F435488

General Info

Members Datasets Scaffolds Average Seq Length
403 235 806 423

Family's Representative Sequence

Representative Sequence 3300046535|Ga0495586_0014580|Ga0495586_0014580_2555_3928
Length 457
Sequence VHQNASTRDTTTHTKAKEEGVHINLNRRWLAVSLPIVAALVTLCAASTGGAASGPSGAITVWVDAVRLPVAKLYAKTHPNVHLNIVTYDGDGNGATTMQTKIQLWNRTGNGWPDVIFTEQANDPVWMGQKPFDFAMDLKGAFPQISGWPKPSLAQCTVNGHLVCLQDNLAQEVLYVNKKLMKKFGYEVPTTWQQWAALGQKVAKEHPGYIIGNIGDSYGAWLYLWANKCPLSQVVGPNTVKIDASDAHCTRMAKLLDPLIESGVVPPESVFTADFAKKWGGAGDKILMMPGPTWYAHDIFSGTLHVPAGELTAAMPLRWNKEPLVTGQVGGGPWVVSKHTENKAAAIDFVKWVTTTNEAKAVAPGYPSYGPAAEAWLKKLDADPYYAAPESPAMKAAANLVWQGWNMVTYPDQPVWSNSVVTQLVAGKSLSSLLPALGKGLAQNAQAAGYKVVSNET

Samples

Sample ID Description Type Environment
1 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
110 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
111 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
112 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
113 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
114 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
115 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
116 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
117 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
118 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
119 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
120 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
121 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
122 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
123 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
124 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
127 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
128 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
134 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
135 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
136 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
139 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
140 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
141 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
153 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
154 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
159 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
160 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
161 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
162 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
168 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
171 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
172 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
173 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
174 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
175 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
176 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
177 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
178 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
179 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
180 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
184 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
185 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
186 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
187 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
188 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
189 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
190 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
191 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
192 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
193 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
194 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
197 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
198 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
199 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
200 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
201 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
202 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
203 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
221 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
222 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
223 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
224 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
225 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
230 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
233 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
234 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
235 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.72
Nodule 0
Rhizoplane 11.91
Rhizosphere 83.13
Stem 0
Stem Tuber 0
Unclassified 1.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495586_0014580 3300046535 Bacteria 4176
2 JGI25406J46586_10005176 3300003203 Bacteria 6050
3 rootL2_10040281 3300003322 Bacteria 3609
4 rootL2_10071243 3300003322 Bacteria 2804
5 Ga0070683_100001535 3300005329 Bacteria 17866
6 Ga0070668_100000299 3300005347 Bacteria 32488
7 Ga0070668_100004195 3300005347 Bacteria 10683
8 Ga0070671_100239862 3300005355 Bacteria 1539
9 Ga0070674_100059584 3300005356 Bacteria 2658
10 Ga0070673_100286344 3300005364 Bacteria 1447
11 Ga0070667_100005078 3300005367 Bacteria 11017
12 Ga0070667_100011166 3300005367 Bacteria 7431
13 Ga0070709_10025125 3300005434 Bacteria 3516
14 Ga0070709_10125493 3300005434 Bacteria 1746
15 Ga0070714_100005338 3300005435 Bacteria 9798
16 Ga0070714_100051672 3300005435 Bacteria 3505
17 Ga0070714_100062271 3300005435 Bacteria 3206
18 Ga0070714_100100561 3300005435 Bacteria 2547
19 Ga0070713_100025308 3300005436 Bacteria 4638
20 Ga0070713_100103865 3300005436 Bacteria 2466
21 Ga0070713_100179537 3300005436 Bacteria 1901
22 Ga0070710_10013982 3300005437 Bacteria 4031
23 Ga0070711_100133898 3300005439 Bacteria 1849
24 Ga0070663_100011171 3300005455 Bacteria 5624
25 Ga0070663_100022826 3300005455 Bacteria 4187
26 Ga0070678_100066178 3300005456 Bacteria 2686
27 Ga0070678_100206383 3300005456 Bacteria 1625
28 Ga0070662_100186690 3300005457 Bacteria 1637
29 Ga0070685_10086594 3300005466 Bacteria 1889
30 Ga0070706_100012141 3300005467 Bacteria 7989
31 Ga0070707_100007315 3300005468 Bacteria 10251
32 Ga0070699_100020812 3300005518 Bacteria 5657
33 Ga0070679_100040980 3300005530 Bacteria 4609
34 Ga0070684_100000757 3300005535 Bacteria 22376
35 Ga0070684_100248169 3300005535 Bacteria 1627
36 Ga0070672_100038795 3300005543 Bacteria 3643
37 Ga0070693_100004545 3300005547 Bacteria 6577
38 Ga0068856_100005046 3300005614 Bacteria 13069
39 Ga0068856_100085543 3300005614 Bacteria 3132
40 Ga0068856_100214962 3300005614 Bacteria 1938
41 Ga0070702_100002161 3300005615 Bacteria 8360
42 Ga0068859_100042741 3300005617 Bacteria 4553
43 Ga0068864_100016395 3300005618 Bacteria 6167
44 Ga0068866_10010926 3300005718 Bacteria 3912
45 Ga0068866_10081004 3300005718 Bacteria 1743
46 Ga0068863_100071660 3300005841 Bacteria 3278
47 Ga0068863_100158135 3300005841 Bacteria 2170
48 Ga0068863_100200274 3300005841 Bacteria 1921
49 Ga0068858_100045756 3300005842 Bacteria 4057
50 Ga0068860_100000787 3300005843 Bacteria 35457
51 Ga0068860_100007981 3300005843 Bacteria 10558
52 Ga0068860_100074748 3300005843 Bacteria 3223
53 Ga0068862_100042640 3300005844 Bacteria 3866
54 Ga0068862_100109199 3300005844 Bacteria 2427
55 Ga0081455_10000543 3300005937 Bacteria 49007
56 Ga0081455_10023493 3300005937 Bacteria 5734
57 Ga0081539_10001931 3300005985 Bacteria 31888
58 Ga0081539_10005085 3300005985 Bacteria 13786
59 Ga0081539_10021773 3300005985 Bacteria 4267
60 Ga0070717_10004236 3300006028 Bacteria 10346
61 Ga0070717_10020106 3300006028 Bacteria 5247
62 Ga0070717_10034618 3300006028 Bacteria 4085
63 Ga0075365_10056732 3300006038 Bacteria 2604
64 Ga0075368_10001055 3300006042 Bacteria 8624
65 Ga0075363_100002248 3300006048 Bacteria 7816
66 Ga0075364_10000061 3300006051 Bacteria 40845
67 Ga0075364_10106117 3300006051 Bacteria 1872
68 Ga0070712_100052416 3300006175 Bacteria 2845
69 Ga0075362_10005284 3300006177 Bacteria 4712
70 Ga0075367_10016691 3300006178 Bacteria 4013
71 Ga0097621_100130375 3300006237 Bacteria 2140
72 Ga0075370_10004050 3300006353 Bacteria 7045
73 Ga0068871_100009009 3300006358 Bacteria 7207
74 Ga0075428_100071089 3300006844 Bacteria 3804
75 Ga0075433_10079383 3300006852 Bacteria 2892
76 Ga0075433_10086433 3300006852 Bacteria 2769
77 Ga0075433_10217711 3300006852 Bacteria 1697
78 Ga0075434_100040599 3300006871 Bacteria 4608
79 Ga0075434_100176794 3300006871 Bacteria 2154
80 Ga0097620_100042740 3300006931 Bacteria 4553
81 Ga0105245_10000717 3300009098 Bacteria 29866
82 Ga0105247_10064003 3300009101 Bacteria 2284
83 Ga0114129_10175596 3300009147 Bacteria 2918
84 Ga0105243_10021424 3300009148 Bacteria 4906
85 Ga0105243_10050246 3300009148 Bacteria 3293
86 Ga0105243_10123464 3300009148 Bacteria 2187
87 Ga0105241_10040966 3300009174 Bacteria 3498
88 Ga0105242_10031492 3300009176 Bacteria 4237
89 Ga0105242_10059023 3300009176 Bacteria 3147
90 Ga0105242_10104762 3300009176 Bacteria 2402
91 Ga0105248_10007905 3300009177 Bacteria 11686
92 Ga0105248_10023921 3300009177 Bacteria 6790
93 Ga0105248_10102923 3300009177 Bacteria 3218
94 Ga0105237_10022947 3300009545 Bacteria 6399
95 Ga0105239_10431372 3300010375 Bacteria 1494
96 Ga0105246_10015162 3300011119 Bacteria 4861
97 Ga0105246_10102247 3300011119 Bacteria 2089
98 Ga0157343_1000528 3300012488 Bacteria 1550
99 Ga0157374_10070313 3300013296 Bacteria 3298
100 Ga0157378_10007512 3300013297 Bacteria 9519
101 Ga0157375_10021592 3300013308 Bacteria 5907
102 Ga0157375_10087092 3300013308 Bacteria 3175
103 Ga0163163_10095811 3300014325 Bacteria 2988
104 Ga0163163_10170217 3300014325 Bacteria 2225
105 Ga0157380_10014665 3300014326 Bacteria 5739
106 Ga0157379_10004573 3300014968 Bacteria 11871
107 Ga0157379_10009574 3300014968 Bacteria 8438
108 Ga0157376_10227732 3300014969 Bacteria 1730
109 Ga0213871_10003700 3300021441 Bacteria 2982
110 Ga0207692_10033523 3300025898 Bacteria 2478
111 Ga0207642_10044264 3300025899 Bacteria 1969
112 Ga0207710_10032119 3300025900 Bacteria 2299
113 Ga0207699_10045985 3300025906 Bacteria 2550
114 Ga0207699_10049434 3300025906 Bacteria 2475
115 Ga0207699_10079537 3300025906 Bacteria 2028
116 Ga0207643_10003066 3300025908 Bacteria 8981
117 Ga0207643_10016026 3300025908 Bacteria 4082
118 Ga0207684_10017090 3300025910 Bacteria 6229
119 Ga0207654_10007166 3300025911 Bacteria 5615
120 Ga0207654_10018755 3300025911 Bacteria 3636
121 Ga0207654_10020128 3300025911 Bacteria 3532
122 Ga0207707_10141443 3300025912 Bacteria 2104
123 Ga0207671_10016058 3300025914 Bacteria 5834
124 Ga0207693_10033185 3300025915 Bacteria 4074
125 Ga0207663_10085529 3300025916 Bacteria 2077
126 Ga0207663_10146389 3300025916 Bacteria 1652
127 Ga0207660_10080224 3300025917 Bacteria 2396
128 Ga0207650_10040891 3300025925 Bacteria 3395
129 Ga0207687_10004967 3300025927 Bacteria 8820
130 Ga0207700_10005169 3300025928 Bacteria 7772
131 Ga0207700_10063120 3300025928 Bacteria 2816
132 Ga0207700_10109238 3300025928 Bacteria 2222
133 Ga0207664_10003317 3300025929 Bacteria 10705
134 Ga0207664_10011113 3300025929 Bacteria 6379
135 Ga0207664_10154822 3300025929 Bacteria 1950
136 Ga0207686_10082103 3300025934 Bacteria 2106
137 Ga0207709_10069531 3300025935 Bacteria 2229
138 Ga0207709_10069557 3300025935 Bacteria 2229
139 Ga0207669_10009387 3300025937 Bacteria 4657
140 Ga0207665_10040703 3300025939 Bacteria 3102
141 Ga0207691_10069679 3300025940 Bacteria 3177
142 Ga0207711_10062537 3300025941 Bacteria 3211
143 Ga0207689_10029792 3300025942 Bacteria 4552
144 Ga0207661_10001775 3300025944 Bacteria 14755
145 Ga0207661_10044337 3300025944 Bacteria 3515
146 Ga0207661_10061414 3300025944 Bacteria 3036
147 Ga0207668_10023420 3300025972 Bacteria 3968
148 Ga0207658_10028856 3300025986 Bacteria 3911
149 Ga0207658_10052393 3300025986 Bacteria 3011
150 Ga0207703_10027059 3300026035 Bacteria 4517
151 Ga0207678_10000318 3300026067 Bacteria 43470
152 Ga0207678_10135402 3300026067 Unclassified 2102
153 Ga0207708_10048060 3300026075 Bacteria 3248
154 Ga0207702_10014577 3300026078 Bacteria 6524
155 Ga0207702_10116364 3300026078 Bacteria 2386
156 Ga0207702_10177808 3300026078 Bacteria 1957
157 Ga0207641_10086598 3300026088 Bacteria 2732
158 Ga0207648_10058471 3300026089 Bacteria 3362
159 Ga0207676_10073348 3300026095 Bacteria 2754
160 Ga0207674_10091544 3300026116 Bacteria 3031
161 Ga0207674_10365238 3300026116 Bacteria 1395
162 Ga0207675_100068681 3300026118 Bacteria 3312
163 Ga0207683_10003521 3300026121 Bacteria 13653
164 Ga0268265_10013586 3300028380 Bacteria 5536
165 Ga0268264_10000748 3300028381 Bacteria 36682
166 Ga0265337_1000156 3300028556 Bacteria 34716
167 Ga0265319_1000843 3300028563 Bacteria 19562
168 Ga0265319_1000874 3300028563 Bacteria 19171
169 Ga0265319_1013722 3300028563 Bacteria 3206
170 Ga0265334_10000743 3300028573 Bacteria 16337
171 Ga0265318_10002383 3300028577 Bacteria 10060
172 Ga0265318_10004859 3300028577 Bacteria 6417
173 Ga0265318_10012892 3300028577 Bacteria 3544
174 Ga0265323_10003677 3300028653 Bacteria 6723
175 Ga0265322_10013583 3300028654 Bacteria 2356
176 Ga0265322_10025703 3300028654 Bacteria 1683
177 Ga0265336_10001413 3300028666 Bacteria 11078
178 Ga0265338_10005379 3300028800 Bacteria 16731
179 Ga0265338_10018594 3300028800 Bacteria 7425
180 Ga0265338_10042917 3300028800 Bacteria 4204
181 Ga0265324_10001619 3300029957 Bacteria 12511
182 Ga0265332_10002633 3300031238 Bacteria 9038
183 Ga0265320_10005408 3300031240 Bacteria 8205
184 Ga0265320_10020939 3300031240 Bacteria 3530
185 Ga0265320_10049074 3300031240 Bacteria 2056
186 Ga0265329_10034655 3300031242 Bacteria 1630
187 Ga0265340_10006442 3300031247 Bacteria 6460
188 Ga0265340_10028834 3300031247 Bacteria 2790
189 Ga0265331_10045848 3300031250 Bacteria 2109
190 Ga0265327_10028672 3300031251 Bacteria 3178
191 Ga0265316_10005960 3300031344 Bacteria 11735
192 Ga0307408_100060494 3300031548 Bacteria 2761
193 Ga0265313_10015172 3300031595 Bacteria 4506
194 Ga0265314_10005141 3300031711 Bacteria 11898
195 Ga0265314_10008586 3300031711 Bacteria 8736
196 Ga0265342_10010346 3300031712 Bacteria 6483
197 Ga0307406_10045958 3300031901 Bacteria 2744
198 Ga0307407_10106723 3300031903 Bacteria 1750
199 Ga0307409_100000630 3300031995 Bacteria 15504
200 Ga0307415_100000139 3300032126 Bacteria 31946
201 Ga0307415_100001876 3300032126 Bacteria 10318
202 Ga0307415_100202042 3300032126 Bacteria 1578
203 Ga0307507_10041727 3300033179 Bacteria 4586
204 Ga0373926_0002568 3300035083 Bacteria 5766
205 Ga0373944_0023348 3300035089 Bacteria 1803
206 Ga0373923_0000111 3300035111 Bacteria 14710
207 Ga0373936_0000876 3300035113 Bacteria 10732
208 Ga0373956_0002592 3300035119 Bacteria 7328
209 Ga0373957_0010952 3300035120 Bacteria 3012
210 Ga0373946_0000551 3300035171 Bacteria 12406
211 Ga0373924_0000341 3300035410 Bacteria 14305
212 Ga0373935_0001054 3300035692 Bacteria 15012
213 Ga0373927_0002395 3300035695 Bacteria 13669
214 Ga0373927_0005178 3300035695 Bacteria 9016
215 Ga0373933_0003331 3300035724 Bacteria 8958
216 Ga0373947_0000829 3300035725 Bacteria 18654
217 Ga0373947_0004220 3300035725 Bacteria 8427
218 Ga0373937_0011210 3300036401 Bacteria 7859
219 Ga0373937_0015781 3300036401 Bacteria 6692
220 Ga0373937_0033619 3300036401 Bacteria 4659
221 Ga0373925_0000630 3300037068 Bacteria 33327
222 Ga0373925_0013673 3300037068 Bacteria 5877
223 Ga0395898_0182421 3300037466 Bacteria 2006
224 Ga0395898_0255654 3300037466 Bacteria 1671
225 Ga0395905_0119645 3300037471 Bacteria 2475
226 Ga0395901_0006011 3300038443 Bacteria 12297
227 Ga0395901_0099567 3300038443 Bacteria 3048
228 Ga0436365_0758000 3300039437 Bacteria 2300
229 Ga0436360_0329066 3300039438 Bacteria 2065
230 Ga0436360_0777850 3300039438 Bacteria 12828
231 Ga0436361_0591612 3300039447 Bacteria 2345
232 Ga0436362_1239628 3300039453 Bacteria 1516
233 Ga0451853_0546778 3300041512 Bacteria 2342
234 Ga0466972_0007582 3300044658 Bacteria 5449
235 Ga0466966_0002695 3300044684 Bacteria 11638
236 Ga0466966_0069681 3300044684 Bacteria 2206
237 Ga0466963_0002807 3300044694 Bacteria 9818
238 Ga0466963_0007064 3300044694 Bacteria 6685
239 Ga0466963_0007522 3300044694 Bacteria 6499
240 Ga0466963_0009854 3300044694 Bacteria 5766
241 Ga0466963_0012937 3300044694 Bacteria 5115
242 Ga0466963_0025338 3300044694 Bacteria 3783
243 Ga0466963_0169614 3300044694 Bacteria 1521
244 Ga0466964_0000622 3300044706 Bacteria 11276
245 Ga0466964_0016846 3300044706 Bacteria 2794
246 Ga0466971_0033300 3300044719 Bacteria 2309
247 Ga0466971_0060901 3300044719 Bacteria 1706
248 Ga0466970_0045471 3300044765 Bacteria 2338
249 Ga0466960_0096404 3300044901 Bacteria 1516
250 Ga0466959_0004903 3300045049 Bacteria 9062
251 Ga0466959_0063938 3300045049 Bacteria 2672
252 Ga0466959_0129329 3300045049 Bacteria 1790
253 Ga0451576_0112564 3300045051 Bacteria 2833
254 Ga0466958_0008863 3300045836 Bacteria 5589
255 Ga0466958_0021456 3300045836 Bacteria 3775
256 Ga0466967_0001669 3300045976 Bacteria 13154
257 Ga0466967_0013089 3300045976 Bacteria 6390
258 Ga0466967_0013536 3300045976 Bacteria 6309
259 Ga0466967_0017270 3300045976 Bacteria 5722
260 Ga0466967_0054501 3300045976 Unclassified 3519
261 Ga0466967_0065658 3300045976 Bacteria 3231
262 Ga0466967_0065712 3300045976 Bacteria 3229
263 Ga0466967_0073164 3300045976 Bacteria 3074
264 Ga0466967_0279522 3300045976 Bacteria 1601
265 Ga0495592_0166401 3300046454 Bacteria 1513
266 Ga0495603_0002107 3300046455 Bacteria 11707
267 Ga0495603_0037336 3300046455 Bacteria 2915
268 Ga0495603_0143534 3300046455 Bacteria 1388
269 Ga0495629_0003673 3300046459 Bacteria 11592
270 Ga0495629_0053440 3300046459 Bacteria 2826
271 Ga0495641_0000503 3300046461 Bacteria 32708
272 Ga0495641_0011922 3300046461 Bacteria 4904
273 Ga0495651_0019067 3300046462 Bacteria 5316
274 Ga0495651_0043560 3300046462 Bacteria 3481
275 Ga0495651_0089756 3300046462 Bacteria 2306
276 Ga0495580_0002808 3300046472 Bacteria 14980
277 Ga0495582_0003261 3300046473 Bacteria 9111
278 Ga0495582_0086528 3300046473 Bacteria 1744
279 Ga0495639_0000258 3300046475 Bacteria 26363
280 Ga0495662_0000059 3300046476 Bacteria 37941
281 Ga0495664_0000374 3300046477 Bacteria 21730
282 Ga0495594_0027692 3300046499 Bacteria 3055
283 Ga0495594_0107056 3300046499 Bacteria 1575
284 Ga0495608_0002973 3300046511 Bacteria 12119
285 Ga0495608_0003413 3300046511 Bacteria 11378
286 Ga0495618_0002534 3300046514 Bacteria 11703
287 Ga0495628_0157423 3300046516 Bacteria 1727
288 Ga0495628_0224755 3300046516 Unclassified 1409
289 Ga0495630_0021692 3300046517 Bacteria 4742
290 Ga0495630_0049995 3300046517 Bacteria 3128
291 Ga0495652_0065222 3300046529 Bacteria 3060
292 Ga0495665_0000181 3300046531 Bacteria 32208
293 Ga0495640_0003942 3300046533 Bacteria 11883
294 Ga0495640_0009085 3300046533 Bacteria 7755
295 Ga0495586_0001645 3300046535 Bacteria 12256
296 Ga0495587_0022838 3300046536 Bacteria 3849
297 Ga0495645_0038638 3300046543 Bacteria 3481
298 Ga0495667_0001251 3300046559 Bacteria 16652
299 Ga0495634_0006618 3300046642 Bacteria 8788
300 Ga0495634_0021360 3300046642 Bacteria 4577
301 Ga0495634_0051393 3300046642 Bacteria 2765
302 Ga0495635_0001054 3300046663 Bacteria 18250
303 Ga0495635_0002232 3300046663 Bacteria 13160
304 Ga0495635_0057182 3300046663 Bacteria 2684
305 Ga0495635_0083712 3300046663 Bacteria 2183
306 Ga0495588_0003918 3300046674 Bacteria 6525
307 Ga0495657_0012599 3300046675 Bacteria 6275
308 Ga0495657_0126251 3300046675 Bacteria 1606
309 Ga0495599_0119391 3300046678 Bacteria 1639
310 Ga0495599_0124149 3300046678 Bacteria 1605
311 Ga0495646_0010113 3300046680 Bacteria 5998
312 Ga0495647_0007981 3300046681 Bacteria 3558
313 Ga0495658_0002615 3300046683 Bacteria 9047
314 Ga0495658_0036539 3300046683 Bacteria 2711
315 Ga0495613_0022968 3300046689 Bacteria 4647
316 Ga0495613_0027066 3300046689 Bacteria 4268
317 Ga0495581_0002296 3300047315 Bacteria 10768
318 Ga0495581_0094435 3300047315 Bacteria 1736
319 Ga0495604_0101159 3300047317 Bacteria 2117
320 Ga0495604_0146986 3300047317 Unclassified 1679
321 Ga0495674_0020736 3300047319 Bacteria 6085
322 Ga0495674_0047280 3300047319 Bacteria 3816
323 Ga0495676_0042691 3300047321 Bacteria 3720
324 Ga0495680_0001683 3300047322 Bacteria 23498
325 Ga0495680_0004608 3300047322 Bacteria 13139
326 Ga0495680_0013553 3300047322 Bacteria 7106
327 Ga0495680_0020187 3300047322 Bacteria 5611
328 Ga0495680_0068486 3300047322 Bacteria 2711
329 Ga0495684_0124618 3300047471 Bacteria 1939
330 Ga0495593_0001208 3300047673 Bacteria 15108
331 Ga0495602_0053620 3300048088 Bacteria 3569
332 Ga0495602_0163864 3300048088 Bacteria 1733
333 Ga0496100_0021740 3300048903 Bacteria 3870
334 Ga0496101_0027547 3300048904 Bacteria 3960
335 Ga0496101_0038049 3300048904 Bacteria 3415
336 Ga0496102_0036789 3300048905 Bacteria 4412
337 Ga0496103_0015182 3300048906 Bacteria 4579
338 Ga0496103_0016099 3300048906 Bacteria 4462
339 Ga0496104_0002210 3300048907 Bacteria 16821
340 Ga0496104_0009700 3300048907 Bacteria 8579
341 Ga0496104_0017512 3300048907 Bacteria 6526
342 Ga0496104_0076340 3300048907 Bacteria 3192
343 Ga0496104_0158908 3300048907 Bacteria 2168
344 Ga0496105_0012527 3300048908 Bacteria 6714
345 Ga0496105_0029938 3300048908 Bacteria 4458
346 Ga0496105_0083948 3300048908 Bacteria 2630
347 Ga0496105_0094054 3300048908 Bacteria 2475
348 Ga0496105_0118187 3300048908 Bacteria 2187
349 Ga0496105_0137253 3300048908 Bacteria 2014
350 Ga0496105_0210660 3300048908 Bacteria 1584
351 Ga0496106_0047129 3300048909 Bacteria 3242
352 Ga0496107_0082736 3300048910 Bacteria 2341
353 Ga0496107_0218488 3300048910 Unclassified 1418
354 Ga0496108_0002141 3300048911 Bacteria 15828
355 Ga0496108_0005855 3300048911 Bacteria 9967
356 Ga0496108_0055270 3300048911 Bacteria 3333
357 Ga0496108_0102872 3300048911 Bacteria 2437
358 Ga0496108_0141346 3300048911 Bacteria 2074
359 Ga0496109_0002085 3300048912 Bacteria 16614
360 Ga0496109_0028167 3300048912 Bacteria 5023
361 Ga0496109_0336882 3300048912 Unclassified 1424
362 Ga0496110_0009129 3300048913 Bacteria 8005
363 Ga0496110_0016675 3300048913 Bacteria 6137
364 Ga0496110_0029383 3300048913 Bacteria 4730
365 Ga0496110_0031052 3300048913 Bacteria 4608
366 Ga0496110_0136271 3300048913 Bacteria 2218
367 Ga0496110_0191438 3300048913 Unclassified 1858
368 Ga0496111_0000861 3300048914 Bacteria 16447
369 Ga0496111_0019879 3300048914 Bacteria 4670
370 Ga0496111_0048846 3300048914 Bacteria 3050
371 Ga0496111_0065808 3300048914 Bacteria 2631
372 Ga0496111_0105065 3300048914 Bacteria 2078
373 Ga0496111_0190651 3300048914 Bacteria 1524
374 Ga0496113_0030111 3300048916 Bacteria 3926
375 Ga0496113_0048454 3300048916 Bacteria 3161
376 Ga0496113_0199263 3300048916 Viruses 1591
377 Ga0496114_0000247 3300048917 Bacteria 39314
378 Ga0496114_0034611 3300048917 Bacteria 4169
379 Ga0496114_0045325 3300048917 Bacteria 3652
380 Ga0496115_0026440 3300048918 Bacteria 4530
381 Ga0501068_0039229 3300049584 Bacteria 2840
382 nmdc:mga03n38_35036_c1 3300050490 Bacteria 2148
383 nmdc:mga00v17_44949_c1 3300050491 Bacteria 2666
384 nmdc:mga00v17_62346_c1 3300050491 Bacteria 2294
385 nmdc:mga0yw44_14719_c1 3300050492 Bacteria 4164
386 nmdc:mga04h51_10427_c1 3300050495 Bacteria 2552
387 nmdc:mga07m45_82240_c1 3300050496 Bacteria 1839
388 nmdc:mga05p37_4326_c2 3300050507 Bacteria 13197
389 nmdc:mga05p37_79798_c1 3300050507 Bacteria 4030
390 nmdc:mga0n895_41025_c1 3300050512 Bacteria 4498
391 nmdc:mga0a205_221333_c1 3300050515 Bacteria 1778
392 nmdc:mga0a205_83014_c1 3300050515 Bacteria 3095
393 Ga0495601_0009132 3300053077 Bacteria 5854
394 Ga0495612_0003695 3300053078 Bacteria 6352
395 Ga0495619_0000806 3300053085 Bacteria 20483
396 Ga0495619_0049151 3300053085 Bacteria 2781
397 Ga0495619_0070772 3300053085 Bacteria 2333
398 Ga0495619_0118378 3300053085 Bacteria 1815
399 Ga0500620_029533 3300053155 Bacteria 1723
400 Ga0501082_0072401 3300060353 Bacteria 2969
401 Ga0466962_0025173 3300061719 Bacteria 2857
402 Ga0466962_0044654 3300061719 Bacteria 2120
403 2753266472 2751185782 Bacteria 11227053
404 Ga0495586_0014580
405 JGI25406J46586_10005176
406 rootL2_10040281
407 rootL2_10071243
408 Ga0070683_100001535
409 Ga0070668_100000299
410 Ga0070668_100004195
411 Ga0070671_100239862
412 Ga0070674_100059584
413 Ga0070673_100286344
414 Ga0070667_100005078
415 Ga0070667_100011166
416 Ga0070709_10025125
417 Ga0070709_10125493
418 Ga0070714_100005338
419 Ga0070714_100051672
420 Ga0070714_100062271
421 Ga0070714_100100561
422 Ga0070713_100025308
423 Ga0070713_100103865
424 Ga0070713_100179537
425 Ga0070710_10013982
426 Ga0070711_100133898
427 Ga0070663_100011171
428 Ga0070663_100022826
429 Ga0070678_100066178
430 Ga0070678_100206383
431 Ga0070662_100186690
432 Ga0070685_10086594
433 Ga0070706_100012141
434 Ga0070707_100007315
435 Ga0070699_100020812
436 Ga0070679_100040980
437 Ga0070684_100000757
438 Ga0070684_100248169
439 Ga0070672_100038795
440 Ga0070693_100004545
441 Ga0068856_100005046
442 Ga0068856_100085543
443 Ga0068856_100214962
444 Ga0070702_100002161
445 Ga0068859_100042741
446 Ga0068864_100016395
447 Ga0068866_10010926
448 Ga0068866_10081004
449 Ga0068863_100071660
450 Ga0068863_100158135
451 Ga0068863_100200274
452 Ga0068858_100045756
453 Ga0068860_100000787
454 Ga0068860_100007981
455 Ga0068860_100074748
456 Ga0068862_100042640
457 Ga0068862_100109199
458 Ga0081455_10000543
459 Ga0081455_10023493
460 Ga0081539_10001931
461 Ga0081539_10005085
462 Ga0081539_10021773
463 Ga0070717_10004236
464 Ga0070717_10020106
465 Ga0070717_10034618
466 Ga0075365_10056732
467 Ga0075368_10001055
468 Ga0075363_100002248
469 Ga0075364_10000061
470 Ga0075364_10106117
471 Ga0070712_100052416
472 Ga0075362_10005284
473 Ga0075367_10016691
474 Ga0097621_100130375
475 Ga0075370_10004050
476 Ga0068871_100009009
477 Ga0075428_100071089
478 Ga0075433_10079383
479 Ga0075433_10086433
480 Ga0075433_10217711
481 Ga0075434_100040599
482 Ga0075434_100176794
483 Ga0097620_100042740
484 Ga0105245_10000717
485 Ga0105247_10064003
486 Ga0114129_10175596
487 Ga0105243_10021424
488 Ga0105243_10050246
489 Ga0105243_10123464
490 Ga0105241_10040966
491 Ga0105242_10031492
492 Ga0105242_10059023
493 Ga0105242_10104762
494 Ga0105248_10007905
495 Ga0105248_10023921
496 Ga0105248_10102923
497 Ga0105237_10022947
498 Ga0105239_10431372
499 Ga0105246_10015162
500 Ga0105246_10102247
501 Ga0157343_1000528
502 Ga0157374_10070313
503 Ga0157378_10007512
504 Ga0157375_10021592
505 Ga0157375_10087092
506 Ga0163163_10095811
507 Ga0163163_10170217
508 Ga0157380_10014665
509 Ga0157379_10004573
510 Ga0157379_10009574
511 Ga0157376_10227732
512 Ga0213871_10003700
513 Ga0207692_10033523
514 Ga0207642_10044264
515 Ga0207710_10032119
516 Ga0207699_10045985
517 Ga0207699_10049434
518 Ga0207699_10079537
519 Ga0207643_10003066
520 Ga0207643_10016026
521 Ga0207684_10017090
522 Ga0207654_10007166
523 Ga0207654_10018755
524 Ga0207654_10020128
525 Ga0207707_10141443
526 Ga0207671_10016058
527 Ga0207693_10033185
528 Ga0207663_10085529
529 Ga0207663_10146389
530 Ga0207660_10080224
531 Ga0207650_10040891
532 Ga0207687_10004967
533 Ga0207700_10005169
534 Ga0207700_10063120
535 Ga0207700_10109238
536 Ga0207664_10003317
537 Ga0207664_10011113
538 Ga0207664_10154822
539 Ga0207686_10082103
540 Ga0207709_10069531
541 Ga0207709_10069557
542 Ga0207669_10009387
543 Ga0207665_10040703
544 Ga0207691_10069679
545 Ga0207711_10062537
546 Ga0207689_10029792
547 Ga0207661_10001775
548 Ga0207661_10044337
549 Ga0207661_10061414
550 Ga0207668_10023420
551 Ga0207658_10028856
552 Ga0207658_10052393
553 Ga0207703_10027059
554 Ga0207678_10000318
555 Ga0207678_10135402
556 Ga0207708_10048060
557 Ga0207702_10014577
558 Ga0207702_10116364
559 Ga0207702_10177808
560 Ga0207641_10086598
561 Ga0207648_10058471
562 Ga0207676_10073348
563 Ga0207674_10091544
564 Ga0207674_10365238
565 Ga0207675_100068681
566 Ga0207683_10003521
567 Ga0268265_10013586
568 Ga0268264_10000748
569 Ga0265337_1000156
570 Ga0265319_1000843
571 Ga0265319_1000874
572 Ga0265319_1013722
573 Ga0265334_10000743
574 Ga0265318_10002383
575 Ga0265318_10004859
576 Ga0265318_10012892
577 Ga0265323_10003677
578 Ga0265322_10013583
579 Ga0265322_10025703
580 Ga0265336_10001413
581 Ga0265338_10005379
582 Ga0265338_10018594
583 Ga0265338_10042917
584 Ga0265324_10001619
585 Ga0265332_10002633
586 Ga0265320_10005408
587 Ga0265320_10020939
588 Ga0265320_10049074
589 Ga0265329_10034655
590 Ga0265340_10006442
591 Ga0265340_10028834
592 Ga0265331_10045848
593 Ga0265327_10028672
594 Ga0265316_10005960
595 Ga0307408_100060494
596 Ga0265313_10015172
597 Ga0265314_10005141
598 Ga0265314_10008586
599 Ga0265342_10010346
600 Ga0307406_10045958
601 Ga0307407_10106723
602 Ga0307409_100000630
603 Ga0307415_100000139
604 Ga0307415_100001876
605 Ga0307415_100202042
606 Ga0307507_10041727
607 Ga0373926_0002568
608 Ga0373944_0023348
609 Ga0373923_0000111
610 Ga0373936_0000876
611 Ga0373956_0002592
612 Ga0373957_0010952
613 Ga0373946_0000551
614 Ga0373924_0000341
615 Ga0373935_0001054
616 Ga0373927_0002395
617 Ga0373927_0005178
618 Ga0373933_0003331
619 Ga0373947_0000829
620 Ga0373947_0004220
621 Ga0373937_0011210
622 Ga0373937_0015781
623 Ga0373937_0033619
624 Ga0373925_0000630
625 Ga0373925_0013673
626 Ga0395898_0182421
627 Ga0395898_0255654
628 Ga0395905_0119645
629 Ga0395901_0006011
630 Ga0395901_0099567
631 Ga0436365_0758000
632 Ga0436360_0329066
633 Ga0436360_0777850
634 Ga0436361_0591612
635 Ga0436362_1239628
636 Ga0451853_0546778
637 Ga0466972_0007582
638 Ga0466966_0002695
639 Ga0466966_0069681
640 Ga0466963_0002807
641 Ga0466963_0007064
642 Ga0466963_0007522
643 Ga0466963_0009854
644 Ga0466963_0012937
645 Ga0466963_0025338
646 Ga0466963_0169614
647 Ga0466964_0000622
648 Ga0466964_0016846
649 Ga0466971_0033300
650 Ga0466971_0060901
651 Ga0466970_0045471
652 Ga0466960_0096404
653 Ga0466959_0004903
654 Ga0466959_0063938
655 Ga0466959_0129329
656 Ga0451576_0112564
657 Ga0466958_0008863
658 Ga0466958_0021456
659 Ga0466967_0001669
660 Ga0466967_0013089
661 Ga0466967_0013536
662 Ga0466967_0017270
663 Ga0466967_0054501
664 Ga0466967_0065658
665 Ga0466967_0065712
666 Ga0466967_0073164
667 Ga0466967_0279522
668 Ga0495592_0166401
669 Ga0495603_0002107
670 Ga0495603_0037336
671 Ga0495603_0143534
672 Ga0495629_0003673
673 Ga0495629_0053440
674 Ga0495641_0000503
675 Ga0495641_0011922
676 Ga0495651_0019067
677 Ga0495651_0043560
678 Ga0495651_0089756
679 Ga0495580_0002808
680 Ga0495582_0003261
681 Ga0495582_0086528
682 Ga0495639_0000258
683 Ga0495662_0000059
684 Ga0495664_0000374
685 Ga0495594_0027692
686 Ga0495594_0107056
687 Ga0495608_0002973
688 Ga0495608_0003413
689 Ga0495618_0002534
690 Ga0495628_0157423
691 Ga0495628_0224755
692 Ga0495630_0021692
693 Ga0495630_0049995
694 Ga0495652_0065222
695 Ga0495665_0000181
696 Ga0495640_0003942
697 Ga0495640_0009085
698 Ga0495586_0001645
699 Ga0495587_0022838
700 Ga0495645_0038638
701 Ga0495667_0001251
702 Ga0495634_0006618
703 Ga0495634_0021360
704 Ga0495634_0051393
705 Ga0495635_0001054
706 Ga0495635_0002232
707 Ga0495635_0057182
708 Ga0495635_0083712
709 Ga0495588_0003918
710 Ga0495657_0012599
711 Ga0495657_0126251
712 Ga0495599_0119391
713 Ga0495599_0124149
714 Ga0495646_0010113
715 Ga0495647_0007981
716 Ga0495658_0002615
717 Ga0495658_0036539
718 Ga0495613_0022968
719 Ga0495613_0027066
720 Ga0495581_0002296
721 Ga0495581_0094435
722 Ga0495604_0101159
723 Ga0495604_0146986
724 Ga0495674_0020736
725 Ga0495674_0047280
726 Ga0495676_0042691
727 Ga0495680_0001683
728 Ga0495680_0004608
729 Ga0495680_0013553
730 Ga0495680_0020187
731 Ga0495680_0068486
732 Ga0495684_0124618
733 Ga0495593_0001208
734 Ga0495602_0053620
735 Ga0495602_0163864
736 Ga0496100_0021740
737 Ga0496101_0027547
738 Ga0496101_0038049
739 Ga0496102_0036789
740 Ga0496103_0015182
741 Ga0496103_0016099
742 Ga0496104_0002210
743 Ga0496104_0009700
744 Ga0496104_0017512
745 Ga0496104_0076340
746 Ga0496104_0158908
747 Ga0496105_0012527
748 Ga0496105_0029938
749 Ga0496105_0083948
750 Ga0496105_0094054
751 Ga0496105_0118187
752 Ga0496105_0137253
753 Ga0496105_0210660
754 Ga0496106_0047129
755 Ga0496107_0082736
756 Ga0496107_0218488
757 Ga0496108_0002141
758 Ga0496108_0005855
759 Ga0496108_0055270
760 Ga0496108_0102872
761 Ga0496108_0141346
762 Ga0496109_0002085
763 Ga0496109_0028167
764 Ga0496109_0336882
765 Ga0496110_0009129
766 Ga0496110_0016675
767 Ga0496110_0029383
768 Ga0496110_0031052
769 Ga0496110_0136271
770 Ga0496110_0191438
771 Ga0496111_0000861
772 Ga0496111_0019879
773 Ga0496111_0048846
774 Ga0496111_0065808
775 Ga0496111_0105065
776 Ga0496111_0190651
777 Ga0496113_0030111
778 Ga0496113_0048454
779 Ga0496113_0199263
780 Ga0496114_0000247
781 Ga0496114_0034611
782 Ga0496114_0045325
783 Ga0496115_0026440
784 Ga0501068_0039229
785 nmdc:mga03n38_35036_c1
786 nmdc:mga00v17_44949_c1
787 nmdc:mga00v17_62346_c1
788 nmdc:mga0yw44_14719_c1
789 nmdc:mga04h51_10427_c1
790 nmdc:mga07m45_82240_c1
791 nmdc:mga05p37_4326_c2
792 nmdc:mga05p37_79798_c1
793 nmdc:mga0n895_41025_c1
794 nmdc:mga0a205_221333_c1
795 nmdc:mga0a205_83014_c1
796 Ga0495601_0009132
797 Ga0495612_0003695
798 Ga0495619_0000806
799 Ga0495619_0049151
800 Ga0495619_0070772
801 Ga0495619_0118378
802 Ga0500620_029533
803 Ga0501082_0072401
804 Ga0466962_0025173
805 Ga0466962_0044654
806 2753266472

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

60

360

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vfq-assembly1.cif.gz_A wild type glta from bifidobacterium infantis jcm 1222 complexed with lacto-n-tetraose 0.8258 43 442
6hus-assembly1.cif.gz_A 2'-fucosyllactose and 3-fucosyllactose binding protein from bifidobacterium longum infantis, bound with 3-fucosyllactose 0.8229 39 444
7vfq-assembly2.cif.gz_B wild type glta from bifidobacterium infantis jcm 1222 complexed with lacto-n-tetraose 0.8218 43 442
7vfr-assembly1.cif.gz_A glta n83k mutant from bifidobacterium infantis jcm 1222 complexed with lacto-n-tetraose 0.8203 43 442
7vfq-assembly1.cif.gz_A wild type glta from bifidobacterium infantis jcm 1222 complexed with lacto-n-tetraose 0.8181 43 442
ID Description Score Start End Superfamily
3k02A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7975 41 157 3.40.190.10
4r9gB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7752 43 156 3.40.190.10
3uorB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7694 43 156 3.40.190.10
2dfzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.767 43 157 3.40.190.10
2ghaA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.764 41 157 3.40.190.10
ID Description Score Start End GO Terms
AF-G0FVQ0-F1-model_v4 deleted 0.9832 48 442
AF-G0FVQ0-F1-model_v4 deleted 0.9807 48 442
AF-U5W7Z1-F1-model_v4 Extracellular solute-binding protein 0.9566 43 442 GO:0030313
AF-A0A7W4UYJ5-F1-model_v4 ABC-type glycerol-3-phosphate transport system substrate-binding protein 0.947 43 444 GO:0030313
AF-A0A7X5XA54-F1-model_v4 Solute-binding lipoprotein 0.9364 120 442

Map