F435465

General Info

Members Datasets Scaffolds Average Seq Length
403 211 394 188

Family's Representative Sequence

Representative Sequence 3300044683|Ga0466965_0014956|Ga0466965_0014956_1653_2249
Length 198
Sequence VGEEETIRMPKHYTLAELDDAAEALRNGGVIAYPTEAVFGLGCDPHDRVAFERIFALKQRPATQGVLLIAADFAQITRYVDMTKVPQGVLAQVRASWPGPFTWVFPRSNDVPDWVAGAHEGIALRVTGHGPAAALCRAFGGALVSTSANPHGQPPARDVATVTAYFGDALDGVVDAPLGGAAQPTTIRDALTGAIIRS

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
3 2738541307 Variovorax sp. GV008 Isolate Unclassified
4 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
5 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
6 2919085039 Luteibacter sp. 1214 Isolate Unclassified
7 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
8 2941471342 Luteibacter sp. 621 Isolate Unclassified
9 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
10 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
11 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
12 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
17 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
18 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
19 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
20 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
21 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
22 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
23 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
85 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
86 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
87 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
88 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
97 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
98 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
100 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
101 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
104 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
105 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
106 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
156 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
157 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
158 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
159 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
160 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
161 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
162 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
163 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
164 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
165 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
166 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
167 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
168 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
169 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
175 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
176 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
177 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
178 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
179 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
180 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
181 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
184 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
185 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
186 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
187 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
188 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
189 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
190 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
193 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
205 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.27
Metatranscriptomes 0.5
Isolates 2.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.38
Nodule 0
Rhizoplane 0.5
Rhizosphere 74.94
Stem 0
Stem Tuber 0
Unclassified 8.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000705 3300002737 Bacteria 23246
2 JGI25162J39368_1001445 3300002737 Bacteria 12645
3 JGI25157J39369_1001046 3300002741 Bacteria 12637
4 JGI25157J39369_1001662 3300002741 Bacteria 7585
5 JGI25164J39214_1000347 3300002772 Bacteria 29028
6 JGI25164J39214_1000714 3300002772 Bacteria 12645
7 JGI25164J39214_1000718 3300002772 Bacteria 12581
8 JGI25164J39214_1000761 3300002772 Bacteria 11822
9 JGI25165J46597_1000640 3300003214 Bacteria 29018
10 JGI25165J46597_1001443 3300003214 Bacteria 12645
11 JGI25165J46597_1003068 3300003214 Bacteria 4520
12 rootL2_10038685 3300003322 Bacteria 1418
13 rootH1_10292646 3300003323 Bacteria 1203
14 Ga0055538_1003613 3300003751 Bacteria 1925
15 Ga0055539_1002420 3300003752 Bacteria 2868
16 Ga0055533_1002475 3300003756 Bacteria 4179
17 Ga0055533_1003063 3300003756 Bacteria 3536
18 Ga0055533_1017870 3300003756 Bacteria 669
19 Ga0055525_1000082 3300003759 Bacteria 159396
20 Ga0055527_1000176 3300003760 Bacteria 43621
21 Ga0055527_1000179 3300003760 Bacteria 42841
22 Ga0055535_1000373 3300003761 Bacteria 42794
23 Ga0055535_1000405 3300003761 Bacteria 40615
24 Ga0055535_1001379 3300003761 Bacteria 12645
25 Ga0055535_1001457 3300003761 Bacteria 11944
26 Ga0055542_1000394 3300003762 Bacteria 43618
27 Ga0055542_1000431 3300003762 Bacteria 40271
28 Ga0055542_1000734 3300003762 Bacteria 25435
29 Ga0055542_1001349 3300003762 Bacteria 12645
30 Ga0055529_1000420 3300003763 Bacteria 43618
31 Ga0055529_1000428 3300003763 Bacteria 42837
32 Ga0055529_1001072 3300003763 Bacteria 12645
33 Ga0070690_100236913 3300005330 Bacteria 1285
34 Ga0070682_100003420 3300005337 Bacteria 8801
35 Ga0070682_100005911 3300005337 Bacteria 6841
36 Ga0070682_100144425 3300005337 Bacteria 1626
37 Ga0070682_100145605 3300005337 Bacteria 1620
38 Ga0070660_100098216 3300005339 Bacteria 2317
39 Ga0070661_100043073 3300005344 Bacteria 3297
40 Ga0070675_100124335 3300005354 Bacteria 2194
41 Ga0070674_100976625 3300005356 Bacteria 742
42 Ga0070673_100668224 3300005364 Bacteria 952
43 Ga0070688_100503788 3300005365 Bacteria 914
44 Ga0070659_100060238 3300005366 Bacteria 2998
45 Ga0070659_100064017 3300005366 Bacteria 2910
46 Ga0070659_100078899 3300005366 Bacteria 2627
47 Ga0070714_100000136 3300005435 Bacteria 58402
48 Ga0070714_100009681 3300005435 Bacteria 7589
49 Ga0070713_100000663 3300005436 Bacteria 22010
50 Ga0070711_100176577 3300005439 Bacteria 1632
51 Ga0070694_101231724 3300005444 Bacteria 628
52 Ga0070663_100029737 3300005455 Bacteria 3736
53 Ga0070678_100111094 3300005456 Bacteria 2144
54 Ga0070678_100158743 3300005456 Bacteria 1830
55 Ga0070662_100157119 3300005457 Bacteria 1776
56 Ga0070681_10013810 3300005458 Bacteria 8037
57 Ga0070681_10184664 3300005458 Bacteria 2006
58 Ga0070681_10298921 3300005458 Bacteria 1520
59 Ga0068867_100036463 3300005459 Bacteria 3570
60 Ga0070679_100030348 3300005530 Bacteria 5338
61 Ga0070684_100042993 3300005535 Bacteria 3902
62 Ga0070684_100276450 3300005535 Bacteria 1538
63 Ga0068853_100002290 3300005539 Bacteria 14303
64 Ga0068853_100083800 3300005539 Bacteria 2793
65 Ga0068853_100272192 3300005539 Bacteria 1560
66 Ga0068853_100346166 3300005539 Bacteria 1382
67 Ga0070696_100016454 3300005546 Bacteria 4981
68 Ga0070696_100420450 3300005546 Bacteria 1049
69 Ga0070693_100013608 3300005547 Bacteria 4149
70 Ga0070693_100255620 3300005547 Bacteria 1163
71 Ga0068855_100276854 3300005563 Bacteria 1865
72 Ga0070664_100543555 3300005564 Bacteria 1074
73 Ga0068857_100149478 3300005577 Bacteria 2115
74 Ga0068854_100274841 3300005578 Bacteria 1354
75 Ga0068856_100000138 3300005614 Bacteria 73748
76 Ga0068856_100000938 3300005614 Bacteria 31227
77 Ga0068856_100084270 3300005614 Bacteria 3157
78 Ga0068856_100125526 3300005614 Bacteria 2569
79 Ga0068852_100000993 3300005616 Bacteria 18725
80 Ga0068852_100087699 3300005616 Bacteria 2777
81 Ga0068852_100798083 3300005616 Unclassified 958
82 Ga0068859_100695974 3300005617 Bacteria 1107
83 Ga0068864_100832311 3300005618 Bacteria 909
84 Ga0068851_10060724 3300005834 Bacteria 1936
85 Ga0068851_10222379 3300005834 Bacteria 1061
86 Ga0068863_100064829 3300005841 Bacteria 3455
87 Ga0068863_100306591 3300005841 Bacteria 1541
88 Ga0068860_100064748 3300005843 Bacteria 3472
89 Ga0068862_100262438 3300005844 Bacteria 1577
90 Ga0070712_100062304 3300006175 Bacteria 2637
91 Ga0070712_100156822 3300006175 Bacteria 1754
92 Ga0097621_100030828 3300006237 Bacteria 4249
93 Ga0068871_100039270 3300006358 Bacteria 3786
94 Ga0068865_100051306 3300006881 Bacteria 2855
95 Ga0068865_100616334 3300006881 Bacteria 919
96 Ga0097620_100695885 3300006931 Bacteria 1107
97 Ga0105240_10020394 3300009093 Bacteria 8843
98 Ga0105240_10092425 3300009093 Bacteria 3694
99 Ga0105240_10498135 3300009093 Bacteria 1355
100 Ga0105245_11414819 3300009098 Bacteria 746
101 Ga0105241_10113604 3300009174 Bacteria 2171
102 Ga0105241_10143875 3300009174 Bacteria 1944
103 Ga0105242_10623300 3300009176 Bacteria 1045
104 Ga0105237_10000108 3300009545 Bacteria 116481
105 Ga0105237_10178205 3300009545 Bacteria 2126
106 Ga0105237_10475288 3300009545 Bacteria 1256
107 Ga0105238_10077321 3300009551 Bacteria 3319
108 Ga0105238_10094582 3300009551 Bacteria 2976
109 Ga0105238_10284964 3300009551 Bacteria 1634
110 Ga0105238_11059889 3300009551 Bacteria 833
111 Ga0105249_10086206 3300009553 Bacteria 2928
112 Ga0105239_10097327 3300010375 Bacteria 3252
113 Ga0105239_10346308 3300010375 Bacteria 1677
114 Ga0105239_10500660 3300010375 Bacteria 1381
115 Ga0105239_10934979 3300010375 Bacteria 995
116 Ga0157373_10124036 3300013100 Bacteria 1816
117 Ga0157373_10376397 3300013100 Bacteria 1015
118 Ga0157371_10078098 3300013102 Bacteria 2344
119 Ga0157370_10028195 3300013104 Bacteria 5526
120 Ga0157370_10092086 3300013104 Bacteria 2846
121 Ga0157370_10422738 3300013104 Bacteria 1226
122 Ga0157369_10001250 3300013105 Bacteria 31665
123 Ga0157369_10023424 3300013105 Bacteria 6876
124 Ga0157369_10780261 3300013105 Bacteria 982
125 Ga0157369_11052126 3300013105 Bacteria 833
126 Ga0157369_11280052 3300013105 Unclassified 748
127 Ga0157378_10000005 3300013297 Bacteria 197893
128 Ga0157378_10441581 3300013297 Bacteria 1290
129 Ga0163162_10004503 3300013306 Bacteria 13418
130 Ga0163162_10061251 3300013306 Bacteria 3800
131 Ga0163162_10398786 3300013306 Bacteria 1508
132 Ga0157372_10042167 3300013307 Bacteria 5046
133 Ga0157372_10059684 3300013307 Bacteria 4267
134 Ga0157375_10015674 3300013308 Bacteria 6789
135 Ga0163163_10141379 3300014325 Bacteria 2449
136 Ga0182008_10003298 3300014497 Bacteria 9825
137 Ga0182008_10020743 3300014497 Bacteria 3380
138 Ga0182008_10204300 3300014497 Bacteria 1006
139 Ga0157379_10032747 3300014968 Bacteria 4635
140 Ga0157376_10004652 3300014969 Bacteria 9563
141 Ga0157376_10089216 3300014969 Bacteria 2665
142 Ga0182006_1000133 3300015261 Bacteria 80418
143 Ga0182006_1016232 3300015261 Bacteria 3177
144 Ga0182007_10002824 3300015262 Bacteria 8456
145 Ga0182007_10040462 3300015262 Bacteria 1556
146 Ga0182007_10057850 3300015262 Bacteria 1272
147 Ga0182007_10069031 3300015262 Bacteria 1158
148 Ga0182005_1000257 3300015265 Bacteria 33567
149 Ga0182005_1000685 3300015265 Bacteria 15850
150 Ga0183369_1004 3300015685 Bacteria 539301
151 Ga0183368_1002 3300015687 Bacteria 1865598
152 Ga0163161_10072469 3300017792 Bacteria 2522
153 Ga0163161_10092419 3300017792 Bacteria 2240
154 Ga0206354_10274793 3300020081 Bacteria 1358
155 Ga0206353_11873004 3300020082 Bacteria 4290
156 Ga0209784_100053 3300025224 Bacteria 182075
157 Ga0209674_100014 3300025226 Bacteria 704989
158 Ga0209674_100197 3300025226 Bacteria 62877
159 Ga0209674_100550 3300025226 Bacteria 14925
160 Ga0209674_100621 3300025226 Bacteria 13278
161 Ga0209672_100004 3300025228 Bacteria 1467504
162 Ga0209672_100008 3300025228 Bacteria 946876
163 Ga0209672_100826 3300025228 Bacteria 14489
164 Ga0209672_101804 3300025228 Bacteria 6565
165 Ga0209563_100097 3300025230 Bacteria 159453
166 Ga0207427_100044 3300025231 Bacteria 242623
167 Ga0207427_100061 3300025231 Bacteria 182815
168 Ga0207427_100129 3300025231 Bacteria 94644
169 Ga0209437_100005 3300025233 Bacteria 1071596
170 Ga0209437_100037 3300025233 Bacteria 459730
171 Ga0209437_100118 3300025233 Bacteria 207534
172 Ga0209258_100003 3300025242 Bacteria 1467504
173 Ga0209258_100004 3300025242 Bacteria 1376422
174 Ga0209258_100008 3300025242 Bacteria 1009355
175 Ga0209258_100090 3300025242 Bacteria 232619
176 Ga0209258_100138 3300025242 Bacteria 167495
177 Ga0209258_100479 3300025242 Bacteria 42065
178 Ga0209258_108074 3300025242 Bacteria 1512
179 Ga0209646_1001101 3300025246 Bacteria 8009
180 Ga0209026_1000010 3300025250 Bacteria 511986
181 Ga0209026_1000104 3300025250 Bacteria 152614
182 Ga0209026_1000553 3300025250 Bacteria 25735
183 Ga0209677_100976 3300025253 Bacteria 13869
184 Ga0209148_1000001 3300025254 Bacteria 2545271
185 Ga0209148_1000016 3300025254 Bacteria 804369
186 Ga0209148_1000041 3300025254 Bacteria 469323
187 Ga0209148_1000065 3300025254 Bacteria 344489
188 Ga0209759_1001467 3300025256 Bacteria 13162
189 Ga0209759_1004437 3300025256 Bacteria 5244
190 Ga0209759_1010286 3300025256 Bacteria 2751
191 Ga0209129_1005329 3300025258 Bacteria 4598
192 Ga0209233_1000002 3300025261 Bacteria 2501366
193 Ga0209233_1000011 3300025261 Bacteria 1071611
194 Ga0209233_1000046 3300025261 Bacteria 470971
195 Ga0209455_1000004 3300025272 Bacteria 1467504
196 Ga0209455_1000007 3300025272 Bacteria 1157983
197 Ga0209455_1000079 3300025272 Bacteria 268778
198 Ga0209455_1000189 3300025272 Bacteria 92877
199 Ga0209758_1000840 3300025297 Bacteria 42856
200 Ga0209257_1031751 3300025304 Bacteria 1685
201 Ga0207656_10090093 3300025321 Bacteria 1391
202 Ga0207642_10033079 3300025899 Bacteria 2184
203 Ga0207680_10121510 3300025903 Bacteria 1708
204 Ga0207647_10000002 3300025904 Bacteria 400771
205 Ga0207647_10033709 3300025904 Bacteria 3275
206 Ga0207647_10075168 3300025904 Bacteria 2034
207 Ga0207699_10258963 3300025906 Bacteria 1202
208 Ga0207654_10084355 3300025911 Bacteria 1920
209 Ga0207654_10207613 3300025911 Bacteria 1293
210 Ga0207654_10267282 3300025911 Bacteria 1152
211 Ga0207707_10033334 3300025912 Bacteria 4508
212 Ga0207707_10091964 3300025912 Bacteria 2651
213 Ga0207695_10000751 3300025913 Bacteria 62399
214 Ga0207695_10034658 3300025913 Bacteria 5486
215 Ga0207695_10329637 3300025913 Bacteria 1415
216 Ga0207695_10399275 3300025913 Bacteria 1259
217 Ga0207671_10001039 3300025914 Bacteria 33742
218 Ga0207671_10056712 3300025914 Bacteria 2903
219 Ga0207671_10627492 3300025914 Bacteria 856
220 Ga0207663_10302989 3300025916 Bacteria 1195
221 Ga0207657_10005348 3300025919 Bacteria 13449
222 Ga0207657_10034179 3300025919 Bacteria 4575
223 Ga0207657_10361214 3300025919 Bacteria 1145
224 Ga0207650_10303997 3300025925 Bacteria 1303
225 Ga0207659_10081448 3300025926 Bacteria 2394
226 Ga0207700_10002250 3300025928 Bacteria 11080
227 Ga0207664_10000150 3300025929 Bacteria 56559
228 Ga0207664_10024414 3300025929 Bacteria 4543
229 Ga0207690_10018888 3300025932 Bacteria 4233
230 Ga0207690_10019423 3300025932 Bacteria 4184
231 Ga0207690_10075080 3300025932 Bacteria 2343
232 Ga0207706_10041079 3300025933 Bacteria 4101
233 Ga0207706_10137663 3300025933 Bacteria 2148
234 Ga0207670_10280065 3300025936 Bacteria 1299
235 Ga0207704_10107734 3300025938 Bacteria 1875
236 Ga0207704_10480075 3300025938 Bacteria 998
237 Ga0207711_10059577 3300025941 Bacteria 3287
238 Ga0207689_10036959 3300025942 Bacteria 4053
239 Ga0207661_10137268 3300025944 Bacteria 2101
240 Ga0207679_10202668 3300025945 Bacteria 1658
241 Ga0207679_10241269 3300025945 Bacteria 1531
242 Ga0207667_10129666 3300025949 Bacteria 2597
243 Ga0207712_10022130 3300025961 Bacteria 4183
244 Ga0207668_10888757 3300025972 Bacteria 792
245 Ga0207640_10026409 3300025981 Bacteria 3525
246 Ga0207640_10109031 3300025981 Bacteria 1958
247 Ga0207640_10304145 3300025981 Bacteria 1263
248 Ga0207658_10209023 3300025986 Bacteria 1634
249 Ga0207658_10992158 3300025986 Bacteria 766
250 Ga0207677_10331958 3300026023 Bacteria 1267
251 Ga0207703_11320740 3300026035 Unclassified 694
252 Ga0207639_10010626 3300026041 Bacteria 6374
253 Ga0207639_10056135 3300026041 Bacteria 3017
254 Ga0207639_10118365 3300026041 Bacteria 2172
255 Ga0207639_10148570 3300026041 Bacteria 1961
256 Ga0207678_10001852 3300026067 Bacteria 19350
257 Ga0207678_10389688 3300026067 Bacteria 1205
258 Ga0207678_10441282 3300026067 Bacteria 1131
259 Ga0207702_10000068 3300026078 Bacteria 116478
260 Ga0207702_10000740 3300026078 Bacteria 34919
261 Ga0207702_10148432 3300026078 Bacteria 2130
262 Ga0207702_10271930 3300026078 Bacteria 1598
263 Ga0207641_10012439 3300026088 Bacteria 6977
264 Ga0207641_10127051 3300026088 Bacteria 2284
265 Ga0207648_10007804 3300026089 Bacteria 10450
266 Ga0207676_10056071 3300026095 Bacteria 3096
267 Ga0207674_10002555 3300026116 Bacteria 22911
268 Ga0207674_10034748 3300026116 Bacteria 5266
269 Ga0207683_10006726 3300026121 Bacteria 9840
270 Ga0207683_10028384 3300026121 Bacteria 4838
271 Ga0207698_10027438 3300026142 Bacteria 4042
272 Ga0207698_10410866 3300026142 Bacteria 1296
273 Ga0268264_10087868 3300028381 Bacteria 2674
274 Ga0265332_10012137 3300031238 Bacteria 3823
275 Ga0307412_10006380 3300031911 Bacteria 6666
276 Ga0395899_0003165 3300037312 Bacteria 13064
277 Ga0395899_0286920 3300037312 Bacteria 1118
278 Ga0395900_0000011 3300037418 Bacteria 421926
279 Ga0395900_0003994 3300037418 Bacteria 15756
280 Ga0395900_0121624 3300037418 Bacteria 2678
281 Ga0395898_0000013 3300037466 Bacteria 458788
282 Ga0395898_0004893 3300037466 Bacteria 14544
283 Ga0395898_0079418 3300037466 Bacteria 3165
284 Ga0395901_0002392 3300038443 Bacteria 19071
285 Ga0395901_0014108 3300038443 Bacteria 8134
286 Ga0395901_0056535 3300038443 Bacteria 4082
287 Ga0395901_0250725 3300038443 Bacteria 1844
288 Ga0395901_0357506 3300038443 Bacteria 1506
289 Ga0395901_1028463 3300038443 Bacteria 798
290 Ga0439436_0000004 3300041404 Bacteria 175137
291 Ga0439465_0014771 3300041413 Bacteria 2435
292 Ga0439454_007983 3300042011 Bacteria 1340
293 Ga0439455_0082845 3300042012 Bacteria 873
294 Ga0466969_0003745 3300044656 Bacteria 8079
295 Ga0466969_0084026 3300044656 Bacteria 1515
296 Ga0466969_0130639 3300044656 Bacteria 1164
297 Ga0466972_0172305 3300044658 Bacteria 1015
298 Ga0466982_0000001 3300044672 Bacteria 514662
299 Ga0466965_0014956 3300044683 Bacteria 3679
300 Ga0466965_0277991 3300044683 Bacteria 903
301 Ga0466966_0003955 3300044684 Bacteria 9793
302 Ga0466966_0051974 3300044684 Bacteria 2604
303 Ga0466961_0000535 3300044693 Bacteria 24166
304 Ga0466961_0001111 3300044693 Bacteria 16550
305 Ga0466961_0021886 3300044693 Bacteria 4113
306 Ga0466961_0285463 3300044693 Bacteria 1009
307 Ga0466971_0001794 3300044719 Bacteria 9109
308 Ga0466971_0078682 3300044719 Bacteria 1502
309 Ga0466971_0151614 3300044719 Unclassified 1082
310 Ga0466968_0048565 3300044735 Bacteria 1806
311 Ga0466970_0068434 3300044765 Bacteria 1907
312 Ga0466970_0139951 3300044765 Bacteria 1332
313 Ga0466970_0269699 3300044765 Bacteria 956
314 Ga0466957_0001515 3300044842 Bacteria 12203
315 Ga0466957_0011846 3300044842 Bacteria 5039
316 Ga0466957_0084013 3300044842 Bacteria 1987
317 Ga0466960_0137340 3300044901 Bacteria 1295
318 Ga0466959_0022722 3300045049 Bacteria 4636
319 Ga0466959_0035404 3300045049 Bacteria 3692
320 Ga0466959_0226298 3300045049 Bacteria 1296
321 Ga0466959_0259815 3300045049 Bacteria 1195
322 Ga0466958_0007247 3300045836 Bacteria 6084
323 Ga0466958_0017645 3300045836 Bacteria 4131
324 Ga0466958_0053028 3300045836 Bacteria 2459
325 Ga0466967_0176391 3300045976 Bacteria 2013
326 Ga0495638_0001087 3300046460 Bacteria 26471
327 Ga0495607_0000006 3300046501 Bacteria 281664
328 Ga0495606_0000016 3300046507 Bacteria 284865
329 Ga0495610_0060292 3300046512 Bacteria 1807
330 Ga0495622_0006861 3300046557 Bacteria 5286
331 Ga0495625_0054251 3300046660 Bacteria 2863
332 Ga0495670_0000599 3300046691 Bacteria 17194
333 Ga0495649_0000450 3300046694 Bacteria 35527
334 Ga0495649_0002369 3300046694 Bacteria 13331
335 Ga0495686_0000426 3300047472 Bacteria 66285
336 Ga0496115_0000729 3300048918 Bacteria 24348
337 Ga0496115_0051557 3300048918 Bacteria 3299
338 Ga0496116_0031157 3300048919 Bacteria 3823
339 Ga0496117_0222564 3300048920 Bacteria 1049
340 Ga0496118_0002160 3300048921 Bacteria 27394
341 Ga0496118_0153116 3300048921 Bacteria 1440
342 Ga0496119_0007834 3300048922 Bacteria 9520
343 Ga0496121_0000116 3300048924 Bacteria 177260
344 Ga0496122_0046307 3300048925 Bacteria 3370
345 Ga0496122_0175508 3300048925 Bacteria 1285
346 Ga0496123_0039574 3300048926 Bacteria 3296
347 Ga0496123_0261540 3300048926 Bacteria 847
348 Ga0496125_0008843 3300048928 Bacteria 10469
349 Ga0496126_0023326 3300048929 Bacteria 5997
350 Ga0496126_0095556 3300048929 Bacteria 2606
351 Ga0495682_0021561 3300049460 Bacteria 2413
352 Ga0501031_0087028 3300049568 Bacteria 2037
353 Ga0501031_0403887 3300049568 Bacteria 883
354 Ga0501031_0440006 3300049568 Bacteria 842
355 Ga0501032_0079442 3300049569 Bacteria 2184
356 Ga0501032_0608184 3300049569 Bacteria 695
357 Ga0501033_0001009 3300049570 Bacteria 25578
358 Ga0501033_0004747 3300049570 Bacteria 10874
359 Ga0501033_0015590 3300049570 Bacteria 5763
360 Ga0501033_0415036 3300049570 Bacteria 938
361 Ga0501034_0039007 3300049571 Bacteria 4811
362 Ga0501034_0319022 3300049571 Bacteria 1487
363 Ga0501034_0630050 3300049571 Bacteria 976
364 Ga0501036_0034826 3300049572 Bacteria 4260
365 Ga0501036_0039004 3300049572 Bacteria 4022
366 Ga0501037_0074941 3300049573 Bacteria 2458
367 Ga0501037_0125242 3300049573 Bacteria 1845
368 Ga0501039_0174414 3300049575 Bacteria 1691
369 Ga0501043_0007069 3300049579 Bacteria 8935
370 Ga0501043_0099758 3300049579 Bacteria 2282
371 Ga0501043_0590609 3300049579 Bacteria 821
372 Ga0501043_0711089 3300049579 Bacteria 733
373 Ga0501046_0032221 3300049580 Bacteria 4244
374 Ga0501047_0013195 3300049581 Bacteria 7825
375 Ga0501047_0210788 3300049581 Bacteria 1801
376 Ga0501047_0399459 3300049581 Bacteria 1207
377 Ga0501048_0187109 3300049582 Bacteria 1467
378 Ga0501048_0466084 3300049582 Bacteria 905
379 Ga0501070_0161249 3300049586 Bacteria 1849
380 Ga0501070_0601708 3300049586 Bacteria 876
381 Ga0501073_0128828 3300049589 Bacteria 1754
382 Ga0501079_0035259 3300049741 Bacteria 3851
383 Ga0501080_0022411 3300049742 Bacteria 5851
384 Ga0501080_0163766 3300049742 Bacteria 2053
385 Ga0501035_0027485 3300049822 Bacteria 5199
386 Ga0501035_0181392 3300049822 Bacteria 1814
387 Ga0501035_0196643 3300049822 Bacteria 1731
388 Ga0501035_0246243 3300049822 Bacteria 1519
389 Ga0501044_0021893 3300049823 Bacteria 6816
390 Ga0501044_0642780 3300049823 Bacteria 950
391 nmdc:mga0n895_763246_c1 3300050512 Bacteria 959
392 Ga0466962_0001335 3300061719 Bacteria 11398
393 Ga0466962_0044629 3300061719 Bacteria 2120
394 Ga0466962_0049688 3300061719 Bacteria 2005

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005844 Ga0068862_100262438 Ga0068862_1002624382 174
2 3300005456 Ga0070678_100111094 Ga0070678_1001110942 175
3 3300005843 Ga0068860_100064748 Ga0068860_1000647483 175
4 3300026121 Ga0207683_10028384 Ga0207683_100283844 175
5 3300050512 nmdc:mga0n895_763246_c1 nmdc:mga0n895_763246_c1_352_903 175
6 3300014969 Ga0157376_10004652 Ga0157376_100046522 177
7 3300009098 Ga0105245_11414819 Ga0105245_114148191 179
8 3300005365 Ga0070688_100503788 Ga0070688_1005037882 181
9 3300005834 Ga0068851_10222379 Ga0068851_102223792 181
10 3300005841 Ga0068863_100306591 Ga0068863_1003065912 181
11 3300013306 Ga0163162_10061251 Ga0163162_100612513 181
12 3300014969 Ga0157376_10089216 Ga0157376_100892162 181
13 3300017792 Ga0163161_10072469 Ga0163161_100724692 181
14 3300025321 Ga0207656_10090093 Ga0207656_100900932 181
15 3300005330 Ga0070690_100236913 Ga0070690_1002369132 183
16 3300005354 Ga0070675_100124335 Ga0070675_1001243352 183
17 3300005457 Ga0070662_100157119 Ga0070662_1001571192 183
18 3300005459 Ga0068867_100036463 Ga0068867_1000364633 183
19 3300005539 Ga0068853_100272192 Ga0068853_1002721922 183
20 3300005563 Ga0068855_100276854 Ga0068855_1002768542 183
21 3300005614 Ga0068856_100125526 Ga0068856_1001255262 183
22 3300005616 Ga0068852_100798083 Ga0068852_1007980832 183
23 3300005618 Ga0068864_100832311 Ga0068864_1008323112 183
24 3300005841 Ga0068863_100064829 Ga0068863_1000648292 183
25 3300006881 Ga0068865_100051306 Ga0068865_1000513062 183
26 3300009176 Ga0105242_10623300 Ga0105242_106233002 183
27 3300009553 Ga0105249_10086206 Ga0105249_100862062 183
28 3300010375 Ga0105239_10934979 Ga0105239_109349792 183
29 3300013104 Ga0157370_10422738 Ga0157370_104227382 183
30 3300013105 Ga0157369_11280052 Ga0157369_112800521 183
31 3300013308 Ga0157375_10015674 Ga0157375_100156745 183
32 3300014325 Ga0163163_10141379 Ga0163163_101413793 183
33 3300017792 Ga0163161_10092419 Ga0163161_100924192 183
34 3300025899 Ga0207642_10033079 Ga0207642_100330792 183
35 3300025911 Ga0207654_10267282 Ga0207654_102672822 183
36 3300025925 Ga0207650_10303997 Ga0207650_103039972 183
37 3300025926 Ga0207659_10081448 Ga0207659_100814482 183
38 3300025933 Ga0207706_10137663 Ga0207706_101376632 183
39 3300025936 Ga0207670_10280065 Ga0207670_102800652 183
40 3300025938 Ga0207704_10107734 Ga0207704_101077342 183
41 3300025942 Ga0207689_10036959 Ga0207689_100369594 183
42 3300025961 Ga0207712_10022130 Ga0207712_100221303 183
43 3300025972 Ga0207668_10888757 Ga0207668_108887572 183
44 3300025981 Ga0207640_10109031 Ga0207640_101090312 183
45 3300026023 Ga0207677_10331958 Ga0207677_103319582 183
46 3300026035 Ga0207703_11320740 Ga0207703_113207402 183
47 3300026041 Ga0207639_10056135 Ga0207639_100561352 183
48 3300026041 Ga0207639_10148570 Ga0207639_101485702 183
49 3300026078 Ga0207702_10271930 Ga0207702_102719302 183
50 3300026088 Ga0207641_10012439 Ga0207641_100124394 183
51 3300026089 Ga0207648_10007804 Ga0207648_100078044 183
52 3300026095 Ga0207676_10056071 Ga0207676_100560711 183
53 3300028381 Ga0268264_10087868 Ga0268264_100878682 183
54 3300046507 Ga0495606_0000016 Ga0495606_0000016_54612_55166 184
55 3300005366 Ga0070659_100064017 Ga0070659_1000640174 185
56 3300005458 Ga0070681_10298921 Ga0070681_102989212 185
57 3300005535 Ga0070684_100042993 Ga0070684_1000429932 185
58 3300005539 Ga0068853_100083800 Ga0068853_1000838002 185
59 3300005547 Ga0070693_100255620 Ga0070693_1002556202 185
60 3300005614 Ga0068856_100084270 Ga0068856_1000842702 185
61 3300005617 Ga0068859_100695974 Ga0068859_1006959742 185
62 3300005834 Ga0068851_10060724 Ga0068851_100607242 185
63 3300006931 Ga0097620_100695885 Ga0097620_1006958852 185
64 3300009093 Ga0105240_10092425 Ga0105240_100924252 185
65 3300009174 Ga0105241_10143875 Ga0105241_101438752 185
66 3300009551 Ga0105238_10284964 Ga0105238_102849642 185
67 3300010375 Ga0105239_10346308 Ga0105239_103463082 185
68 3300013100 Ga0157373_10124036 Ga0157373_101240362 185
69 3300013307 Ga0157372_10042167 Ga0157372_100421674 185
70 3300025903 Ga0207680_10121510 Ga0207680_101215102 185
71 3300025904 Ga0207647_10075168 Ga0207647_100751682 185
72 3300025913 Ga0207695_10034658 Ga0207695_100346584 185
73 3300025919 Ga0207657_10005348 Ga0207657_100053489 185
74 3300025933 Ga0207706_10041079 Ga0207706_100410792 185
75 3300025944 Ga0207661_10137268 Ga0207661_101372682 185
76 3300025945 Ga0207679_10241269 Ga0207679_102412692 185
77 3300025986 Ga0207658_10209023 Ga0207658_102090232 185
78 3300026078 Ga0207702_10148432 Ga0207702_101484322 185
79 3300026116 Ga0207674_10002555 Ga0207674_100025554 185
80 3300026142 Ga0207698_10410866 Ga0207698_104108662 185
81 3300049579 Ga0501043_0711089 Ga0501043_0711089_76_633 185
82 3300049741 Ga0501079_0035259 Ga0501079_0035259_197_754 185
83 3300049742 Ga0501080_0022411 Ga0501080_0022411_2526_3083 185
84 iso_pu_bacteria 2842918807 2842920959 185
85 iso_pu_bacteria 2919085039 2919086477 185
86 iso_pu_bacteria 2941471342 2941472037 185
87 iso_pu_bacteria 2953994433 2953996229 185
88 3300005439 Ga0070711_100176577 Ga0070711_1001765772 186
89 3300005616 Ga0068852_100000993 Ga0068852_10000099313 186
90 3300025906 Ga0207699_10258963 Ga0207699_102589632 186
91 3300025916 Ga0207663_10302989 Ga0207663_103029892 186
92 3300049573 Ga0501037_0125242 Ga0501037_0125242_539_1099 186
93 3300049742 Ga0501080_0163766 Ga0501080_0163766_870_1430 186
94 3300049822 Ga0501035_0181392 Ga0501035_0181392_923_1483 186
95 iso_pu_bacteria 2537561836 2538834380 186
96 iso_pu_bacteria 2643221562 2643828769 186
97 iso_pu_bacteria 2895395659 2895398087 186
98 iso_pu_bacteria 2939611941 2939613470 186
99 3300005356 Ga0070674_100976625 Ga0070674_1009766251 187
100 3300005364 Ga0070673_100668224 Ga0070673_1006682242 187
101 3300005456 Ga0070678_100158743 Ga0070678_1001587431 187
102 3300006237 Ga0097621_100030828 Ga0097621_1000308282 187
103 3300006358 Ga0068871_100039270 Ga0068871_1000392702 187
104 3300006881 Ga0068865_100616334 Ga0068865_1006163341 187
105 3300013105 Ga0157369_11052126 Ga0157369_110521262 187
106 3300013297 Ga0157378_10441581 Ga0157378_104415812 187
107 3300013306 Ga0163162_10004503 Ga0163162_100045035 187
108 3300013306 Ga0163162_10398786 Ga0163162_103987862 187
109 3300014968 Ga0157379_10032747 Ga0157379_100327472 187
110 3300025938 Ga0207704_10480075 Ga0207704_104800752 187
111 3300025941 Ga0207711_10059577 Ga0207711_100595773 187
112 3300025986 Ga0207658_10992158 Ga0207658_109921581 187
113 3300026088 Ga0207641_10127051 Ga0207641_101270512 187
114 3300026121 Ga0207683_10006726 Ga0207683_100067265 187
115 iso_pu_bacteria 2738541307 2738881063 187
116 3300044693 Ga0466961_0000535 Ga0466961_0000535_20965_21531 188
117 3300005535 Ga0070684_100276450 Ga0070684_1002764502 189
118 3300010375 Ga0105239_10500660 Ga0105239_105006602 189
119 3300013104 Ga0157370_10028195 Ga0157370_100281954 189
120 3300013105 Ga0157369_10001250 Ga0157369_1000125027 189
121 3300014497 Ga0182008_10003298 Ga0182008_100032985 189
122 3300015261 Ga0182006_1000133 Ga0182006_100013320 189
123 3300015265 Ga0182005_1000257 Ga0182005_100025715 189
124 3300015265 Ga0182005_1000685 Ga0182005_10006854 189
125 3300025304 Ga0209257_1031751 Ga0209257_10317512 189
126 3300025904 Ga0207647_10000002 Ga0207647_1000000275 189
127 3300031911 Ga0307412_10006380 Ga0307412_100063803 189
128 3300041404 Ga0439436_0000004 Ga0439436_0000004_13180_13749 189
129 3300041413 Ga0439465_0014771 Ga0439465_0014771_205_774 189
130 3300042011 Ga0439454_007983 Ga0439454_007983_231_800 189
131 3300046501 Ga0495607_0000006 Ga0495607_0000006_178829_179398 189
132 3300046512 Ga0495610_0060292 Ga0495610_0060292_496_1065 189
133 3300046691 Ga0495670_0000599 Ga0495670_0000599_11567_12136 189
134 3300046694 Ga0495649_0002369 Ga0495649_0002369_10711_11280 189
135 3300047472 Ga0495686_0000426 Ga0495686_0000426_16386_16955 189
136 3300048919 Ga0496116_0031157 Ga0496116_0031157_177_746 189
137 3300048920 Ga0496117_0222564 Ga0496117_0222564_353_922 189
138 3300048921 Ga0496118_0002160 Ga0496118_0002160_9988_10557 189
139 3300048921 Ga0496118_0153116 Ga0496118_0153116_458_1027 189
140 3300048922 Ga0496119_0007834 Ga0496119_0007834_5685_6254 189
141 3300048924 Ga0496121_0000116 Ga0496121_0000116_93439_94008 189
142 3300048925 Ga0496122_0175508 Ga0496122_0175508_657_1226 189
143 3300048926 Ga0496123_0261540 Ga0496123_0261540_71_640 189
144 3300048928 Ga0496125_0008843 Ga0496125_0008843_7205_7774 189
145 3300048929 Ga0496126_0023326 Ga0496126_0023326_5124_5693 189
146 3300002737 JGI25162J39368_1000705 JGI25162J39368_100070510 190
147 3300002737 JGI25162J39368_1001445 JGI25162J39368_10014452 190
148 3300002741 JGI25157J39369_1001046 JGI25157J39369_10010462 190
149 3300002741 JGI25157J39369_1001662 JGI25157J39369_10016623 190
150 3300002772 JGI25164J39214_1000347 JGI25164J39214_100034719 190
151 3300002772 JGI25164J39214_1000714 JGI25164J39214_10007142 190
152 3300002772 JGI25164J39214_1000718 JGI25164J39214_10007188 190
153 3300002772 JGI25164J39214_1000761 JGI25164J39214_10007618 190
154 3300003214 JGI25165J46597_1000640 JGI25165J46597_100064019 190
155 3300003214 JGI25165J46597_1001443 JGI25165J46597_10014432 190
156 3300003214 JGI25165J46597_1003068 JGI25165J46597_10030684 190
157 3300003322 rootL2_10038685 rootL2_100386852 190
158 3300003323 rootH1_10292646 rootH1_102926462 190
159 3300003751 Ga0055538_1003613 Ga0055538_10036132 190
160 3300003752 Ga0055539_1002420 Ga0055539_10024202 190
161 3300003756 Ga0055533_1002475 Ga0055533_10024753 190
162 3300003756 Ga0055533_1003063 Ga0055533_10030631 190
163 3300003756 Ga0055533_1017870 Ga0055533_10178701 190
164 3300003759 Ga0055525_1000082 Ga0055525_1000082118 190
165 3300003760 Ga0055527_1000176 Ga0055527_100017627 190
166 3300003760 Ga0055527_1000179 Ga0055527_100017927 190
167 3300003761 Ga0055535_1000373 Ga0055535_100037327 190
168 3300003761 Ga0055535_1000405 Ga0055535_100040523 190
169 3300003761 Ga0055535_1001379 Ga0055535_10013792 190
170 3300003761 Ga0055535_1001457 Ga0055535_100145713 190
171 3300003762 Ga0055542_1000394 Ga0055542_100039419 190
172 3300003762 Ga0055542_1000431 Ga0055542_100043122 190
173 3300003762 Ga0055542_1000734 Ga0055542_100073424 190
174 3300003762 Ga0055542_1001349 Ga0055542_10013492 190
175 3300003763 Ga0055529_1000420 Ga0055529_100042019 190
176 3300003763 Ga0055529_1000428 Ga0055529_100042820 190
177 3300003763 Ga0055529_1001072 Ga0055529_10010722 190
178 3300005337 Ga0070682_100003420 Ga0070682_1000034204 190
179 3300005337 Ga0070682_100005911 Ga0070682_1000059114 190
180 3300005337 Ga0070682_100144425 Ga0070682_1001444252 190
181 3300005337 Ga0070682_100145605 Ga0070682_1001456052 190
182 3300005339 Ga0070660_100098216 Ga0070660_1000982162 190
183 3300005344 Ga0070661_100043073 Ga0070661_1000430734 190
184 3300005366 Ga0070659_100060238 Ga0070659_1000602382 190
185 3300005366 Ga0070659_100078899 Ga0070659_1000788992 190
186 3300005435 Ga0070714_100000136 Ga0070714_10000013619 190
187 3300005435 Ga0070714_100009681 Ga0070714_1000096814 190
188 3300005436 Ga0070713_100000663 Ga0070713_10000066311 190
189 3300005444 Ga0070694_101231724 Ga0070694_1012317241 190
190 3300005455 Ga0070663_100029737 Ga0070663_1000297372 190
191 3300005458 Ga0070681_10013810 Ga0070681_100138105 190
192 3300005458 Ga0070681_10184664 Ga0070681_101846642 190
193 3300005530 Ga0070679_100030348 Ga0070679_1000303483 190
194 3300005539 Ga0068853_100002290 Ga0068853_1000022902 190
195 3300005539 Ga0068853_100346166 Ga0068853_1003461662 190
196 3300005546 Ga0070696_100016454 Ga0070696_1000164545 190
197 3300005546 Ga0070696_100420450 Ga0070696_1004204502 190
198 3300005547 Ga0070693_100013608 Ga0070693_1000136083 190
199 3300005564 Ga0070664_100543555 Ga0070664_1005435552 190
200 3300005577 Ga0068857_100149478 Ga0068857_1001494782 190
201 3300005578 Ga0068854_100274841 Ga0068854_1002748412 190
202 3300005614 Ga0068856_100000138 Ga0068856_10000013857 190
203 3300005614 Ga0068856_100000938 Ga0068856_10000093815 190
204 3300005616 Ga0068852_100087699 Ga0068852_1000876992 190
205 3300006175 Ga0070712_100062304 Ga0070712_1000623042 190
206 3300006175 Ga0070712_100156822 Ga0070712_1001568222 190
207 3300009093 Ga0105240_10020394 Ga0105240_100203945 190
208 3300009093 Ga0105240_10498135 Ga0105240_104981352 190
209 3300009174 Ga0105241_10113604 Ga0105241_101136042 190
210 3300009545 Ga0105237_10000108 Ga0105237_100001082 190
211 3300009545 Ga0105237_10178205 Ga0105237_101782053 190
212 3300009545 Ga0105237_10475288 Ga0105237_104752882 190
213 3300009551 Ga0105238_10077321 Ga0105238_100773212 190
214 3300009551 Ga0105238_10094582 Ga0105238_100945822 190
215 3300009551 Ga0105238_11059889 Ga0105238_110598892 190
216 3300010375 Ga0105239_10097327 Ga0105239_100973272 190
217 3300013100 Ga0157373_10376397 Ga0157373_103763972 190
218 3300013102 Ga0157371_10078098 Ga0157371_100780982 190
219 3300013104 Ga0157370_10092086 Ga0157370_100920862 190
220 3300013105 Ga0157369_10023424 Ga0157369_100234243 190
221 3300013105 Ga0157369_10780261 Ga0157369_107802612 190
222 3300013297 Ga0157378_10000005 Ga0157378_1000000520 190
223 3300013307 Ga0157372_10059684 Ga0157372_100596842 190
224 3300014497 Ga0182008_10020743 Ga0182008_100207432 190
225 3300014497 Ga0182008_10204300 Ga0182008_102043001 190
226 3300015261 Ga0182006_1016232 Ga0182006_10162323 190
227 3300015262 Ga0182007_10002824 Ga0182007_100028246 190
228 3300015262 Ga0182007_10040462 Ga0182007_100404622 190
229 3300015262 Ga0182007_10057850 Ga0182007_100578502 190
230 3300015262 Ga0182007_10069031 Ga0182007_100690312 190
231 3300015685 Ga0183369_1004 Ga0183369_1004414 190
232 3300015687 Ga0183368_1002 Ga0183368_10021398 190
233 3300020081 Ga0206354_10274793 Ga0206354_102747932 190
234 3300020082 Ga0206353_11873004 Ga0206353_118730042 190
235 3300025224 Ga0209784_100053 Ga0209784_10005344 190
236 3300025226 Ga0209674_100014 Ga0209674_10001460 190
237 3300025226 Ga0209674_100197 Ga0209674_10019746 190
238 3300025226 Ga0209674_100550 Ga0209674_10055015 190
239 3300025226 Ga0209674_100621 Ga0209674_1006216 190
240 3300025228 Ga0209672_100004 Ga0209672_100004391 190
241 3300025228 Ga0209672_100008 Ga0209672_100008290 190
242 3300025228 Ga0209672_100826 Ga0209672_1008262 190
243 3300025228 Ga0209672_101804 Ga0209672_1018042 190
244 3300025230 Ga0209563_100097 Ga0209563_100097120 190
245 3300025231 Ga0207427_100044 Ga0207427_100044126 190
246 3300025231 Ga0207427_100061 Ga0207427_100061113 190
247 3300025231 Ga0207427_100129 Ga0207427_10012954 190
248 3300025233 Ga0209437_100005 Ga0209437_100005250 190
249 3300025233 Ga0209437_100037 Ga0209437_100037272 190
250 3300025233 Ga0209437_100118 Ga0209437_100118150 190
251 3300025242 Ga0209258_100003 Ga0209258_100003391 190
252 3300025242 Ga0209258_100004 Ga0209258_100004900 190
253 3300025242 Ga0209258_100008 Ga0209258_100008525 190
254 3300025242 Ga0209258_100090 Ga0209258_10009082 190
255 3300025242 Ga0209258_100138 Ga0209258_10013859 190
256 3300025242 Ga0209258_100479 Ga0209258_10047920 190
257 3300025242 Ga0209258_108074 Ga0209258_1080742 190
258 3300025246 Ga0209646_1001101 Ga0209646_10011015 190
259 3300025250 Ga0209026_1000010 Ga0209026_1000010218 190
260 3300025250 Ga0209026_1000104 Ga0209026_1000104114 190
261 3300025250 Ga0209026_1000553 Ga0209026_10005534 190
262 3300025253 Ga0209677_100976 Ga0209677_1009766 190
263 3300025254 Ga0209148_1000001 Ga0209148_1000001238 190
264 3300025254 Ga0209148_1000016 Ga0209148_1000016391 190
265 3300025254 Ga0209148_1000041 Ga0209148_100004127 190
266 3300025254 Ga0209148_1000065 Ga0209148_100006582 190
267 3300025256 Ga0209759_1001467 Ga0209759_10014678 190
268 3300025256 Ga0209759_1004437 Ga0209759_10044373 190
269 3300025256 Ga0209759_1010286 Ga0209759_10102862 190
270 3300025258 Ga0209129_1005329 Ga0209129_10053293 190
271 3300025261 Ga0209233_1000002 Ga0209233_10000021993 190
272 3300025261 Ga0209233_1000011 Ga0209233_1000011691 190
273 3300025261 Ga0209233_1000046 Ga0209233_1000046144 190
274 3300025272 Ga0209455_1000004 Ga0209455_1000004391 190
275 3300025272 Ga0209455_1000007 Ga0209455_1000007645 190
276 3300025272 Ga0209455_1000079 Ga0209455_1000079113 190
277 3300025272 Ga0209455_1000189 Ga0209455_100018950 190
278 3300025297 Ga0209758_1000840 Ga0209758_100084050 190
279 3300025904 Ga0207647_10033709 Ga0207647_100337092 190
280 3300025911 Ga0207654_10084355 Ga0207654_100843552 190
281 3300025911 Ga0207654_10207613 Ga0207654_102076132 190
282 3300025912 Ga0207707_10033334 Ga0207707_100333342 190
283 3300025912 Ga0207707_10091964 Ga0207707_100919643 190
284 3300025913 Ga0207695_10000751 Ga0207695_100007512 190
285 3300025913 Ga0207695_10329637 Ga0207695_103296372 190
286 3300025913 Ga0207695_10399275 Ga0207695_103992751 190
287 3300025914 Ga0207671_10001039 Ga0207671_100010392 190
288 3300025914 Ga0207671_10056712 Ga0207671_100567122 190
289 3300025914 Ga0207671_10627492 Ga0207671_106274922 190
290 3300025919 Ga0207657_10034179 Ga0207657_100341792 190
291 3300025919 Ga0207657_10361214 Ga0207657_103612142 190
292 3300025928 Ga0207700_10002250 Ga0207700_100022503 190
293 3300025929 Ga0207664_10000150 Ga0207664_1000015030 190
294 3300025929 Ga0207664_10024414 Ga0207664_100244143 190
295 3300025932 Ga0207690_10018888 Ga0207690_100188882 190
296 3300025932 Ga0207690_10019423 Ga0207690_100194233 190
297 3300025932 Ga0207690_10075080 Ga0207690_100750802 190
298 3300025945 Ga0207679_10202668 Ga0207679_102026682 190
299 3300025949 Ga0207667_10129666 Ga0207667_101296662 190
300 3300025981 Ga0207640_10026409 Ga0207640_100264092 190
301 3300025981 Ga0207640_10304145 Ga0207640_103041452 190
302 3300026041 Ga0207639_10010626 Ga0207639_100106263 190
303 3300026041 Ga0207639_10118365 Ga0207639_101183652 190
304 3300026067 Ga0207678_10001852 Ga0207678_100018522 190
305 3300026067 Ga0207678_10389688 Ga0207678_103896881 190
306 3300026067 Ga0207678_10441282 Ga0207678_104412822 190
307 3300026078 Ga0207702_10000068 Ga0207702_1000006812 190
308 3300026078 Ga0207702_10000740 Ga0207702_100007404 190
309 3300026116 Ga0207674_10034748 Ga0207674_100347483 190
310 3300026142 Ga0207698_10027438 Ga0207698_100274382 190
311 3300031238 Ga0265332_10012137 Ga0265332_100121373 190
312 3300037312 Ga0395899_0003165 Ga0395899_0003165_2565_3137 190
313 3300037312 Ga0395899_0286920 Ga0395899_0286920_169_741 190
314 3300037418 Ga0395900_0000011 Ga0395900_0000011_16974_17546 190
315 3300037418 Ga0395900_0003994 Ga0395900_0003994_11158_11730 190
316 3300037418 Ga0395900_0121624 Ga0395900_0121624_860_1432 190
317 3300037466 Ga0395898_0000013 Ga0395898_0000013_18495_19067 190
318 3300037466 Ga0395898_0004893 Ga0395898_0004893_3258_3830 190
319 3300037466 Ga0395898_0079418 Ga0395898_0079418_1580_2152 190
320 3300038443 Ga0395901_0002392 Ga0395901_0002392_14060_14632 190
321 3300038443 Ga0395901_0014108 Ga0395901_0014108_5232_5804 190
322 3300038443 Ga0395901_0056535 Ga0395901_0056535_3153_3725 190
323 3300038443 Ga0395901_0250725 Ga0395901_0250725_526_1098 190
324 3300038443 Ga0395901_0357506 Ga0395901_0357506_80_652 190
325 3300038443 Ga0395901_1028463 Ga0395901_1028463_160_732 190
326 3300042012 Ga0439455_0082845 Ga0439455_0082845_264_836 190
327 3300044656 Ga0466969_0003745 Ga0466969_0003745_3612_4184 190
328 3300044656 Ga0466969_0084026 Ga0466969_0084026_44_616 190
329 3300044656 Ga0466969_0130639 Ga0466969_0130639_525_1097 190
330 3300044658 Ga0466972_0172305 Ga0466972_0172305_303_875 190
331 3300044672 Ga0466982_0000001 Ga0466982_0000001_449990_450562 190
332 3300044683 Ga0466965_0014956 Ga0466965_0014956_1653_2249 190
333 3300044683 Ga0466965_0277991 Ga0466965_0277991_56_628 190
334 3300044684 Ga0466966_0003955 Ga0466966_0003955_2128_2700 190
335 3300044684 Ga0466966_0051974 Ga0466966_0051974_1487_2059 190
336 3300044693 Ga0466961_0001111 Ga0466961_0001111_13145_13717 190
337 3300044693 Ga0466961_0021886 Ga0466961_0021886_3380_3976 190
338 3300044693 Ga0466961_0285463 Ga0466961_0285463_119_691 190
339 3300044719 Ga0466971_0001794 Ga0466971_0001794_7257_7829 190
340 3300044719 Ga0466971_0078682 Ga0466971_0078682_476_1048 190
341 3300044719 Ga0466971_0151614 Ga0466971_0151614_467_1063 190
342 3300044735 Ga0466968_0048565 Ga0466968_0048565_796_1368 190
343 3300044765 Ga0466970_0068434 Ga0466970_0068434_669_1241 190
344 3300044765 Ga0466970_0139951 Ga0466970_0139951_567_1139 190
345 3300044765 Ga0466970_0269699 Ga0466970_0269699_274_846 190
346 3300044842 Ga0466957_0001515 Ga0466957_0001515_11293_11865 190
347 3300044842 Ga0466957_0011846 Ga0466957_0011846_1349_1945 190
348 3300044842 Ga0466957_0084013 Ga0466957_0084013_814_1386 190
349 3300044901 Ga0466960_0137340 Ga0466960_0137340_36_608 190
350 3300045049 Ga0466959_0022722 Ga0466959_0022722_771_1343 190
351 3300045049 Ga0466959_0035404 Ga0466959_0035404_587_1183 190
352 3300045049 Ga0466959_0226298 Ga0466959_0226298_553_1125 190
353 3300045049 Ga0466959_0259815 Ga0466959_0259815_526_1098 190
354 3300045836 Ga0466958_0007247 Ga0466958_0007247_1702_2274 190
355 3300045836 Ga0466958_0017645 Ga0466958_0017645_1585_2157 190
356 3300045836 Ga0466958_0053028 Ga0466958_0053028_805_1401 190
357 3300045976 Ga0466967_0176391 Ga0466967_0176391_178_750 190
358 3300046460 Ga0495638_0001087 Ga0495638_0001087_10629_11201 190
359 3300046557 Ga0495622_0006861 Ga0495622_0006861_2724_3296 190
360 3300046660 Ga0495625_0054251 Ga0495625_0054251_1781_2353 190
361 3300046694 Ga0495649_0000450 Ga0495649_0000450_22163_22735 190
362 3300048918 Ga0496115_0000729 Ga0496115_0000729_21941_22513 190
363 3300048918 Ga0496115_0051557 Ga0496115_0051557_1842_2414 190
364 3300048925 Ga0496122_0046307 Ga0496122_0046307_419_994 190
365 3300048926 Ga0496123_0039574 Ga0496123_0039574_2546_3121 190
366 3300048929 Ga0496126_0095556 Ga0496126_0095556_90_662 190
367 3300049460 Ga0495682_0021561 Ga0495682_0021561_560_1132 190
368 3300049568 Ga0501031_0087028 Ga0501031_0087028_74_646 190
369 3300049568 Ga0501031_0403887 Ga0501031_0403887_199_771 190
370 3300049568 Ga0501031_0440006 Ga0501031_0440006_239_811 190
371 3300049569 Ga0501032_0079442 Ga0501032_0079442_1463_2035 190
372 3300049569 Ga0501032_0608184 Ga0501032_0608184_34_606 190
373 3300049570 Ga0501033_0001009 Ga0501033_0001009_21363_21935 190
374 3300049570 Ga0501033_0004747 Ga0501033_0004747_8485_9057 190
375 3300049570 Ga0501033_0015590 Ga0501033_0015590_4528_5100 190
376 3300049570 Ga0501033_0415036 Ga0501033_0415036_244_825 190
377 3300049571 Ga0501034_0039007 Ga0501034_0039007_2016_2588 190
378 3300049571 Ga0501034_0319022 Ga0501034_0319022_471_1043 190
379 3300049571 Ga0501034_0630050 Ga0501034_0630050_18_599 190
380 3300049572 Ga0501036_0034826 Ga0501036_0034826_171_743 190
381 3300049572 Ga0501036_0039004 Ga0501036_0039004_2652_3224 190
382 3300049573 Ga0501037_0074941 Ga0501037_0074941_1725_2297 190
383 3300049575 Ga0501039_0174414 Ga0501039_0174414_317_889 190
384 3300049579 Ga0501043_0007069 Ga0501043_0007069_4053_4625 190
385 3300049579 Ga0501043_0099758 Ga0501043_0099758_861_1433 190
386 3300049579 Ga0501043_0590609 Ga0501043_0590609_152_733 190
387 3300049580 Ga0501046_0032221 Ga0501046_0032221_358_930 190
388 3300049581 Ga0501047_0013195 Ga0501047_0013195_5194_5766 190
389 3300049581 Ga0501047_0210788 Ga0501047_0210788_669_1241 190
390 3300049581 Ga0501047_0399459 Ga0501047_0399459_340_912 190
391 3300049582 Ga0501048_0187109 Ga0501048_0187109_204_776 190
392 3300049582 Ga0501048_0466084 Ga0501048_0466084_320_892 190
393 3300049586 Ga0501070_0161249 Ga0501070_0161249_877_1449 190
394 3300049586 Ga0501070_0601708 Ga0501070_0601708_208_780 190
395 3300049589 Ga0501073_0128828 Ga0501073_0128828_460_1032 190
396 3300049822 Ga0501035_0027485 Ga0501035_0027485_211_783 190
397 3300049822 Ga0501035_0196643 Ga0501035_0196643_497_1069 190
398 3300049822 Ga0501035_0246243 Ga0501035_0246243_453_1025 190
399 3300049823 Ga0501044_0021893 Ga0501044_0021893_5563_6135 190
400 3300049823 Ga0501044_0642780 Ga0501044_0642780_43_615 190
401 3300061719 Ga0466962_0001335 Ga0466962_0001335_1025_1597 190
402 3300061719 Ga0466962_0044629 Ga0466962_0044629_108_704 190
403 3300061719 Ga0466962_0049688 Ga0466962_0049688_562_1134 190

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01300

Sua5_yciO_yrdC

Telomere recombination

23

198

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1hru-assembly1.cif.gz_B the structure of the yrdc gene product from e.coli 0.9444 7 186
3aje-assembly1.cif.gz_A crystal structure of s. tokodaii sua5 complexed with l-threonine and amppnp 0.9342 3 179
2eqa-assembly1.cif.gz_A crystal structure of the hypothetical sua5 protein from sulfolobus tokodaii 0.9341 3 179
1hru-assembly1.cif.gz_B the structure of the yrdc gene product from e.coli 0.9198 7 186
6f89-assembly1.cif.gz_A structure of h234a/y235a p.abyssi sua5 0.919 1 185
ID Description Score Start End Superfamily
1hruB00 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9341 7 186 3.90.870.10
4e1bA01 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9304 3 179 3.90.870.10
1hruB00 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9194 7 186 3.90.870.10
af_Q4DBQ8_3_214_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9166 3 188 3.90.870.10
af_Q2FWE2_20_236_3.90.870.10 Alpha Beta;Alpha-Beta Complex;DHBP synthase;DHBP synthase 0.9108 3 188 3.90.870.10
ID Description Score Start End GO Terms
AF-A0A522RS45-F1-model_v4 Threonylcarbamoyl-AMP synthase (TC-AMP synthase) (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaC) (tRNA threonylcarbamoyladenosine biosynthesis protein TsaC) 0.9759 2 188 GO:0000049
GO:0002949
GO:0003725
GO:0005524
GO:0005737
GO:0006450
GO:0061710
AF-A0A1G5BNB7-F1-model_v4 Threonylcarbamoyl-AMP synthase (TC-AMP synthase) (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaC) (tRNA threonylcarbamoyladenosine biosynthesis protein TsaC) 0.9715 10 187 GO:0000049
GO:0002949
GO:0003725
GO:0005524
GO:0005737
GO:0006450
GO:0061710
AF-A0A522RS45-F1-model_v4 Threonylcarbamoyl-AMP synthase (TC-AMP synthase) (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaC) (tRNA threonylcarbamoyladenosine biosynthesis protein TsaC) 0.9708 2 188 GO:0000049
GO:0002949
GO:0003725
GO:0005524
GO:0005737
GO:0006450
GO:0061710
AF-A0A421K549-F1-model_v4 Threonylcarbamoyl-AMP synthase (TC-AMP synthase) (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaC) (tRNA threonylcarbamoyladenosine biosynthesis protein TsaC) 0.9702 9 188 GO:0000049
GO:0002949
GO:0003725
GO:0005524
GO:0005737
GO:0006450
GO:0061710
AF-A0A2T6NKQ2-F1-model_v4 Threonylcarbamoyl-AMP synthase (TC-AMP synthase) (EC 2.7.7.87) (L-threonylcarbamoyladenylate synthase) (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaC) (tRNA threonylcarbamoyladenosine biosynthesis protein TsaC) 0.9691 17 188 GO:0000049
GO:0002949
GO:0003725
GO:0005524
GO:0005737
GO:0006450
GO:0061710

Feature Viewer

pLDDT pTM Quality
95.39 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map