bacteria 194261
109 Ga0209257_1010202 3300025304 Bacteria 4817
110 Ga0207696_1000363 3300025711 Bacteria 45454
111 Ga0207713_1000020 3300025735 Bacteria 359258
112 Ga0207713_1000060 3300025735 Bacteria 213145
113 Ga0207682_10002426 3300025893 Bacteria 8368
114 Ga0207682_10032532 3300025893 Bacteria 2096
115 Ga0207688_10042364 3300025901 Bacteria 2534
116 Ga0207662_10088267 3300025918 Bacteria 1904
117 Ga0207681_10012967 3300025923 Bacteria 5152
118 Ga0207681_10092786 3300025923 Bacteria 2159
119 Ga0207694_10123188 3300025924 Bacteria 2071
120 Ga0207650_10009829 3300025925 Bacteria 6544
121 Ga0207659_10064054 3300025926 Bacteria 2659
122 Ga0207644_10002799 3300025931 Bacteria 11241
123 Ga0207644_10007467 3300025931 Bacteria 7129
124 Ga0207709_10000112 3300025935 Bacteria 127357
125 Ga0207669_10008204 3300025937 Bacteria 4892
126 Ga0207691_10000186 3300025940 Bacteria 58949
127 Ga0207691_10009406 3300025940 Bacteria 9386
128 Ga0207651_10015332 3300025960 Bacteria 4451
129 Ga0207651_10159268 3300025960 Bacteria 1768
130 Ga0207658_10032939 3300025986 Bacteria 3693
131 Ga0207658_10038443 3300025986 Bacteria 3447
132 Ga0207658_10067877 3300025986 Bacteria 2688
133 Ga0207677_10114766 3300026023 Bacteria 2013
134 Ga0207703_10031008 3300026035 Bacteria 4227
135 Ga0207641_10007810 3300026088 Bacteria 8887
136 Ga0207648_10000629 3300026089 Bacteria 39533
137 Ga0207648_10035113 3300026089 Bacteria 4419
138 Ga0207648_10048841 3300026089 Bacteria 3704
139 Ga0207676_10014346 3300026095 Bacteria 5699
140 Ga0207683_10015213 3300026121 Bacteria 6548
141 Ga0207683_10031808 3300026121 Bacteria 4581
142 Ga0207683_10078210 3300026121 Bacteria 2931
143 Ga0207683_10105990 3300026121 Bacteria 2513
144 Ga0209281_1000020 3300027111 Bacteria 575972
145 Ga0209281_1000883 3300027111 Bacteria 25710
146 Ga0209371_1000033 3300027312 Bacteria 381084
147 Ga0207428_10007707 3300027907 Bacteria 9795
148 Ga0268266_10004323 3300028379 Bacteria 13663
149 Ga0268266_10023825 3300028379 Bacteria 5209
150 Ga0268264_10033190 3300028381 Bacteria 4238
151 Ga0307515_10000219 3300028794 Bacteria 141532
152 Ga0307515_10001249 3300028794 Bacteria 58038
153 Ga0307515_10008172 3300028794 Bacteria 20484
154 Ga0307515_10131178 3300028794 Bacteria 2758
155 Ga0268256_1001121 3300030500 Bacteria 17424
156 Ga0314311_1071918 3300030733 Bacteria 13295
157 Ga0316183_1035810 3300030742 Bacteria 5220
158 Ga0316181_1220031 3300030744 Bacteria 2448
159 Ga0265327_10014732 3300031251 Bacteria 5094
160 Ga0307513_10025388 3300031456 Bacteria 6866
161 Ga0307408_100000025 3300031548 Bacteria 267563
162 Ga0307408_100002328 3300031548 Bacteria 13449
163 Ga0307408_100008982 3300031548 Bacteria 6602
164 Ga0307408_100016863 3300031548 Bacteria 4882
165 Ga0307408_100018955 3300031548 Bacteria 4626
166 Ga0307408_100129851 3300031548 Bacteria 1964
167 Ga0307408_100165351 3300031548 Bacteria 1761
168 Ga0307514_10002106 3300031649 Bacteria 21468
169 Ga0265342_10097352 3300031712 Bacteria 1680
170 Ga0307516_10002784 3300031730 Bacteria 23086
171 Ga0307405_10000093 3300031731 Bacteria 38072
172 Ga0307405_10016869 3300031731 Bacteria 3993
173 Ga0307410_10085995 3300031852 Bacteria 2220
174 Ga0307406_10005950 3300031901 Bacteria 6695
175 Ga0307406_10008357 3300031901 Bacteria 5769
176 Ga0307407_10027113 3300031903 Bacteria 3043
177 Ga0307407_10100904 3300031903 Bacteria 1791
178 Ga0307412_10000174 3300031911 Bacteria 45787
179 Ga0307412_10001039 3300031911 Bacteria 15857
180 Ga0307409_100033870 3300031995 Bacteria 3723
181 Ga0307409_100347985 3300031995 Bacteria 1397
182 Ga0307416_100083057 3300032002 Bacteria 2716
183 Ga0307416_100189193 3300032002 Bacteria 1939
184 Ga0307414_10013127 3300032004 Bacteria 4923
185 Ga0307414_10101076 3300032004 Bacteria 2170
186 Ga0307411_10052452 3300032005 Bacteria 2666
187 Ga0307411_10151415 3300032005 Bacteria 1724
188 Ga0307415_100105288 3300032126 Bacteria 2080
189 Ga0307415_100111314 3300032126 Bacteria 2032
190 Ga0307415_100166680 3300032126 Bacteria 1713
191 Ga0307510_10016491 3300033180 Bacteria 8719
192 Ga0307510_10064668 3300033180 Bacteria 3713
193 Ga0395905_0018604 3300037471 Bacteria 6591
194 Ga0395905_0120493 3300037471 Bacteria 2466
195 Ga0395901_0189500 3300038443 Bacteria 2157
196 Ga0436361_0289253 3300039447 Bacteria 14543
197 Ga0439438_000124 3300041405 Bacteria 34621
198 Ga0439466_0000104 3300041411 Bacteria 32322
199 Ga0439466_0058558 3300041411 Bacteria 1246
200 Ga0439465_0008447 3300041413 Bacteria 3250
201 Ga0439465_0063398 3300041413 Bacteria 1227
202 Ga0451837_0068199 3300041494 Bacteria 1592
203 Ga0451843_0906194 3300041509 Bacteria 1545
204 Ga0439431_0001177 3300041997 Bacteria 5716
205 Ga0439445_0001270 3300042004 Bacteria 5471
206 Ga0439434_0003123 3300042435 Bacteria 4868
207 Ga0450901_000200 3300042533 Bacteria 7113
208 Ga0466972_0035274 3300044658 Bacteria 2448
209 Ga0466965_0022148 3300044683 Bacteria 3063
210 Ga0466970_0063855 3300044765 Bacteria 1974
211 Ga0466960_0009013 3300044901 Bacteria 4102
212 Ga0495617_009721 3300046452 Bacteria 3300
213 Ga0495590_0013860 3300046457 Bacteria 2956
214 Ga0495591_001996 3300046458 Bacteria 11891
215 Ga0495650_0000710 3300046471 Bacteria 42545
216 Ga0495580_0045842 3300046472 Bacteria 3104
217 Ga0495605_0025530 3300046474 Bacteria 3078
218 Ga0495664_0112606 3300046477 Bacteria 1643
219 Ga0495584_0010751 3300046491 Bacteria 4700
220 Ga0495585_0043676 3300046492 Bacteria 2505
221 Ga0495607_0000168 3300046501 Bacteria 69682
222 Ga0495607_0005795 3300046501 Bacteria 8788
223 Ga0495583_0000008 3300046506 Bacteria 411092
224 Ga0495583_0001112 3300046506 Bacteria 29748
225 Ga0495606_0000032 3300046507 Bacteria 248690
226 Ga0495606_0000042 3300046507 Bacteria 215099
227 Ga0495606_0083168 3300046507 Bacteria 1985
228 Ga0495608_0146509 3300046511 Bacteria 1506
229 Ga0495631_0003004 3300046518 Bacteria 9333
230 Ga0495632_0005956 3300046519 Bacteria 7943
231 Ga0495637_0000073 3300046520 Bacteria 81803
232 Ga0495637_0000171 3300046520 Bacteria 49947
233 Ga0495643_0028715 3300046522 Bacteria 3115
234 Ga0495644_0001175 3300046523 Bacteria 10733
235 Ga0495648_0014467 3300046524 Bacteria 5774
236 Ga0495654_0001087 3300046530 Bacteria 19760
237 Ga0495654_0008036 3300046530 Bacteria 5854
238 Ga0495609_0000456 3300046538 Bacteria 33462
239 Ga0495621_0007269 3300046539 Bacteria 3273
240 Ga0495622_0001439 3300046557 Bacteria 12019
241 Ga0495656_0038142 3300046615 Bacteria 1988
242 Ga0495625_0000010 3300046660 Bacteria 381775
243 Ga0495625_0084752 3300046660 Bacteria 2201
244 Ga0495661_0000790 3300046665 Bacteria 30045
245 Ga0495670_0018862 3300046691 Bacteria 3399
246 Ga0495671_0000560 3300046692 Bacteria 27925
247 Ga0495671_0022136 3300046692 Bacteria 3332
248 Ga0495649_0023752 3300046694 Bacteria 3424
249 Ga0495660_0027169 3300046810 Bacteria 3239
250 Ga0495672_0005078 3300047320 Bacteria 10517
251 Ga0495672_0034586 3300047320 Bacteria 3120
252 Ga0495672_0037160 3300047320 Bacteria 2983
253 Ga0495676_0000002 3300047321 Bacteria 373918
254 Ga0495687_005857 3300047443 Bacteria 7694
255 Ga0495679_000243 3300047446 Bacteria 45339
256 Ga0495673_0001431 3300047469 Bacteria 19061
257 Ga0495673_0023751 3300047469 Bacteria 2975
258 Ga0495681_0003032 3300047470 Bacteria 11804
259 Ga0495686_0000739 3300047472 Bacteria 43610
260 Ga0495626_0000319 3300048091 Bacteria 50529
261 Ga0496102_0003948 3300048905 Bacteria 12568
262 Ga0496102_0026929 3300048905 Bacteria 5133
263 Ga0496104_0017394 3300048907 Bacteria 6546
264 Ga0496105_0020462 3300048908 Bacteria 5346
265 Ga0496108_0168934 3300048911 Bacteria 1892
266 Ga0496109_0083439 3300048912 Bacteria 2947
267 Ga0496109_0317726 3300048912 Bacteria 1469
268 Ga0496111_0118188 3300048914 Bacteria 1957
269 Ga0496114_0017488 3300048917 Bacteria 5787
270 Ga0496114_0021038 3300048917 Bacteria 5302
271 Ga0496114_0300904 3300048917 Bacteria 1416
272 Ga0496116_0000205 3300048919 Bacteria 112754
273 Ga0496121_0003643 3300048924 Bacteria 21671
274 Ga0496121_0085366 3300048924 Bacteria 2485
275 Ga0496122_0000167 3300048925 Bacteria 157130
276 Ga0496123_0000127 3300048926 Bacteria 154927
277 Ga0496124_0033913 3300048927 Bacteria 4487
278 Ga0496124_0063229 3300048927 Bacteria 3093
279 Ga0496125_0006302 3300048928 Bacteria 12877
280 Ga0496126_0116745 3300048929 Bacteria 2319
281 Ga0501031_0030991 3300049568 Bacteria 3489
282 Ga0501032_0001224 3300049569 Bacteria 20569
283 Ga0501032_0085180 3300049569 Bacteria 2101
284 Ga0501033_0028329 3300049570 Bacteria 4209
285 Ga0501034_0000279 3300049571 Bacteria 91909
286 Ga0501034_0008088 3300049571 Bacteria 11154
287 Ga0501036_0026250 3300049572 Bacteria 4915
288 Ga0501037_0067598 3300049573 Bacteria 2602
289 Ga0501038_0077951 3300049574 Bacteria 2797
290 Ga0501041_0073981 3300049577 Bacteria 2093
291 Ga0501042_0015988 3300049578 Bacteria 5148
292 Ga0501043_0006542 3300049579 Bacteria 9350
293 Ga0501046_0145360 3300049580 Bacteria 1791
294 Ga0501047_0028825 3300049581 Bacteria 5355
295 Ga0501047_0112349 3300049581 Bacteria 2606
296 Ga0501071_0037736 3300049587 Bacteria 3451
297 Ga0501072_0021093 3300049588 Bacteria 5054
298 Ga0501074_0210692 3300049590 Bacteria 1384
299 Ga0501076_0174602 3300049592 Bacteria 1751
300 Ga0501077_0057423 3300049593 Bacteria 2471
301 Ga0501079_0053604 3300049741 Bacteria 3111
302 Ga0501080_0332260 3300049742 Bacteria 1374
303 Ga0501081_0051864 3300049743 Bacteria 2829
304 Ga0501035_0015073 3300049822 Bacteria 7132
305 Ga0501035_0279784 3300049822 Bacteria 1410
306 Ga0501044_0007871 3300049823 Bacteria 11718
307 Ga0501045_0074847 3300049824 Bacteria 2494
308 Ga0501226_000001 3300049853 Bacteria 432595
309 nmdc:mga03683_25261_c1 3300050489 Bacteria 2331
310 nmdc:mga03683_86604_c1 3300050489 Bacteria 1360
311 nmdc:mga03n38_105275_c1 3300050490 Bacteria 1366
312 nmdc:mga00v17_140684_c1 3300050491 Bacteria 1547
313 nmdc:mga00v17_18566_c1 3300050491 Bacteria 3953
314 nmdc:mga00v17_26699_c1 3300050491 Bacteria 3367
315 nmdc:mga00v17_7102_c1 3300050491 Bacteria 5964
316 nmdc:mga00v17_92781_c1 3300050491 Bacteria 1898
317 nmdc:mga0yw44_211619_c1 3300050492 Bacteria 1282
318 nmdc:mga0yw44_37933_c1 3300050492 Bacteria 2848
319 nmdc:mga0yw44_84198_c1 3300050492 Bacteria 1999
320 nmdc:mga0yw44_98395_c1 3300050492 Bacteria 1860
321 nmdc:mga0k408_13381_c1 3300050493 Bacteria 4498
322 nmdc:mga0k408_346_c1 3300050493 Bacteria 25314
323 nmdc:mga06z11_179078_c1 3300050494 Bacteria 1221
324 nmdc:mga07m45_44997_c1 3300050496 Bacteria 2478
325 nmdc:mga07m45_51402_c1 3300050496 Bacteria 2324
326 nmdc:mga06r32_106012_c1 3300050510 Bacteria 2761
327 nmdc:mga0sz30_20424_c1 3300050516 Bacteria 2671
328 nmdc:mga0sz30_5667_c1 3300050516 Bacteria 4594
329 Ga0500643_002156 3300053087 Bacteria 10424
330 Ga0500583_0000752 3300053092 Bacteria 9399
331 Ga0500651_0131904 3300053093 Bacteria 1511
332 Ga0500562_005129 3300053108 Bacteria 3291
333 Ga0500562_030595 3300053108 Bacteria 1419
334 Ga0500608_006764 3300053122 Bacteria 4697
335 Ga0500658_0110228 3300053134 Bacteria 1211
336 Ga0500616_0008600 3300053153 Bacteria 6320
337 Ga0500616_0015754 3300053153 Bacteria 4315
338 2510843098 2510461069 Bacteria 5505000
339 2511827903 2511231156 Bacteria 6845832
340 2537901502 2537561592 Bacteria 4348607
341 2558906173 2558860112 Bacteria 9931328
342 2562462672 2561511199 Bacteria 5155034
343 2599767881 2599185248 Bacteria 6696816
344 2599887803 2599185289 Bacteria 6778765
345 2599899506 2599185291 Bacteria 6775623
346 2599962156 2599185305 Bacteria 6748700
347 2600007164 2599185313 Bacteria 6658188
348 2600019528 2599185315 Bacteria 6771107
349 2600054038 2599185321 Bacteria 6764560
350 2600072060 2599185324 Bacteria 6590677
351 2600443258 2600254954 Bacteria 5100516
352 2602009261 2600255389 Bacteria 5275336
353 2643982317 2643221594 Bacteria 5811388
354 2644062553 2643221609 Bacteria 6756331
355 2644076417 2643221611 Bacteria 6820941
356 2644282948 2643221650 Bacteria 7029547
357 2644637760 2643221715 Bacteria 6671032
358 2671092010 2667528170 Bacteria 6786960
359 2678266423 2675903515 Bacteria 6580491
360 2722883282 2721755523 Bacteria 6430384
361 2729908279 2728369276 Bacteria 5610032
362 2738722591 2738541277 Bacteria 7458140
363 2739245340 2738543012 Bacteria 7115078
364 2739283162 2738543019 Bacteria 7459457
365 2740165824 2739367898 Bacteria 4367674
366 2745007653 2744054620 Bacteria 6551379
367 2774396971 2773857762 Bacteria 5971770
368 2795785563 2795385470 Bacteria 8317180
369 2809198617 2808606439 Bacteria 5952208
370 2812352809 2811994878 Bacteria 5992952
371 2816474705 2816332133 Bacteria 7249298
372 2823424868 2823421272 Bacteria 5372474
373 2839143777 2839138175 Bacteria 6549354
374 2839986076 2839986021 Bacteria 3685650
375 2842722049 2842718218 Bacteria 4560148
376 2852678995 2852677369 Bacteria 3768884
377 2855733441 2855730933 Bacteria 7047938
378 2855772342 2855767633 Bacteria 7049357
379 2857743538 2857740372 Bacteria 4782044
380 2871284435 2871282230 Bacteria 4917173
381 2881417573 2881412998 Bacteria 6492157
382 2891969645 2891968417 Bacteria 5821697
383 2900053958 2900051742 Bacteria 4985156
384 2900054431 2900051742 Bacteria 4985156
385 2902794777 2902792274 Bacteria 7270173
386 2902816661 2902810491 Bacteria 6794147
387 2904480401 2904479285 Bacteria 5073931
388 2904589629 2904584206 Bacteria 6028872
389 2904595278 2904589729 Bacteria 6113573
390 2913042809 2913036834 Bacteria 6704877
391 2919392581 2919391150 Bacteria 4884741
392 2919504605 2919501602 Bacteria 5286340
393 2926064822 2926063275 Bacteria 5285848
394 2928078030 2928070936 Bacteria 8062541
395 2928117887 2928115317 Bacteria 6477646
396 2929212484 2929212328 Bacteria 7708288
397 2945976147 2945972063 Bacteria 6086495
398 2974323282 2974320154 Bacteria 4571377
399 2988731744 2988728565 Bacteria 6124362
400 3001890108 3001889506 Bacteria 2975194
401 8034962851 8034962539 Bacteria 4884839
402 8054610339 8054609563 Bacteria 5170090
403 8054930391 8054929484 Bacteria 5599761
404 nmdc:mga00v17_306_c1
405 JGI24751J29686_10004756
406 JGI25151J46595_10007862
407 Ga0055524_1000085
408 Ga0055524_1033898
409 Ga0055534_1004543
410 Ga0055530_10001191
411 Ga0055540_1000056
412 Ga0055531_10002398
413 Ga0058692_1000411
414 Ga0070676_10036232
415 Ga0070670_100000509
416 Ga0070670_100161535
417 Ga0070666_10068843
418 Ga0068868_100034550
419 Ga0070668_100162169
420 Ga0070669_100015447
421 Ga0070669_100075082
422 Ga0070675_100003522
423 Ga0070671_100006034
424 Ga0070671_100048027
425 Ga0070671_100069253
426 Ga0070674_100069123
427 Ga0070674_100198130
428 Ga0070673_100004724
429 Ga0070667_100052327
430 Ga0070713_100138416
431 Ga0070700_100062821
432 Ga0070678_100004250
433 Ga0068867_100010732
434 Ga0068867_100039797
435 Ga0068867_100053524
436 Ga0070707_100400547
437 Ga0070699_100087429
438 Ga0068853_100048547
439 Ga0070672_100002485
440 Ga0070672_100045341
441 Ga0070696_100006772
442 Ga0070665_100009219
443 Ga0070665_100019623
444 Ga0068864_100017875
445 Ga0068861_100093302
446 Ga0068863_100000256
447 Ga0068858_100026823
448 Ga0081539_10000155
449 Ga0075365_10029298
450 Ga0075368_10065601
451 Ga0075363_100008905
452 Ga0075364_10000592
453 Ga0075364_10000665
454 Ga0075364_10002347
455 Ga0075364_10005678
456 Ga0075364_10022219
457 Ga0075367_10014443
458 Ga0075367_10121911
459 Ga0075366_10010070
460 Ga0075366_10017765
461 Ga0097621_100029243
462 Ga0075370_10038036
463 Ga0075370_10070381
464 Ga0068871_100003669
465 Ga0075428_100247677
466 Ga0079104_1000007
467 Ga0079104_1001781
468 Ga0105251_10000032
469 Ga0105250_10000241
470 Ga0105250_10049437
471 Ga0111539_10008419
472 Ga0105243_10004088
473 Ga0105243_10121904
474 Ga0105242_10000164
475 Ga0105242_10044652
476 Ga0105238_10194386
477 Ga0105238_10257413
478 Ga0105246_10070567
479 Ga0157371_10000157
480 Ga0157378_10043252
481 Ga0163162_10052297
482 Ga0163162_10116022
483 Ga0163162_10190296
484 Ga0163162_10301400
485 Ga0157375_10051363
486 Ga0157375_10064033
487 Ga0163163_10047273
488 Ga0157380_10136004
489 Ga0182008_10034019
490 Ga0157379_10048367
491 Ga0157379_10088586
492 Ga0182007_10015940
493 Ga0163161_10009037
494 Ga0213872_10003908
495 Ga0209565_1007265
496 Ga0209130_1005211
497 Ga0209675_1003411
498 Ga0209675_1006227
499 Ga0209676_1024737
500 Ga0209676_1026654
501 Ga0209025_1000028
502 Ga0209025_1000868
503 Ga0209050_1001130
504 Ga0209256_1000036
505 Ga0209256_1000127
506 Ga0209051_1000068
507 Ga0209051_1001275
508 Ga0209051_1001318
509 Ga0209051_1007096
510 Ga0209051_1010768
511 Ga0209257_1000146
512 Ga0209257_1010202
513 Ga0207696_1000363
514 Ga0207713_1000020
515 Ga0207713_1000060
516 Ga0207682_10002426
517 Ga0207682_10032532
518 Ga0207688_10042364
519 Ga0207662_10088267
520 Ga0207681_10012967
521 Ga0207681_10092786
522 Ga0207694_10123188
523 Ga0207650_10009829
524 Ga0207659_10064054
525 Ga0207644_10002799
526 Ga0207644_10007467
527 Ga0207709_10000112
528 Ga0207669_10008204
529 Ga0207691_10000186
530 Ga0207691_10009406
531 Ga0207651_10015332
532 Ga0207651_10159268
533 Ga0207658_10032939
534 Ga0207658_10038443
535 Ga0207658_10067877
536 Ga0207677_10114766
537 Ga0207703_10031008
538 Ga0207641_10007810
539 Ga0207648_10000629
540 Ga0207648_10035113
541 Ga0207648_10048841
542 Ga0207676_10014346
543 Ga0207683_10015213
544 Ga0207683_10031808
545 Ga0207683_10078210
546 Ga0207683_10105990
547 Ga0209281_1000020
548 Ga0209281_1000883
549 Ga0209371_1000033
550 Ga0207428_10007707
551 Ga0268266_10004323
552 Ga0268266_10023825
553 Ga0268264_10033190
554 Ga0307515_10000219
555 Ga0307515_10001249
556 Ga0307515_10008172
557 Ga0307515_10131178
558 Ga0268256_1001121
559 Ga0314311_1071918
560 Ga0316183_1035810
561 Ga0316181_1220031
562 Ga0265327_10014732
563 Ga0307513_10025388
564 Ga0307408_100000025
565 Ga0307408_100002328
566 Ga0307408_100008982
567 Ga0307408_100016863
568 Ga0307408_100018955
569 Ga0307408_100129851
570 Ga0307408_100165351
571 Ga0307514_10002106
572 Ga0265342_10097352
573 Ga0307516_10002784
574 Ga0307405_10000093
575 Ga0307405_10016869
576 Ga0307410_10085995
577 Ga0307406_10005950
578 Ga0307406_10008357
579 Ga0307407_10027113
580 Ga0307407_10100904
581 Ga0307412_10000174
582 Ga0307412_10001039
583 Ga0307409_100033870
584 Ga0307409_100347985
585 Ga0307416_100083057
586 Ga0307416_100189193
587 Ga0307414_10013127
588 Ga0307414_10101076
589 Ga0307411_10052452
590 Ga0307411_10151415
591 Ga0307415_100105288
592 Ga0307415_100111314
593 Ga0307415_100166680
594 Ga0307510_10016491
595 Ga0307510_10064668
596 Ga0395905_0018604
597 Ga0395905_0120493
598 Ga0395901_0189500
599 Ga0436361_0289253
600 Ga0439438_000124
601 Ga0439466_0000104
602 Ga0439466_0058558
603 Ga0439465_0008447
604 Ga0439465_0063398
605 Ga0451837_0068199
606 Ga0451843_0906194
607 Ga0439431_0001177
608 Ga0439445_0001270
609 Ga0439434_0003123
610 Ga0450901_000200
611 Ga0466972_0035274
612 Ga0466965_0022148
613 Ga0466970_0063855
614 Ga0466960_0009013
615 Ga0495617_009721
616 Ga0495590_0013860
617 Ga0495591_001996
618 Ga0495650_0000710
619 Ga0495580_0045842
620 Ga0495605_0025530
621 Ga0495664_0112606
622 Ga0495584_0010751
623 Ga0495585_0043676
624 Ga0495607_0000168
625 Ga0495607_0005795
626 Ga0495583_0000008
627 Ga0495583_0001112
628 Ga0495606_0000032
629 Ga0495606_0000042
630 Ga0495606_0083168
631 Ga0495608_0146509
632 Ga0495631_0003004
633 Ga0495632_0005956
634 Ga0495637_0000073
635 Ga0495637_0000171
636 Ga0495643_0028715
637 Ga0495644_0001175
638 Ga0495648_0014467
639 Ga0495654_0001087
640 Ga0495654_0008036
641 Ga0495609_0000456
642 Ga0495621_0007269
643 Ga0495622_0001439
644 Ga0495656_0038142
645 Ga0495625_0000010
646 Ga0495625_0084752
647 Ga0495661_0000790
648 Ga0495670_0018862
649 Ga0495671_0000560
650 Ga0495671_0022136
651 Ga0495649_0023752
652 Ga0495660_0027169
653 Ga0495672_0005078
654 Ga0495672_0034586
655 Ga0495672_0037160
656 Ga0495676_0000002
657 Ga0495687_005857
658 Ga0495679_000243
659 Ga0495673_0001431
660 Ga0495673_0023751
661 Ga0495681_0003032
662 Ga0495686_0000739
663 Ga0495626_0000319
664 Ga0496102_0003948
665 Ga0496102_0026929
666 Ga0496104_0017394
667 Ga0496105_0020462
668 Ga0496108_0168934
669 Ga0496109_0083439
670 Ga0496109_0317726
671 Ga0496111_0118188
672 Ga0496114_0017488
673 Ga0496114_0021038
674 Ga0496114_0300904
675 Ga0496116_0000205
676 Ga0496121_0003643
677 Ga0496121_0085366
678 Ga0496122_0000167
679 Ga0496123_0000127
680 Ga0496124_0033913
681 Ga0496124_0063229
682 Ga0496125_0006302
683 Ga0496126_0116745
684 Ga0501031_0030991
685 Ga0501032_0001224
686 Ga0501032_0085180
687 Ga0501033_0028329
688 Ga0501034_0000279
689 Ga0501034_0008088
690 Ga0501036_0026250
691 Ga0501037_0067598
692 Ga0501038_0077951
693 Ga0501041_0073981
694 Ga0501042_0015988
695 Ga0501043_0006542
696 Ga0501046_0145360
697 Ga0501047_0028825
698 Ga0501047_0112349
699 Ga0501071_0037736
700 Ga0501072_0021093
701 Ga0501074_0210692
702 Ga0501076_0174602
703 Ga0501077_0057423
704 Ga0501079_0053604
705 Ga0501080_0332260
706 Ga0501081_0051864
707 Ga0501035_0015073
708 Ga0501035_0279784
709 Ga0501044_0007871
710 Ga0501045_0074847
711 Ga0501226_000001
712 nmdc:mga03683_25261_c1
713 nmdc:mga03683_86604_c1
714 nmdc:mga03n38_105275_c1
715 nmdc:mga00v17_140684_c1
716 nmdc:mga00v17_18566_c1
717 nmdc:mga00v17_26699_c1
718 nmdc:mga00v17_7102_c1
719 nmdc:mga00v17_92781_c1
720 nmdc:mga0yw44_211619_c1
721 nmdc:mga0yw44_37933_c1
722 nmdc:mga0yw44_84198_c1
723 nmdc:mga0yw44_98395_c1
724 nmdc:mga0k408_13381_c1
725 nmdc:mga0k408_346_c1
726 nmdc:mga06z11_179078_c1
727 nmdc:mga07m45_44997_c1
728 nmdc:mga07m45_51402_c1
729 nmdc:mga06r32_106012_c1
730 nmdc:mga0sz30_20424_c1
731 nmdc:mga0sz30_5667_c1
732 Ga0500643_002156
733 Ga0500583_0000752
734 Ga0500651_0131904
735 Ga0500562_005129
736 Ga0500562_030595
737 Ga0500608_006764
738 Ga0500658_0110228
739 Ga0500616_0008600
740 Ga0500616_0015754
741 2510843098
742 2511827903
743 2537901502
744 2558906173
745 2562462672
746 2599767881
747 2599887803
748 2599899506
749 2599962156
750 2600007164
751 2600019528
752 2600054038
753 2600072060
754 2600443258
755 2602009261
756 2643982317
757 2644062553
758 2644076417
759 2644282948
760 2644637760
761 2671092010
762 2678266423
763 2722883282
764 2729908279
765 2738722591
766 2739245340
767 2739283162
768 2740165824
769 2745007653
770 2774396971
771 2795785563
772 2809198617
773 2812352809
774 2816474705
775 2823424868
776 2839143777
777 2839986076
778 2842722049
779 2852678995
780 2855733441
781 2855772342
782 2857743538
783 2871284435
784 2881417573
785 2891969645
786 2900053958
787 2900054431
788 2902794777
789 2902816661
790 2904480401
791 2904589629
792 2904595278
793 2913042809
794 2919392581
795 2919504605
796 2926064822
797 2928078030
798 2928117887
799 2929212484
800 2945976147
801 2974323282
802 2988731744
803 3001890108
804 8034962851
805 8054610339
806 8054930391

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13378

MR_MLE_C

Enolase C-terminal domain-like

217

423

0.95

PF02746

MR_MLE_N

Mandelate racemase / muconate lactonizing enzyme, N-terminal domain

88

195

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pp3-assembly1.cif.gz_B crystal structure of l-talarate/galactarate dehydratase mutant k197a liganded with mg and l-glucarate 0.9905 1 372
2pp0-assembly1.cif.gz_B crystal structure of l-talarate/galactarate dehydratase from salmonella typhimurium lt2 0.9903 1 372
2pp1-assembly3.cif.gz_C crystal structure of l-talarate/galactarate dehydratase from salmonella typhimurium lt2 liganded with mg and l-lyxarohydroxamate 0.9902 1 372
2pp3-assembly1.cif.gz_B crystal structure of l-talarate/galactarate dehydratase mutant k197a liganded with mg and l-glucarate 0.9878 1 372
2pp0-assembly1.cif.gz_B crystal structure of l-talarate/galactarate dehydratase from salmonella typhimurium lt2 0.9877 1 372
ID Description Score Start End Superfamily
2pp0A01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9811 1 125 3.30.390.10
2og9B02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.98 126 356 3.20.20.120
2og9B02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9757 126 356 3.20.20.120
2og9A01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9704 1 125 3.30.390.10
3ck5D02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9496 127 356 3.20.20.120
ID Description Score Start End GO Terms
AF-A0A2A6HRY2-F1-model_v4 Enolase 0.9921 3 371 GO:0000287
GO:0008867
GO:0009063
GO:0016052
GO:1990594
AF-A0A4V2LY26-F1-model_v4 Mandelate racemase/muconate lactonizing enzyme family protein 0.9918 3 369 GO:0000287
GO:0008867
GO:0009063
GO:0016052
GO:1990594
AF-A0A7C9PKQ1-F1-model_v4 Mandelate racemase/muconate lactonizing enzyme family protein 0.9918 1 372 GO:0000287
GO:0008867
GO:0009063
GO:0016052
GO:1990594
AF-F5XKS5-F1-model_v4 Putative mandelate racemase (EC 5.1.2.2) 0.9917 3 372 GO:0000287
GO:0008867
GO:0009063
GO:0016052
GO:0018838
GO:1990594
AF-A0A379VZZ6-F1-model_v4 Racemase (EC 5.1.2.2) 0.9917 173 372 GO:0000287
GO:0009063
GO:0016052
GO:0016836
GO:0018838

Map