F435404

General Info

Members Datasets Scaffolds Average Seq Length
403 214 396 312

Family's Representative Sequence

Representative Sequence 3300025931|Ga0207644_10008472|Ga0207644_100084724
Length 338
Sequence VSLRANHQAVQRPGATNEGDLVINQEILKMSSATGTGKYERLLERCKTLAPVPTAVAHPCEESALTGAVEAAEAGLILPILVGPAEKIAETAKSAGLNLGNLEIVDTSHSVDSARQAVALVREGRAEVLMKGSLHTDELMSAIVSRDGGLRTGRRISHVFVMDVPTYHKVLIVTDAAINIAPTLEDKVDICQNAIDLAITLGLEKPKVAVLCAVETVNSKMPATLDAAALCKMAERGQIKGGLIDGPLAFDNAVSKQAAETKGIKSSVAGDPDILLAPDLEAGNILAKQLSFLANADSAGMVLGARVPVILTSRADSVRSRIASCAVAKLVAHARRSA

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
3 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
4 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
5 2928163908 Burkholderia sp. 567 Isolate Unclassified
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
8 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
9 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
161 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
168 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
169 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
170 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
171 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
172 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
173 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
174 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
175 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
176 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
177 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
178 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
179 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
180 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
181 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
185 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
188 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
189 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
190 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
191 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
192 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
193 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
194 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
195 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
196 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
197 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
198 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
199 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
200 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
201 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
204 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
205 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
206 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
209 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
213 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
214 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.26
Metatranscriptomes 0
Isolates 1.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.73
Nodule 0
Rhizoplane 0.5
Rhizosphere 94.79
Stem 0
Stem Tuber 0
Unclassified 1.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10000015 3300002459 Bacteria 112804
2 Ga0055532_1000174 3300003758 Bacteria 54785
3 Ga0055527_1000036 3300003760 Bacteria 133374
4 Ga0055535_1000051 3300003761 Bacteria 133374
5 Ga0065712_10001966 3300005290 Bacteria 6530
6 Ga0065715_10215300 3300005293 Bacteria 1295
7 Ga0065715_10224489 3300005293 Bacteria 1244
8 Ga0065707_10105489 3300005295 Bacteria 2642
9 Ga0070658_10048039 3300005327 Bacteria 3455
10 Ga0070683_100036956 3300005329 Bacteria 4469
11 Ga0070690_100003698 3300005330 Bacteria 8421
12 Ga0070690_100004617 3300005330 Bacteria 7664
13 Ga0070670_100000182 3300005331 Bacteria 57532
14 Ga0068869_100009618 3300005334 Bacteria 6278
15 Ga0068869_100114960 3300005334 Bacteria 2051
16 Ga0070680_100006284 3300005336 Bacteria 9018
17 Ga0070682_100006011 3300005337 Bacteria 6794
18 Ga0068868_100018854 3300005338 Bacteria 5163
19 Ga0070660_100000518 3300005339 Bacteria 25747
20 Ga0070689_100003958 3300005340 Bacteria 9945
21 Ga0070689_100376884 3300005340 Bacteria 1195
22 Ga0070687_100040993 3300005343 Bacteria 2337
23 Ga0070661_100085434 3300005344 Bacteria 2332
24 Ga0070692_10009612 3300005345 Bacteria 4367
25 Ga0070692_10177899 3300005345 Bacteria 1231
26 Ga0070668_100024800 3300005347 Bacteria 4545
27 Ga0070669_100017646 3300005353 Bacteria 5091
28 Ga0070669_100058901 3300005353 Bacteria 2819
29 Ga0070669_100120892 3300005353 Bacteria 1998
30 Ga0070671_100057733 3300005355 Bacteria 3230
31 Ga0070671_100061614 3300005355 Bacteria 3124
32 Ga0070671_100177756 3300005355 Bacteria 1801
33 Ga0070673_100033479 3300005364 Bacteria 3881
34 Ga0070673_100056302 3300005364 Bacteria 3102
35 Ga0070673_100137679 3300005364 Bacteria 2057
36 Ga0070673_100170503 3300005364 Bacteria 1857
37 Ga0070659_100000245 3300005366 Bacteria 42680
38 Ga0070667_100019053 3300005367 Bacteria 5690
39 Ga0070667_100125657 3300005367 Bacteria 2235
40 Ga0070701_10039297 3300005438 Bacteria 2399
41 Ga0070701_10071179 3300005438 Bacteria 1860
42 Ga0070701_10071250 3300005438 Bacteria 1859
43 Ga0070705_100010172 3300005440 Bacteria 4700
44 Ga0070700_100022583 3300005441 Bacteria 3672
45 Ga0070700_100022863 3300005441 Bacteria 3652
46 Ga0070694_100014977 3300005444 Bacteria 4859
47 Ga0070694_100055965 3300005444 Bacteria 2677
48 Ga0070694_100124782 3300005444 Bacteria 1852
49 Ga0070694_100197165 3300005444 Bacteria 1499
50 Ga0070694_100303279 3300005444 Bacteria 1224
51 Ga0070663_100049565 3300005455 Bacteria 2983
52 Ga0070678_100003707 3300005456 Bacteria 8547
53 Ga0070662_100493128 3300005457 Bacteria 1021
54 Ga0068867_100043319 3300005459 Unclassified 3295
55 Ga0068867_100094964 3300005459 Bacteria 2268
56 Ga0068867_100227317 3300005459 Unclassified 1507
57 Ga0070685_10055247 3300005466 Bacteria 2307
58 Ga0070707_100084911 3300005468 Bacteria 3059
59 Ga0070699_100003603 3300005518 Bacteria 13698
60 Ga0070699_100004486 3300005518 Bacteria 12351
61 Ga0070699_100059113 3300005518 Bacteria 3322
62 Ga0070684_100023633 3300005535 Bacteria 5146
63 Ga0070672_100041875 3300005543 Bacteria 3524
64 Ga0070695_100219988 3300005545 Bacteria 1368
65 Ga0070696_100285414 3300005546 Bacteria 1260
66 Ga0070693_100002753 3300005547 Bacteria 8087
67 Ga0070704_100030705 3300005549 Bacteria 3603
68 Ga0070704_100035637 3300005549 Bacteria 3384
69 Ga0070704_100062248 3300005549 Bacteria 2674
70 Ga0070704_100074303 3300005549 Bacteria 2479
71 Ga0070704_100340356 3300005549 Bacteria 1263
72 Ga0068855_100002447 3300005563 Bacteria 22934
73 Ga0068855_100104080 3300005563 Bacteria 3265
74 Ga0070664_100002121 3300005564 Bacteria 15877
75 Ga0070664_100081612 3300005564 Bacteria 2787
76 Ga0070664_100320971 3300005564 Bacteria 1403
77 Ga0068857_100118005 3300005577 Bacteria 2388
78 Ga0068857_100375305 3300005577 Bacteria 1320
79 Ga0068854_100218028 3300005578 Unclassified 1508
80 Ga0068856_100032010 3300005614 Bacteria 5147
81 Ga0070702_100000429 3300005615 Bacteria 14936
82 Ga0070702_100045253 3300005615 Bacteria 2489
83 Ga0068852_100049488 3300005616 Bacteria 3596
84 Ga0068852_100176257 3300005616 Bacteria 2008
85 Ga0068852_100187746 3300005616 Bacteria 1948
86 Ga0068859_100005802 3300005617 Bacteria 12538
87 Ga0068859_100021150 3300005617 Bacteria 6529
88 Ga0068859_100025307 3300005617 Bacteria 5953
89 Ga0068859_100122945 3300005617 Bacteria 2662
90 Ga0068859_100136075 3300005617 Bacteria 2530
91 Ga0068859_100137962 3300005617 Bacteria 2512
92 Ga0068859_100181888 3300005617 Bacteria 2185
93 Ga0068864_100012044 3300005618 Bacteria 7143
94 Ga0068864_100039863 3300005618 Bacteria 4015
95 Ga0068864_100091752 3300005618 Bacteria 2680
96 Ga0068864_100530711 3300005618 Bacteria 1136
97 Ga0068861_100000611 3300005719 Bacteria 21166
98 Ga0068861_100023056 3300005719 Bacteria 4488
99 Ga0068861_100066360 3300005719 Bacteria 2782
100 Ga0068861_100077520 3300005719 Unclassified 2593
101 Ga0068861_100124821 3300005719 Bacteria 2082
102 Ga0068851_10005132 3300005834 Bacteria 5939
103 Ga0068870_10135403 3300005840 Bacteria 1436
104 Ga0068863_100002675 3300005841 Bacteria 17619
105 Ga0068863_100012662 3300005841 Bacteria 8134
106 Ga0068858_100054420 3300005842 Bacteria 3700
107 Ga0068858_100094543 3300005842 Bacteria 2784
108 Ga0068858_100108154 3300005842 Bacteria 2596
109 Ga0068858_100186944 3300005842 Bacteria 1957
110 Ga0068860_100045810 3300005843 Bacteria 4170
111 Ga0068860_100106374 3300005843 Bacteria 2679
112 Ga0068860_100260997 3300005843 Bacteria 1689
113 Ga0068862_100016298 3300005844 Bacteria 6183
114 Ga0068862_100046108 3300005844 Bacteria 3720
115 Ga0068862_100066407 3300005844 Bacteria 3108
116 Ga0068862_100292506 3300005844 Bacteria 1496
117 Ga0075432_10030350 3300006058 Bacteria 1868
118 Ga0097621_100005308 3300006237 Bacteria 9075
119 Ga0097621_100009789 3300006237 Bacteria 6976
120 Ga0097621_100206232 3300006237 Bacteria 1708
121 Ga0068871_100006530 3300006358 Bacteria 8260
122 Ga0075428_100010732 3300006844 Bacteria 10183
123 Ga0075428_100039689 3300006844 Bacteria 5181
124 Ga0075428_100094570 3300006844 Bacteria 3258
125 Ga0075428_100179889 3300006844 Bacteria 2289
126 Ga0075430_100000586 3300006846 Bacteria 27612
127 Ga0075430_100010906 3300006846 Bacteria 7698
128 Ga0075431_100000643 3300006847 Bacteria 29600
129 Ga0075431_100032316 3300006847 Bacteria 5393
130 Ga0075431_100084737 3300006847 Bacteria 3271
131 Ga0075429_100011699 3300006880 Bacteria 7609
132 Ga0075429_100025582 3300006880 Bacteria 5123
133 Ga0075429_100237279 3300006880 Bacteria 1597
134 Ga0068865_100013620 3300006881 Bacteria 5147
135 Ga0068865_100015036 3300006881 Bacteria 4929
136 Ga0097620_100005803 3300006931 Bacteria 12538
137 Ga0097620_100021150 3300006931 Bacteria 6529
138 Ga0097620_100025308 3300006931 Bacteria 5953
139 Ga0097620_100122951 3300006931 Bacteria 2662
140 Ga0097620_100136076 3300006931 Bacteria 2530
141 Ga0097620_100137969 3300006931 Bacteria 2512
142 Ga0097620_100181881 3300006931 Bacteria 2185
143 Ga0105240_10009038 3300009093 Bacteria 14150
144 Ga0105240_10410649 3300009093 Bacteria 1523
145 Ga0111539_10002823 3300009094 Bacteria 23094
146 Ga0111539_10084508 3300009094 Bacteria 3731
147 Ga0111539_10426813 3300009094 Bacteria 1544
148 Ga0105245_10112275 3300009098 Bacteria 2536
149 Ga0105245_10302699 3300009098 Bacteria 1569
150 Ga0105247_10000512 3300009101 Bacteria 31789
151 Ga0114129_10000005 3300009147 Bacteria 159906
152 Ga0114129_10002104 3300009147 Bacteria 27400
153 Ga0114129_10192034 3300009147 Bacteria 2772
154 Ga0114129_10280074 3300009147 Bacteria 2228
155 Ga0114129_10518303 3300009147 Bacteria 1555
156 Ga0114129_10523275 3300009147 Bacteria 1546
157 Ga0105243_10002963 3300009148 Bacteria 14028
158 Ga0105241_10000416 3300009174 Bacteria 32181
159 Ga0105241_10039051 3300009174 Bacteria 3580
160 Ga0105241_10120113 3300009174 Bacteria 2115
161 Ga0105242_10000362 3300009176 Bacteria 36296
162 Ga0105242_10001430 3300009176 Bacteria 18819
163 Ga0105242_10006361 3300009176 Bacteria 9091
164 Ga0105242_10018288 3300009176 Bacteria 5476
165 Ga0105242_10323727 3300009176 Bacteria 1415
166 Ga0105248_10011316 3300009177 Bacteria 9835
167 Ga0105248_10016396 3300009177 Bacteria 8154
168 Ga0105248_10159051 3300009177 Bacteria 2548
169 Ga0105248_10178831 3300009177 Bacteria 2391
170 Ga0105248_10476224 3300009177 Bacteria 1407
171 Ga0105237_10014768 3300009545 Bacteria 8150
172 Ga0105237_10087057 3300009545 Bacteria 3113
173 Ga0105237_10095946 3300009545 Bacteria 2955
174 Ga0105238_10006912 3300009551 Bacteria 11335
175 Ga0105238_10007818 3300009551 Bacteria 10692
176 Ga0105238_10008569 3300009551 Bacteria 10231
177 Ga0105249_10000025 3300009553 Bacteria 232713
178 Ga0105249_10002741 3300009553 Bacteria 15243
179 Ga0105249_10011998 3300009553 Bacteria 7623
180 Ga0105249_10048454 3300009553 Unclassified 3873
181 Ga0105239_10010735 3300010375 Bacteria 10231
182 Ga0105239_10048343 3300010375 Bacteria 4665
183 Ga0105239_10085299 3300010375 Bacteria 3480
184 Ga0105246_10020358 3300011119 Bacteria 4253
185 Ga0105246_10021365 3300011119 Bacteria 4165
186 Ga0157373_10386550 3300013100 Bacteria 1001
187 Ga0157374_10010972 3300013296 Bacteria 7824
188 Ga0157378_10014193 3300013297 Bacteria 6971
189 Ga0157378_10137937 3300013297 Bacteria 2263
190 Ga0163162_10000002 3300013306 Bacteria 717331
191 Ga0163162_10009856 3300013306 Bacteria 9293
192 Ga0163162_10015304 3300013306 Bacteria 7494
193 Ga0163162_10020554 3300013306 Bacteria 6486
194 Ga0163162_10053695 3300013306 Bacteria 4051
195 Ga0163162_10341832 3300013306 Bacteria 1629
196 Ga0157372_10013637 3300013307 Bacteria 8685
197 Ga0157372_10425758 3300013307 Bacteria 1547
198 Ga0157375_10023578 3300013308 Bacteria 5680
199 Ga0157375_10024208 3300013308 Bacteria 5615
200 Ga0157375_10145684 3300013308 Bacteria 2499
201 Ga0163163_10011707 3300014325 Bacteria 7967
202 Ga0163163_10021636 3300014325 Bacteria 6072
203 Ga0163163_10040359 3300014325 Bacteria 4557
204 Ga0163163_10216513 3300014325 Bacteria 1964
205 Ga0157380_10001765 3300014326 Bacteria 14275
206 Ga0157380_10004409 3300014326 Bacteria 9754
207 Ga0157380_10018018 3300014326 Bacteria 5238
208 Ga0157380_10058436 3300014326 Bacteria 3074
209 Ga0157380_10079611 3300014326 Bacteria 2676
210 Ga0157380_10145712 3300014326 Bacteria 2041
211 Ga0157380_10173814 3300014326 Bacteria 1885
212 Ga0157377_10094711 3300014745 Bacteria 1769
213 Ga0157377_10199233 3300014745 Bacteria 1270
214 Ga0157379_10085773 3300014968 Bacteria 2823
215 Ga0157379_10148072 3300014968 Bacteria 2117
216 Ga0157379_10336439 3300014968 Bacteria 1380
217 Ga0157379_10346367 3300014968 Bacteria 1360
218 Ga0157376_10076093 3300014969 Bacteria 2867
219 Ga0157376_10692687 3300014969 Bacteria 1023
220 Ga0209566_100255 3300025225 Bacteria 50715
221 Ga0209674_103610 3300025226 Bacteria 2782
222 Ga0209672_100026 3300025228 Bacteria 348998
223 Ga0209147_100033 3300025229 Bacteria 348998
224 Ga0209258_100051 3300025242 Bacteria 348998
225 Ga0209148_1000313 3300025254 Bacteria 68764
226 Ga0209455_1000154 3300025272 Bacteria 124382
227 Ga0207656_10005213 3300025321 Bacteria 4575
228 Ga0207710_10005886 3300025900 Bacteria 5260
229 Ga0207647_10008576 3300025904 Bacteria 7315
230 Ga0207643_10001406 3300025908 Bacteria 13780
231 Ga0207705_10051091 3300025909 Bacteria 2976
232 Ga0207654_10002645 3300025911 Bacteria 9093
233 Ga0207671_10009883 3300025914 Bacteria 7931
234 Ga0207671_10029419 3300025914 Bacteria 4101
235 Ga0207660_10012850 3300025917 Bacteria 5482
236 Ga0207660_10115417 3300025917 Bacteria 2027
237 Ga0207657_10000053 3300025919 Bacteria 107963
238 Ga0207649_10056153 3300025920 Bacteria 2457
239 Ga0207649_10150129 3300025920 Bacteria 1604
240 Ga0207649_10266863 3300025920 Bacteria 1239
241 Ga0207681_10031245 3300025923 Bacteria 3477
242 Ga0207694_10003389 3300025924 Bacteria 12696
243 Ga0207694_10005204 3300025924 Bacteria 10047
244 Ga0207650_10000017 3300025925 Bacteria 354674
245 Ga0207650_10283494 3300025925 Bacteria 1349
246 Ga0207659_10329093 3300025926 Bacteria 1262
247 Ga0207644_10008472 3300025931 Bacteria 6731
248 Ga0207644_10009599 3300025931 Bacteria 6355
249 Ga0207644_10014877 3300025931 Bacteria 5216
250 Ga0207690_10000009 3300025932 Bacteria 366044
251 Ga0207706_10228785 3300025933 Bacteria 1627
252 Ga0207686_10003376 3300025934 Bacteria 8575
253 Ga0207686_10014776 3300025934 Bacteria 4356
254 Ga0207686_10047972 3300025934 Bacteria 2643
255 Ga0207709_10024352 3300025935 Bacteria 3456
256 Ga0207670_10012535 3300025936 Bacteria 4964
257 Ga0207670_10242299 3300025936 Bacteria 1390
258 Ga0207704_10041597 3300025938 Bacteria 2697
259 Ga0207704_10067511 3300025938 Bacteria 2250
260 Ga0207691_10005584 3300025940 Bacteria 12152
261 Ga0207711_10006264 3300025941 Bacteria 10037
262 Ga0207711_10008907 3300025941 Bacteria 8390
263 Ga0207711_10038366 3300025941 Bacteria 4073
264 Ga0207711_10058904 3300025941 Bacteria 3306
265 Ga0207689_10002532 3300025942 Bacteria 16983
266 Ga0207689_10180232 3300025942 Bacteria 1742
267 Ga0207661_10050014 3300025944 Bacteria 3329
268 Ga0207679_10103515 3300025945 Bacteria 2231
269 Ga0207667_10022135 3300025949 Bacteria 7031
270 Ga0207667_10075817 3300025949 Bacteria 3491
271 Ga0207651_10017698 3300025960 Bacteria 4217
272 Ga0207651_10021521 3300025960 Bacteria 3922
273 Ga0207651_10461125 3300025960 Bacteria 1092
274 Ga0207712_10000070 3300025961 Bacteria 125324
275 Ga0207712_10000650 3300025961 Bacteria 27103
276 Ga0207712_10094118 3300025961 Bacteria 2212
277 Ga0207712_10256591 3300025961 Bacteria 1416
278 Ga0207668_10038421 3300025972 Bacteria 3212
279 Ga0207640_10047966 3300025981 Bacteria 2759
280 Ga0207640_10212873 3300025981 Unclassified 1474
281 Ga0207677_10050536 3300026023 Bacteria 2813
282 Ga0207677_10110982 3300026023 Bacteria 2042
283 Ga0207703_10017342 3300026035 Bacteria 5621
284 Ga0207703_10021074 3300026035 Bacteria 5100
285 Ga0207703_10067195 3300026035 Bacteria 2950
286 Ga0207703_10180545 3300026035 Bacteria 1862
287 Ga0207678_10009403 3300026067 Bacteria 8600
288 Ga0207708_10005262 3300026075 Bacteria 9528
289 Ga0207708_10019697 3300026075 Bacteria 5088
290 Ga0207708_10024360 3300026075 Bacteria 4578
291 Ga0207708_10030884 3300026075 Bacteria 4065
292 Ga0207708_10038689 3300026075 Bacteria 3633
293 Ga0207641_10011237 3300026088 Bacteria 7345
294 Ga0207641_10045685 3300026088 Bacteria 3689
295 Ga0207648_10001882 3300026089 Bacteria 22923
296 Ga0207648_10168363 3300026089 Bacteria 1936
297 Ga0207648_10451626 3300026089 Bacteria 1170
298 Ga0207676_10005365 3300026095 Bacteria 9079
299 Ga0207676_10007345 3300026095 Bacteria 7817
300 Ga0207676_10008109 3300026095 Bacteria 7464
301 Ga0207676_10008544 3300026095 Bacteria 7278
302 Ga0207676_10195648 3300026095 Bacteria 1783
303 Ga0207676_10563499 3300026095 Bacteria 1090
304 Ga0207674_10146548 3300026116 Bacteria 2319
305 Ga0207674_10252791 3300026116 Bacteria 1709
306 Ga0207674_10258148 3300026116 Bacteria 1690
307 Ga0207675_100010273 3300026118 Bacteria 8772
308 Ga0207675_100013488 3300026118 Bacteria 7625
309 Ga0207675_100060694 3300026118 Bacteria 3530
310 Ga0207675_100063466 3300026118 Bacteria 3451
311 Ga0207675_100068287 3300026118 Bacteria 3322
312 Ga0207675_100182358 3300026118 Unclassified 2011
313 Ga0207683_10029035 3300026121 Bacteria 4787
314 Ga0207698_10034526 3300026142 Bacteria 3688
315 Ga0207698_10051862 3300026142 Bacteria 3139
316 Ga0207698_10212467 3300026142 Bacteria 1742
317 Ga0268265_10062896 3300028380 Bacteria 2853
318 Ga0268264_10374254 3300028381 Bacteria 1362
319 Ga0307408_100002345 3300031548 Bacteria 13397
320 Ga0307408_100265321 3300031548 Bacteria 1423
321 Ga0307405_10007017 3300031731 Bacteria 5599
322 Ga0307413_10008446 3300031824 Bacteria 4864
323 Ga0307410_10002497 3300031852 Bacteria 8885
324 Ga0307406_10006796 3300031901 Bacteria 6328
325 Ga0307406_10257647 3300031901 Bacteria 1318
326 Ga0307412_10043426 3300031911 Bacteria 2927
327 Ga0307412_10251205 3300031911 Bacteria 1373
328 Ga0307416_100000605 3300032002 Bacteria 18488
329 Ga0307416_100003680 3300032002 Bacteria 9081
330 Ga0307414_10000789 3300032004 Bacteria 16173
331 Ga0307414_10045046 3300032004 Bacteria 3018
332 Ga0307411_10009289 3300032005 Bacteria 5159
333 Ga0307411_10070237 3300032005 Bacteria 2369
334 Ga0307415_100001729 3300032126 Bacteria 10634
335 Ga0373951_0002121 3300035091 Bacteria 5067
336 Ga0373941_0011218 3300035115 Bacteria 2311
337 Ga0373937_0125687 3300036401 Bacteria 2392
338 Ga0373925_0009327 3300037068 Bacteria 7144
339 Ga0395898_0164363 3300037466 Bacteria 2123
340 Ga0451577_0122145 3300042876 Bacteria 2333
341 Ga0451576_0078986 3300045051 Bacteria 3423
342 Ga0495603_0013053 3300046455 Bacteria 5022
343 Ga0495580_0097405 3300046472 Bacteria 2046
344 Ga0495580_0158009 3300046472 Bacteria 1569
345 Ga0495580_0254162 3300046472 Bacteria 1203
346 Ga0495639_0093088 3300046475 Bacteria 1416
347 Ga0495639_0208263 3300046475 Bacteria 959
348 Ga0495664_0221484 3300046477 Bacteria 1145
349 Ga0495583_0001725 3300046506 Bacteria 20966
350 Ga0495616_0056429 3300046513 Bacteria 1940
351 Ga0495618_0012901 3300046514 Bacteria 5080
352 Ga0495630_0146729 3300046517 Bacteria 1794
353 Ga0495634_0012703 3300046642 Bacteria 6096
354 Ga0495658_0107023 3300046683 Bacteria 1677
355 Ga0495613_0040329 3300046689 Bacteria 3460
356 Ga0495674_0022013 3300047319 Bacteria 5883
357 Ga0495672_0049658 3300047320 Bacteria 2482
358 Ga0495675_0007510 3300047444 Bacteria 6718
359 Ga0495684_0008358 3300047471 Bacteria 8021
360 Ga0496102_0382690 3300048905 Bacteria 1324
361 Ga0496112_0305098 3300048915 Bacteria 1537
362 Ga0496118_0069959 3300048921 Bacteria 2537
363 Ga0496121_0159146 3300048924 Bacteria 1653
364 Ga0501038_0002729 3300049574 Bacteria 16456
365 Ga0501072_0040437 3300049588 Bacteria 3661
366 Ga0501076_0139346 3300049592 Bacteria 1970
367 Ga0501198_001409 3300049649 Bacteria 3133
368 Ga0501202_001752 3300049652 Bacteria 3540
369 Ga0501206_004919 3300049653 Bacteria 1714
370 Ga0501207_000121 3300049654 Bacteria 6824
371 Ga0501208_007761 3300049655 Bacteria 1423
372 Ga0501223_001605 3300049663 Bacteria 5202
373 Ga0501224_000883 3300049664 Bacteria 3861
374 Ga0501227_004593 3300049665 Bacteria 2966
375 Ga0501233_000623 3300049668 Bacteria 5789
376 Ga0501235_001258 3300049669 Bacteria 5348
377 Ga0501259_004000 3300049688 Bacteria 2342
378 Ga0501225_0000292 3300049705 Bacteria 15607
379 Ga0501234_000188 3300049707 Bacteria 8644
380 Ga0501079_0073631 3300049741 Bacteria 2640
381 Ga0501273_001394 3300049770 Bacteria 2290
382 Ga0501283_002199 3300049779 Bacteria 2531
383 Ga0501204_000427 3300049850 Bacteria 3647
384 Ga0501226_002619 3300049853 Bacteria 2183
385 nmdc:mga05p37_2020_c1 3300050507 Bacteria 23672
386 nmdc:mga05p37_274392_c1 3300050507 Bacteria 2014
387 nmdc:mga05p37_3365_c1 3300050507 Bacteria 18662
388 nmdc:mga09592_12377_c2 3300050508 Bacteria 6615
389 nmdc:mga09592_226960_c1 3300050508 Bacteria 1618
390 nmdc:mga09592_338905_c1 3300050508 Bacteria 1302
391 nmdc:mga0qj67_127_c1 3300050509 Bacteria 50287
392 nmdc:mga0qj67_202435_c1 3300050509 Bacteria 1613
393 nmdc:mga06r32_754_c1 3300050510 Bacteria 28479
394 nmdc:mga06r32_771_c1 3300050510 Bacteria 28266
395 nmdc:mga08y16_154856_c1 3300050511 Bacteria 2382
396 Ga0500568_0003754 3300053139 Bacteria 8319

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009551 Ga0105238_10006912 Ga0105238_100069129 272
2 3300009553 Ga0105249_10048454 Ga0105249_100484543 275
3 3300013100 Ga0157373_10386550 Ga0157373_103865502 275
4 3300013308 Ga0157375_10145684 Ga0157375_101456842 275
5 3300014326 Ga0157380_10001765 Ga0157380_100017658 275
6 3300009545 Ga0105237_10095946 Ga0105237_100959463 277
7 3300025225 Ga0209566_100255 Ga0209566_10025535 290
8 3300025226 Ga0209674_103610 Ga0209674_1036103 290
9 3300005339 Ga0070660_100000518 Ga0070660_1000005186 292
10 3300005366 Ga0070659_100000245 Ga0070659_1000002456 292
11 3300005455 Ga0070663_100049565 Ga0070663_1000495652 292
12 3300005563 Ga0068855_100104080 Ga0068855_1001040802 292
13 3300005842 Ga0068858_100108154 Ga0068858_1001081542 292
14 3300009093 Ga0105240_10009038 Ga0105240_1000903816 292
15 3300010375 Ga0105239_10048343 Ga0105239_100483434 292
16 3300025919 Ga0207657_10000053 Ga0207657_1000005390 292
17 3300025920 Ga0207649_10056153 Ga0207649_100561532 292
18 3300025932 Ga0207690_10000009 Ga0207690_100000096 292
19 3300025949 Ga0207667_10022135 Ga0207667_100221355 292
20 3300026067 Ga0207678_10009403 Ga0207678_100094039 292
21 3300026142 Ga0207698_10051862 Ga0207698_100518622 292
22 3300048921 Ga0496118_0069959 Ga0496118_0069959_274_1296 292
23 3300048924 Ga0496121_0159146 Ga0496121_0159146_342_1364 292
24 iso_pu_bacteria 2885270888 2885271896 292
25 3300046475 Ga0495639_0208263 Ga0495639_0208263_11_910 297
26 3300026118 Ga0207675_100013488 Ga0207675_1000134884 298
27 3300031548 Ga0307408_100002345 Ga0307408_10000234510 298
28 3300031731 Ga0307405_10007017 Ga0307405_100070174 298
29 3300031824 Ga0307413_10008446 Ga0307413_100084464 298
30 3300031852 Ga0307410_10002497 Ga0307410_100024974 298
31 3300031901 Ga0307406_10006796 Ga0307406_100067963 298
32 3300032002 Ga0307416_100000605 Ga0307416_1000006057 298
33 3300032004 Ga0307414_10000789 Ga0307414_1000078910 298
34 3300032005 Ga0307411_10009289 Ga0307411_100092893 298
35 3300032126 Ga0307415_100001729 Ga0307415_1000017292 298
36 3300049649 Ga0501198_001409 Ga0501198_001409_1311_2255 298
37 3300049652 Ga0501202_001752 Ga0501202_001752_26_970 298
38 3300049653 Ga0501206_004919 Ga0501206_004919_629_1573 298
39 3300049654 Ga0501207_000121 Ga0501207_000121_4422_5366 298
40 3300049655 Ga0501208_007761 Ga0501208_007761_393_1337 298
41 3300049663 Ga0501223_001605 Ga0501223_001605_1222_2166 298
42 3300049664 Ga0501224_000883 Ga0501224_000883_875_1819 298
43 3300049665 Ga0501227_004593 Ga0501227_004593_881_1825 298
44 3300049668 Ga0501233_000623 Ga0501233_000623_4576_5520 298
45 3300049669 Ga0501235_001258 Ga0501235_001258_937_1881 298
46 3300049688 Ga0501259_004000 Ga0501259_004000_1019_1963 298
47 3300049705 Ga0501225_0000292 Ga0501225_0000292_10582_11526 298
48 3300049707 Ga0501234_000188 Ga0501234_000188_4645_5589 298
49 3300049770 Ga0501273_001394 Ga0501273_001394_1229_2173 298
50 3300049779 Ga0501283_002199 Ga0501283_002199_710_1654 298
51 3300049850 Ga0501204_000427 Ga0501204_000427_2670_3614 298
52 3300049853 Ga0501226_002619 Ga0501226_002619_824_1768 298
53 3300005327 Ga0070658_10048039 Ga0070658_100480392 303
54 3300025904 Ga0207647_10008576 Ga0207647_100085763 303
55 3300025909 Ga0207705_10051091 Ga0207705_100510912 303
56 3300025914 Ga0207671_10029419 Ga0207671_100294192 303
57 3300005338 Ga0068868_100018854 Ga0068868_1000188543 304
58 3300005344 Ga0070661_100085434 Ga0070661_1000854342 304
59 3300005355 Ga0070671_100177756 Ga0070671_1001777562 304
60 3300005364 Ga0070673_100137679 Ga0070673_1001376792 304
61 3300005438 Ga0070701_10071179 Ga0070701_100711792 304
62 3300005549 Ga0070704_100030705 Ga0070704_1000307052 304
63 3300005564 Ga0070664_100002121 Ga0070664_10000212112 304
64 3300005618 Ga0068864_100091752 Ga0068864_1000917523 304
65 3300005841 Ga0068863_100002675 Ga0068863_1000026753 304
66 3300005842 Ga0068858_100054420 Ga0068858_1000544202 304
67 3300005843 Ga0068860_100106374 Ga0068860_1001063741 304
68 3300005844 Ga0068862_100066407 Ga0068862_1000664072 304
69 3300009176 Ga0105242_10323727 Ga0105242_103237272 304
70 3300009177 Ga0105248_10016396 Ga0105248_100163963 304
71 3300011119 Ga0105246_10021365 Ga0105246_100213653 304
72 3300013296 Ga0157374_10010972 Ga0157374_100109723 304
73 3300013306 Ga0163162_10009856 Ga0163162_100098564 304
74 3300013308 Ga0157375_10024208 Ga0157375_100242082 304
75 3300014325 Ga0163163_10021636 Ga0163163_100216364 304
76 3300014326 Ga0157380_10058436 Ga0157380_100584363 304
77 3300014968 Ga0157379_10336439 Ga0157379_103364392 304
78 3300025917 Ga0207660_10115417 Ga0207660_101154172 304
79 3300025920 Ga0207649_10266863 Ga0207649_102668632 304
80 3300025925 Ga0207650_10283494 Ga0207650_102834942 304
81 3300025942 Ga0207689_10180232 Ga0207689_101802321 304
82 3300025945 Ga0207679_10103515 Ga0207679_101035152 304
83 3300026023 Ga0207677_10110982 Ga0207677_101109822 304
84 3300026035 Ga0207703_10067195 Ga0207703_100671952 304
85 3300026075 Ga0207708_10024360 Ga0207708_100243603 304
86 3300026088 Ga0207641_10011237 Ga0207641_100112373 304
87 3300026089 Ga0207648_10168363 Ga0207648_101683632 304
88 3300026095 Ga0207676_10008109 Ga0207676_100081094 304
89 3300026118 Ga0207675_100063466 Ga0207675_1000634662 304
90 3300047444 Ga0495675_0007510 Ga0495675_0007510_4411_5349 305
91 3300046455 Ga0495603_0013053 Ga0495603_0013053_1479_2543 307
92 3300046472 Ga0495580_0158009 Ga0495580_0158009_219_1283 307
93 3300046506 Ga0495583_0001725 Ga0495583_0001725_15745_16809 307
94 3300047319 Ga0495674_0022013 Ga0495674_0022013_658_1722 307
95 3300006844 Ga0075428_100039689 Ga0075428_1000396894 308
96 3300006846 Ga0075430_100000586 Ga0075430_10000058618 308
97 3300006847 Ga0075431_100000643 Ga0075431_10000064314 308
98 3300006881 Ga0068865_100015036 Ga0068865_1000150362 308
99 3300009098 Ga0105245_10112275 Ga0105245_101122751 308
100 3300009147 Ga0114129_10002104 Ga0114129_100021049 308
101 3300009176 Ga0105242_10006361 Ga0105242_100063614 308
102 3300009177 Ga0105248_10178831 Ga0105248_101788312 308
103 3300014969 Ga0157376_10692687 Ga0157376_106926871 308
104 3300025941 Ga0207711_10038366 Ga0207711_100383662 308
105 3300050507 nmdc:mga05p37_3365_c1 nmdc:mga05p37_3365_c1_15056_16003 308
106 3300050509 nmdc:mga0qj67_127_c1 nmdc:mga0qj67_127_c1_15207_16154 308
107 3300050510 nmdc:mga06r32_754_c1 nmdc:mga06r32_754_c1_14566_15513 308
108 iso_pu_bacteria 2928163908 2928168870 308
109 iso_pu_bacteria 8021120328 8021125815 308
110 iso_pu_bacteria 8039098773 8039102857 308
111 3300005329 Ga0070683_100036956 Ga0070683_1000369563 309
112 3300005355 Ga0070671_100057733 Ga0070671_1000577332 309
113 3300025931 Ga0207644_10008472 Ga0207644_100084724 309
114 3300025944 Ga0207661_10050014 Ga0207661_100500142 309
115 iso_pu_bacteria 2501025501 2501074303 309
116 iso_pu_bacteria 2510917014 2511095188 309
117 iso_pu_bacteria 2510917015 2511104847 309
118 3300002459 JGI24751J29686_10000015 JGI24751J29686_1000001528 310
119 3300003758 Ga0055532_1000174 Ga0055532_100017459 310
120 3300003760 Ga0055527_1000036 Ga0055527_100003659 310
121 3300003761 Ga0055535_1000051 Ga0055535_100005159 310
122 3300005290 Ga0065712_10001966 Ga0065712_100019663 310
123 3300005293 Ga0065715_10215300 Ga0065715_102153001 310
124 3300005293 Ga0065715_10224489 Ga0065715_102244891 310
125 3300005295 Ga0065707_10105489 Ga0065707_101054893 310
126 3300005330 Ga0070690_100003698 Ga0070690_1000036983 310
127 3300005330 Ga0070690_100004617 Ga0070690_1000046175 310
128 3300005331 Ga0070670_100000182 Ga0070670_10000018221 310
129 3300005334 Ga0068869_100009618 Ga0068869_1000096182 310
130 3300005334 Ga0068869_100114960 Ga0068869_1001149602 310
131 3300005336 Ga0070680_100006284 Ga0070680_1000062847 310
132 3300005337 Ga0070682_100006011 Ga0070682_1000060112 310
133 3300005340 Ga0070689_100003958 Ga0070689_1000039584 310
134 3300005340 Ga0070689_100376884 Ga0070689_1003768841 310
135 3300005343 Ga0070687_100040993 Ga0070687_1000409932 310
136 3300005345 Ga0070692_10009612 Ga0070692_100096123 310
137 3300005345 Ga0070692_10177899 Ga0070692_101778991 310
138 3300005347 Ga0070668_100024800 Ga0070668_1000248002 310
139 3300005353 Ga0070669_100017646 Ga0070669_1000176462 310
140 3300005353 Ga0070669_100058901 Ga0070669_1000589012 310
141 3300005353 Ga0070669_100120892 Ga0070669_1001208922 310
142 3300005355 Ga0070671_100061614 Ga0070671_1000616142 310
143 3300005364 Ga0070673_100033479 Ga0070673_1000334792 310
144 3300005364 Ga0070673_100056302 Ga0070673_1000563022 310
145 3300005364 Ga0070673_100170503 Ga0070673_1001705032 310
146 3300005367 Ga0070667_100019053 Ga0070667_1000190535 310
147 3300005367 Ga0070667_100125657 Ga0070667_1001256572 310
148 3300005438 Ga0070701_10039297 Ga0070701_100392973 310
149 3300005438 Ga0070701_10071250 Ga0070701_100712502 310
150 3300005440 Ga0070705_100010172 Ga0070705_1000101723 310
151 3300005441 Ga0070700_100022583 Ga0070700_1000225834 310
152 3300005441 Ga0070700_100022863 Ga0070700_1000228634 310
153 3300005444 Ga0070694_100014977 Ga0070694_1000149772 310
154 3300005444 Ga0070694_100055965 Ga0070694_1000559652 310
155 3300005444 Ga0070694_100124782 Ga0070694_1001247822 310
156 3300005444 Ga0070694_100197165 Ga0070694_1001971652 310
157 3300005444 Ga0070694_100303279 Ga0070694_1003032791 310
158 3300005456 Ga0070678_100003707 Ga0070678_1000037074 310
159 3300005457 Ga0070662_100493128 Ga0070662_1004931281 310
160 3300005459 Ga0068867_100043319 Ga0068867_1000433193 310
161 3300005459 Ga0068867_100094964 Ga0068867_1000949642 310
162 3300005459 Ga0068867_100227317 Ga0068867_1002273172 310
163 3300005466 Ga0070685_10055247 Ga0070685_100552472 310
164 3300005468 Ga0070707_100084911 Ga0070707_1000849112 310
165 3300005518 Ga0070699_100003603 Ga0070699_10000360313 310
166 3300005518 Ga0070699_100004486 Ga0070699_1000044864 310
167 3300005518 Ga0070699_100059113 Ga0070699_1000591132 310
168 3300005535 Ga0070684_100023633 Ga0070684_1000236335 310
169 3300005543 Ga0070672_100041875 Ga0070672_1000418752 310
170 3300005545 Ga0070695_100219988 Ga0070695_1002199881 310
171 3300005546 Ga0070696_100285414 Ga0070696_1002854142 310
172 3300005547 Ga0070693_100002753 Ga0070693_1000027534 310
173 3300005549 Ga0070704_100035637 Ga0070704_1000356372 310
174 3300005549 Ga0070704_100062248 Ga0070704_1000622482 310
175 3300005549 Ga0070704_100074303 Ga0070704_1000743031 310
176 3300005549 Ga0070704_100340356 Ga0070704_1003403562 310
177 3300005563 Ga0068855_100002447 Ga0068855_1000024476 310
178 3300005564 Ga0070664_100081612 Ga0070664_1000816122 310
179 3300005564 Ga0070664_100320971 Ga0070664_1003209712 310
180 3300005577 Ga0068857_100118005 Ga0068857_1001180052 310
181 3300005577 Ga0068857_100375305 Ga0068857_1003753051 310
182 3300005578 Ga0068854_100218028 Ga0068854_1002180282 310
183 3300005614 Ga0068856_100032010 Ga0068856_1000320102 310
184 3300005615 Ga0070702_100000429 Ga0070702_10000042912 310
185 3300005615 Ga0070702_100045253 Ga0070702_1000452532 310
186 3300005616 Ga0068852_100049488 Ga0068852_1000494882 310
187 3300005616 Ga0068852_100176257 Ga0068852_1001762572 310
188 3300005616 Ga0068852_100187746 Ga0068852_1001877462 310
189 3300005617 Ga0068859_100005802 Ga0068859_10000580210 310
190 3300005617 Ga0068859_100021150 Ga0068859_1000211502 310
191 3300005617 Ga0068859_100025307 Ga0068859_1000253076 310
192 3300005617 Ga0068859_100122945 Ga0068859_1001229453 310
193 3300005617 Ga0068859_100136075 Ga0068859_1001360752 310
194 3300005617 Ga0068859_100137962 Ga0068859_1001379622 310
195 3300005617 Ga0068859_100181888 Ga0068859_1001818882 310
196 3300005618 Ga0068864_100012044 Ga0068864_1000120445 310
197 3300005618 Ga0068864_100039863 Ga0068864_1000398633 310
198 3300005618 Ga0068864_100530711 Ga0068864_1005307111 310
199 3300005719 Ga0068861_100000611 Ga0068861_1000006113 310
200 3300005719 Ga0068861_100023056 Ga0068861_1000230564 310
201 3300005719 Ga0068861_100066360 Ga0068861_1000663602 310
202 3300005719 Ga0068861_100077520 Ga0068861_1000775202 310
203 3300005719 Ga0068861_100124821 Ga0068861_1001248212 310
204 3300005834 Ga0068851_10005132 Ga0068851_100051323 310
205 3300005840 Ga0068870_10135403 Ga0068870_101354031 310
206 3300005841 Ga0068863_100012662 Ga0068863_1000126626 310
207 3300005842 Ga0068858_100094543 Ga0068858_1000945432 310
208 3300005842 Ga0068858_100186944 Ga0068858_1001869442 310
209 3300005843 Ga0068860_100045810 Ga0068860_1000458102 310
210 3300005843 Ga0068860_100260997 Ga0068860_1002609972 310
211 3300005844 Ga0068862_100016298 Ga0068862_1000162983 310
212 3300005844 Ga0068862_100046108 Ga0068862_1000461083 310
213 3300005844 Ga0068862_100292506 Ga0068862_1002925062 310
214 3300006058 Ga0075432_10030350 Ga0075432_100303501 310
215 3300006237 Ga0097621_100005308 Ga0097621_1000053083 310
216 3300006237 Ga0097621_100009789 Ga0097621_1000097893 310
217 3300006237 Ga0097621_100206232 Ga0097621_1002062322 310
218 3300006358 Ga0068871_100006530 Ga0068871_1000065304 310
219 3300006844 Ga0075428_100010732 Ga0075428_1000107327 310
220 3300006844 Ga0075428_100094570 Ga0075428_1000945702 310
221 3300006844 Ga0075428_100179889 Ga0075428_1001798892 310
222 3300006846 Ga0075430_100010906 Ga0075430_1000109065 310
223 3300006847 Ga0075431_100032316 Ga0075431_1000323162 310
224 3300006847 Ga0075431_100084737 Ga0075431_1000847373 310
225 3300006880 Ga0075429_100011699 Ga0075429_1000116992 310
226 3300006880 Ga0075429_100025582 Ga0075429_1000255824 310
227 3300006880 Ga0075429_100237279 Ga0075429_1002372792 310
228 3300006881 Ga0068865_100013620 Ga0068865_1000136204 310
229 3300006931 Ga0097620_100005803 Ga0097620_1000058034 310
230 3300006931 Ga0097620_100021150 Ga0097620_1000211504 310
231 3300006931 Ga0097620_100025308 Ga0097620_1000253082 310
232 3300006931 Ga0097620_100122951 Ga0097620_1001229513 310
233 3300006931 Ga0097620_100136076 Ga0097620_1001360762 310
234 3300006931 Ga0097620_100137969 Ga0097620_1001379692 310
235 3300006931 Ga0097620_100181881 Ga0097620_1001818812 310
236 3300009093 Ga0105240_10410649 Ga0105240_104106491 310
237 3300009094 Ga0111539_10002823 Ga0111539_100028236 310
238 3300009094 Ga0111539_10084508 Ga0111539_100845083 310
239 3300009094 Ga0111539_10426813 Ga0111539_104268131 310
240 3300009098 Ga0105245_10302699 Ga0105245_103026992 310
241 3300009101 Ga0105247_10000512 Ga0105247_1000051222 310
242 3300009147 Ga0114129_10000005 Ga0114129_1000000510 310
243 3300009147 Ga0114129_10192034 Ga0114129_101920342 310
244 3300009147 Ga0114129_10280074 Ga0114129_102800742 310
245 3300009147 Ga0114129_10518303 Ga0114129_105183031 310
246 3300009147 Ga0114129_10523275 Ga0114129_105232751 310
247 3300009148 Ga0105243_10002963 Ga0105243_100029637 310
248 3300009174 Ga0105241_10000416 Ga0105241_100004166 310
249 3300009174 Ga0105241_10039051 Ga0105241_100390513 310
250 3300009174 Ga0105241_10120113 Ga0105241_101201131 310
251 3300009176 Ga0105242_10000362 Ga0105242_1000036221 310
252 3300009176 Ga0105242_10001430 Ga0105242_100014307 310
253 3300009176 Ga0105242_10018288 Ga0105242_100182886 310
254 3300009177 Ga0105248_10011316 Ga0105248_100113163 310
255 3300009177 Ga0105248_10159051 Ga0105248_101590512 310
256 3300009177 Ga0105248_10476224 Ga0105248_104762241 310
257 3300009545 Ga0105237_10014768 Ga0105237_100147685 310
258 3300009545 Ga0105237_10087057 Ga0105237_100870573 310
259 3300009551 Ga0105238_10007818 Ga0105238_100078184 310
260 3300009551 Ga0105238_10008569 Ga0105238_100085694 310
261 3300009553 Ga0105249_10000025 Ga0105249_10000025175 310
262 3300009553 Ga0105249_10002741 Ga0105249_100027413 310
263 3300009553 Ga0105249_10011998 Ga0105249_100119983 310
264 3300010375 Ga0105239_10010735 Ga0105239_100107357 310
265 3300010375 Ga0105239_10085299 Ga0105239_100852992 310
266 3300011119 Ga0105246_10020358 Ga0105246_100203581 310
267 3300013297 Ga0157378_10014193 Ga0157378_100141933 310
268 3300013297 Ga0157378_10137937 Ga0157378_101379372 310
269 3300013306 Ga0163162_10000002 Ga0163162_10000002360 310
270 3300013306 Ga0163162_10015304 Ga0163162_100153046 310
271 3300013306 Ga0163162_10020554 Ga0163162_100205542 310
272 3300013306 Ga0163162_10053695 Ga0163162_100536952 310
273 3300013306 Ga0163162_10341832 Ga0163162_103418322 310
274 3300013307 Ga0157372_10013637 Ga0157372_100136376 310
275 3300013307 Ga0157372_10425758 Ga0157372_104257582 310
276 3300013308 Ga0157375_10023578 Ga0157375_100235782 310
277 3300014325 Ga0163163_10011707 Ga0163163_100117074 310
278 3300014325 Ga0163163_10040359 Ga0163163_100403592 310
279 3300014325 Ga0163163_10216513 Ga0163163_102165132 310
280 3300014326 Ga0157380_10004409 Ga0157380_100044097 310
281 3300014326 Ga0157380_10018018 Ga0157380_100180182 310
282 3300014326 Ga0157380_10079611 Ga0157380_100796112 310
283 3300014326 Ga0157380_10145712 Ga0157380_101457121 310
284 3300014326 Ga0157380_10173814 Ga0157380_101738142 310
285 3300014745 Ga0157377_10094711 Ga0157377_100947112 310
286 3300014745 Ga0157377_10199233 Ga0157377_101992332 310
287 3300014968 Ga0157379_10085773 Ga0157379_100857732 310
288 3300014968 Ga0157379_10148072 Ga0157379_101480722 310
289 3300014968 Ga0157379_10346367 Ga0157379_103463672 310
290 3300014969 Ga0157376_10076093 Ga0157376_100760932 310
291 3300025228 Ga0209672_100026 Ga0209672_10002685 310
292 3300025229 Ga0209147_100033 Ga0209147_10003385 310
293 3300025242 Ga0209258_100051 Ga0209258_10005185 310
294 3300025254 Ga0209148_1000313 Ga0209148_100031364 310
295 3300025272 Ga0209455_1000154 Ga0209455_100015485 310
296 3300025321 Ga0207656_10005213 Ga0207656_100052134 310
297 3300025900 Ga0207710_10005886 Ga0207710_100058863 310
298 3300025908 Ga0207643_10001406 Ga0207643_1000140612 310
299 3300025911 Ga0207654_10002645 Ga0207654_100026453 310
300 3300025914 Ga0207671_10009883 Ga0207671_100098836 310
301 3300025917 Ga0207660_10012850 Ga0207660_100128502 310
302 3300025920 Ga0207649_10150129 Ga0207649_101501292 310
303 3300025923 Ga0207681_10031245 Ga0207681_100312451 310
304 3300025924 Ga0207694_10003389 Ga0207694_100033893 310
305 3300025924 Ga0207694_10005204 Ga0207694_100052045 310
306 3300025925 Ga0207650_10000017 Ga0207650_1000001781 310
307 3300025926 Ga0207659_10329093 Ga0207659_103290931 310
308 3300025931 Ga0207644_10009599 Ga0207644_100095993 310
309 3300025931 Ga0207644_10014877 Ga0207644_100148772 310
310 3300025933 Ga0207706_10228785 Ga0207706_102287851 310
311 3300025934 Ga0207686_10003376 Ga0207686_100033762 310
312 3300025934 Ga0207686_10014776 Ga0207686_100147763 310
313 3300025934 Ga0207686_10047972 Ga0207686_100479723 310
314 3300025935 Ga0207709_10024352 Ga0207709_100243522 310
315 3300025936 Ga0207670_10012535 Ga0207670_100125354 310
316 3300025936 Ga0207670_10242299 Ga0207670_102422992 310
317 3300025938 Ga0207704_10041597 Ga0207704_100415972 310
318 3300025938 Ga0207704_10067511 Ga0207704_100675112 310
319 3300025940 Ga0207691_10005584 Ga0207691_100055848 310
320 3300025941 Ga0207711_10006264 Ga0207711_100062645 310
321 3300025941 Ga0207711_10008907 Ga0207711_100089076 310
322 3300025941 Ga0207711_10058904 Ga0207711_100589041 310
323 3300025942 Ga0207689_10002532 Ga0207689_100025323 310
324 3300025949 Ga0207667_10075817 Ga0207667_100758173 310
325 3300025960 Ga0207651_10017698 Ga0207651_100176982 310
326 3300025960 Ga0207651_10021521 Ga0207651_100215214 310
327 3300025960 Ga0207651_10461125 Ga0207651_104611251 310
328 3300025961 Ga0207712_10000070 Ga0207712_1000007091 310
329 3300025961 Ga0207712_10000650 Ga0207712_1000065019 310
330 3300025961 Ga0207712_10094118 Ga0207712_100941182 310
331 3300025961 Ga0207712_10256591 Ga0207712_102565912 310
332 3300025972 Ga0207668_10038421 Ga0207668_100384212 310
333 3300025981 Ga0207640_10047966 Ga0207640_100479661 310
334 3300025981 Ga0207640_10212873 Ga0207640_102128732 310
335 3300026023 Ga0207677_10050536 Ga0207677_100505363 310
336 3300026035 Ga0207703_10017342 Ga0207703_100173425 310
337 3300026035 Ga0207703_10021074 Ga0207703_100210743 310
338 3300026035 Ga0207703_10180545 Ga0207703_101805452 310
339 3300026075 Ga0207708_10005262 Ga0207708_100052623 310
340 3300026075 Ga0207708_10019697 Ga0207708_100196973 310
341 3300026075 Ga0207708_10030884 Ga0207708_100308842 310
342 3300026075 Ga0207708_10038689 Ga0207708_100386893 310
343 3300026088 Ga0207641_10045685 Ga0207641_100456853 310
344 3300026089 Ga0207648_10001882 Ga0207648_1000188213 310
345 3300026089 Ga0207648_10451626 Ga0207648_104516261 310
346 3300026095 Ga0207676_10005365 Ga0207676_100053657 310
347 3300026095 Ga0207676_10007345 Ga0207676_100073454 310
348 3300026095 Ga0207676_10008544 Ga0207676_100085443 310
349 3300026095 Ga0207676_10195648 Ga0207676_101956482 310
350 3300026095 Ga0207676_10563499 Ga0207676_105634992 310
351 3300026116 Ga0207674_10146548 Ga0207674_101465482 310
352 3300026116 Ga0207674_10252791 Ga0207674_102527912 310
353 3300026116 Ga0207674_10258148 Ga0207674_102581482 310
354 3300026118 Ga0207675_100010273 Ga0207675_1000102734 310
355 3300026118 Ga0207675_100060694 Ga0207675_1000606942 310
356 3300026118 Ga0207675_100068287 Ga0207675_1000682872 310
357 3300026118 Ga0207675_100182358 Ga0207675_1001823582 310
358 3300026121 Ga0207683_10029035 Ga0207683_100290352 310
359 3300026142 Ga0207698_10034526 Ga0207698_100345263 310
360 3300026142 Ga0207698_10212467 Ga0207698_102124672 310
361 3300028380 Ga0268265_10062896 Ga0268265_100628962 310
362 3300028381 Ga0268264_10374254 Ga0268264_103742541 310
363 3300031548 Ga0307408_100265321 Ga0307408_1002653211 310
364 3300031901 Ga0307406_10257647 Ga0307406_102576471 310
365 3300031911 Ga0307412_10043426 Ga0307412_100434262 310
366 3300031911 Ga0307412_10251205 Ga0307412_102512052 310
367 3300032002 Ga0307416_100003680 Ga0307416_1000036803 310
368 3300032004 Ga0307414_10045046 Ga0307414_100450462 310
369 3300032005 Ga0307411_10070237 Ga0307411_100702372 310
370 3300035091 Ga0373951_0002121 Ga0373951_0002121_3041_3973 310
371 3300035115 Ga0373941_0011218 Ga0373941_0011218_1070_2014 310
372 3300036401 Ga0373937_0125687 Ga0373937_0125687_81_1013 310
373 3300037068 Ga0373925_0009327 Ga0373925_0009327_2882_3829 310
374 3300037466 Ga0395898_0164363 Ga0395898_0164363_430_1362 310
375 3300042876 Ga0451577_0122145 Ga0451577_0122145_1099_2031 310
376 3300045051 Ga0451576_0078986 Ga0451576_0078986_1187_2119 310
377 3300046472 Ga0495580_0097405 Ga0495580_0097405_742_1674 310
378 3300046472 Ga0495580_0254162 Ga0495580_0254162_168_1100 310
379 3300046475 Ga0495639_0093088 Ga0495639_0093088_205_1137 310
380 3300046477 Ga0495664_0221484 Ga0495664_0221484_31_963 310
381 3300046513 Ga0495616_0056429 Ga0495616_0056429_707_1666 310
382 3300046514 Ga0495618_0012901 Ga0495618_0012901_3157_4095 310
383 3300046517 Ga0495630_0146729 Ga0495630_0146729_356_1294 310
384 3300046642 Ga0495634_0012703 Ga0495634_0012703_1753_2691 310
385 3300046683 Ga0495658_0107023 Ga0495658_0107023_422_1354 310
386 3300046689 Ga0495613_0040329 Ga0495613_0040329_384_1316 310
387 3300047320 Ga0495672_0049658 Ga0495672_0049658_1284_2243 310
388 3300047471 Ga0495684_0008358 Ga0495684_0008358_2169_3101 310
389 3300048905 Ga0496102_0382690 Ga0496102_0382690_270_1202 310
390 3300048915 Ga0496112_0305098 Ga0496112_0305098_302_1255 310
391 3300049574 Ga0501038_0002729 Ga0501038_0002729_6323_7255 310
392 3300049588 Ga0501072_0040437 Ga0501072_0040437_1132_2097 310
393 3300049592 Ga0501076_0139346 Ga0501076_0139346_565_1530 310
394 3300049741 Ga0501079_0073631 Ga0501079_0073631_1326_2291 310
395 3300050507 nmdc:mga05p37_2020_c1 nmdc:mga05p37_2020_c1_20132_21079 310
396 3300050507 nmdc:mga05p37_274392_c1 nmdc:mga05p37_274392_c1_641_1573 310
397 3300050508 nmdc:mga09592_12377_c2 nmdc:mga09592_12377_c2_4914_5861 310
398 3300050508 nmdc:mga09592_226960_c1 nmdc:mga09592_226960_c1_488_1420 310
399 3300050508 nmdc:mga09592_338905_c1 nmdc:mga09592_338905_c1_190_1134 310
400 3300050509 nmdc:mga0qj67_202435_c1 nmdc:mga0qj67_202435_c1_184_1116 310
401 3300050510 nmdc:mga06r32_771_c1 nmdc:mga06r32_771_c1_10746_11693 310
402 3300050511 nmdc:mga08y16_154856_c1 nmdc:mga08y16_154856_c1_180_1112 310
403 3300053139 Ga0500568_0003754 Ga0500568_0003754_4564_5523 310

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01515

PTA_PTB

Phosphate acetyl/butaryl transferase

107

329

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vg9-assembly1.cif.gz_A crystal structure of phosphotransbutyrylase from clostridium acetobutylicum 0.9509 10 303
7vg9-assembly1.cif.gz_A crystal structure of phosphotransbutyrylase from clostridium acetobutylicum 0.9265 10 303
3u9e-assembly1.cif.gz_B the crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with coa. 0.9182 21 302
1yco-assembly1.cif.gz_A crystal structure of a branched-chain phosphotransacylase from enterococcus faecalis v583 0.8835 23 304
1yco-assembly1.cif.gz_B crystal structure of a branched-chain phosphotransacylase from enterococcus faecalis v583 0.8738 23 302
ID Description Score Start End Superfamily
3u9eA00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9308 18 303 3.40.718.10
3u9eA00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.9024 18 303 3.40.718.10
1ycoB00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8738 23 302 3.40.718.10
1ycoB00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8616 23 302 3.40.718.10
af_Q2G0J0_17_327_3.40.718.10 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8565 23 303 3.40.718.10
ID Description Score Start End GO Terms
AF-A0A536WXC6-F1-model_v4 Phosphate acetyltransferase (EC 2.3.1.8) 0.9859 9 107 GO:0008959
AF-A0A6L5DLZ6-F1-model_v4 deleted 0.9791 9 307
AF-A0A0C4YC54-F1-model_v4 Phosphate acetyltransferase (EC 2.3.1.8) 0.979 9 309 GO:0008959
AF-A0A2R4VPU6-F1-model_v4 Enoyl-CoA hydratase 0.9777 7 108 GO:0006633
GO:0019171
AF-N6ZUF3-F1-model_v4 Phosphate acetyltransferase 0.9775 20 308 GO:0016746

Feature Viewer

pLDDT pTM Quality
91.35 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map