F435388

General Info

Members Datasets Scaffolds Average Seq Length
403 247 352 510

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10000642|Ga0157372_1000064214
Length 555
Sequence LELILACPANLLKNAELVTVFSKQTRRFKMCARAMRCTAQFCIFARMQETILILDFGSQYTQLIARRVRELNVYCEIHPFNKIPEITGNIKGVILSGSPFSVRASDAPNPDLSAFKNKLPLLGVCYGAQLMAHKFGGEVQKSEHREYGRANLSFVKADNELFKGVSNNSQVWMSHADTITKIPDNYEIISSTKDVKFAGYQVKGEQTYGIQFHPEVYHSTEGAVLLKNFVVEICGCRQDWTPDSFVETTVKELQQKIGNDKVVLGLSGGVDSSVAAVLLHKAIGKNLYCIFVDNGLLRKNEFETVLDSYKHMGLNVKGVNAKDRFYAELAGVSDPEKKRKAIGKVFIDVFDDESKRIEDVKWLGQGTIYPDVIESVSVKGPSATIKSHHNVGGLPDFMKLKIVEPLNTLFKDEVRRVGKTLQIDDAILGRHPFPGPGLAIRILGDITAEKVRILQEVDSIFIDNLKSADLYKDVWQAGAIFLPVQSVGVMGDERTYENAVALRAVTSTDGMTADWCHLPYEFLGKVSNEIINKVKGINRVVYDISSKPPATIEWE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
3 2523533628 Maridesulfovibrio zosterae DSM 11974 Isolate Rhizosphere
4 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
5 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
6 2738541283 Pedobacter sp. OK701 Isolate Unclassified
7 2738541284 Pedobacter sp. YR016 Isolate Unclassified
8 2738541302 Pedobacter sp. CF074 Isolate Unclassified
9 2738543023 Pedobacter sp. OK628 Isolate Unclassified
10 2739367651 Pedobacter sp. OK291 Isolate Unclassified
11 2739367656 Pedobacter sp. CF523 Isolate Unclassified
12 2739367663 Pedobacter sp. YR510 Isolate Unclassified
13 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
14 2818991437 Pedobacter terrae 518 Isolate Unclassified
15 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
16 2818991444 Filimonas endophytica 3197 Isolate Unclassified
17 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
18 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
19 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
20 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
21 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
22 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
23 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
24 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
25 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
26 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
27 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
28 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
29 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
30 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
31 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
32 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
33 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
34 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
35 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
36 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
37 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
38 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
39 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
40 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
41 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
42 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
43 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
44 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
45 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
46 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
47 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
48 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
49 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
50 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
51 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
52 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
53 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
54 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
55 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
56 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
57 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
58 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
59 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
60 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
61 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
62 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
63 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
64 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
65 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
66 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
67 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
68 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
69 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
72 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
73 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
74 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
75 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
76 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
77 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
78 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
79 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
80 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
81 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
82 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
83 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
84 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
85 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
86 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
87 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
88 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
89 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
90 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
91 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
92 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
93 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
117 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
118 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
119 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
122 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
123 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
124 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
126 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
127 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
128 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
130 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
131 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
133 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
135 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
136 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
138 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
163 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
164 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
165 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
166 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
167 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
176 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
177 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
178 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
185 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
188 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
189 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
190 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
191 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
192 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
193 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
194 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
195 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
196 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
197 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
198 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
199 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
200 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
201 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
202 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
203 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
204 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
205 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
206 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
209 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
210 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
211 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
212 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
213 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
223 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
224 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
225 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
226 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
230 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
231 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
232 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
233 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
234 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
235 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
236 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
237 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
238 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
239 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
240 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
241 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
242 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
243 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
244 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
245 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
246 8015556637 Bdellovibrio reynosensis LBG001 Isolate Rhizosphere
247 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.6
Metatranscriptomes 0.5
Isolates 12.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.65
Nodule 0
Rhizoplane 0.5
Rhizosphere 71.96
Stem 0
Stem Tuber 0
Unclassified 13.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1761633 2162886007 Bacteria 195701
2 SwRhRL2b_contig_1785592 2162886007 Bacteria 28394
3 SwRhRL2b_contig_2693654 2162886007 Bacteria 123938
4 SwRhRL2b_contig_38688 2162886007 Bacteria 22286
5 JGI24740J21852_10000503 3300001979 Bacteria 16803
6 JGI24737J22298_10002164 3300001990 Bacteria 7008
7 JGI24737J22298_10006779 3300001990 Bacteria 3890
8 JGI24735J21928_10000038 3300002067 Bacteria 64134
9 JGI25162J39368_1000047 3300002737 Viruses 167507
10 JGI25162J39368_1000940 3300002737 Bacteria 18700
11 JGI25154J39366_1000004 3300002738 Bacteria 346460
12 JGI25152J39213_1000195 3300002773 Bacteria 40804
13 JGI25150J39212_1000014 3300002774 Bacteria 170955
14 JGI25151J46595_10000042 3300003187 Bacteria 170955
15 JGI25165J46597_1001356 3300003214 Bacteria 13638
16 JGI25153J46596_10000009 3300003215 Bacteria 340925
17 rootH1_10022825 3300003316 Bacteria 10594
18 rootH2_10002048 3300003320 Bacteria 70313
19 rootH2_10013605 3300003320 Bacteria 52813
20 rootL2_10012658 3300003322 Bacteria 11372
21 rootL2_10012659 3300003322 Bacteria 3258
22 rootH1_10003426 3300003323 Bacteria 42703
23 rootH1_10004301 3300003316 Bacteria 2946
24 rootH1_10004301 3300003323 Bacteria 21275
25 rootH1_10050816 3300003323 Bacteria 5399
26 rootH1_10210593 3300003323 Bacteria 6674
27 JGI25160J50197_1004415 3300003354 Bacteria 6095
28 JGI25160J50197_1004554 3300003354 Bacteria 5971
29 Ga0055536_1000019 3300003781 Bacteria 203087
30 Ga0055530_10001246 3300003791 Bacteria 19383
31 Ga0055531_10000171 3300003794 Bacteria 73046
32 Ga0058863_11968118 3300004799 Bacteria 4912
33 Ga0058862_12403007 3300004803 Bacteria 2888
34 Ga0065165_1000060 3300005262 Bacteria 180226
35 Ga0065714_10002525 3300005288 Bacteria 27682
36 Ga0065714_10064969 3300005288 Bacteria 14694
37 Ga0065714_10065104 3300005288 Bacteria 12936
38 Ga0065714_10074878 3300005288 Bacteria 2979
39 Ga0065704_10000195 3300005289 Bacteria 195830
40 Ga0065704_10000301 3300005289 Bacteria 42046
41 Ga0065704_10070132 3300005289 Bacteria 1955461
42 Ga0065704_10075020 3300005289 Bacteria 5840
43 Ga0065704_10081460 3300005289 Bacteria 3741
44 Ga0065704_10083738 3300005289 Bacteria 3425
45 Ga0065715_10003509 3300005293 Bacteria 5698
46 Ga0070658_10000014 3300005327 Bacteria 244978
47 Ga0070658_10079249 3300005327 Bacteria 2697
48 Ga0070676_10000619 3300005328 Bacteria 17345
49 Ga0070683_100129177 3300005329 Bacteria 2390
50 Ga0068868_100046733 3300005338 Bacteria 3389
51 Ga0070660_100004154 3300005339 Bacteria 9997
52 Ga0070660_100006750 3300005339 Bacteria 7963
53 Ga0070673_100004298 3300005364 Bacteria 8997
54 Ga0070659_100000253 3300005366 Bacteria 42218
55 Ga0070659_100023927 3300005366 Bacteria 4679
56 Ga0070714_100085776 3300005435 Bacteria 2751
57 Ga0070713_100215477 3300005436 Bacteria 1740
58 Ga0070662_100000054 3300005457 Bacteria 60719
59 Ga0070681_10004904 3300005458 Bacteria 12846
60 Ga0068853_100006872 3300005539 Bacteria 9077
61 Ga0070665_100000010 3300005548 Bacteria 529545
62 Ga0070665_100002844 3300005548 Bacteria 18745
63 Ga0068855_100000927 3300005563 Bacteria 36472
64 Ga0068855_100003209 3300005563 Bacteria 20016
65 Ga0068855_100036016 3300005563 Bacteria 5892
66 Ga0068855_100161484 3300005563 Bacteria 2543
67 Ga0068856_100000023 3300005614 Bacteria 141671
68 Ga0068856_100023566 3300005614 Bacteria 5985
69 Ga0068856_100095462 3300005614 Bacteria 2961
70 Ga0068856_100102395 3300005614 Bacteria 2857
71 Ga0068856_100113219 3300005614 Bacteria 2711
72 Ga0068852_100001687 3300005616 Bacteria 15044
73 Ga0068851_10000739 3300005834 Bacteria 13977
74 Ga0068870_10025269 3300005840 Bacteria 2947
75 Ga0075366_10003370 3300006195 Bacteria 8415
76 Ga0075366_10025107 3300006195 Bacteria 3478
77 Ga0068871_100004730 3300006358 Bacteria 9526
78 Ga0068865_100000076 3300006881 Bacteria 51732
79 Ga0105244_10000003 3300009036 Bacteria 494610
80 Ga0105240_10000294 3300009093 Bacteria 97108
81 Ga0105240_10113800 3300009093 Bacteria 3269
82 Ga0105240_10135564 3300009093 Bacteria 2949
83 Ga0105243_10021331 3300009148 Bacteria 4916
84 Ga0105241_10003146 3300009174 Bacteria 12277
85 Ga0105242_10060473 3300009176 Bacteria 3113
86 Ga0105242_10087653 3300009176 Bacteria 2613
87 Ga0105237_10000109 3300009545 Bacteria 115699
88 Ga0105237_10000578 3300009545 Bacteria 51257
89 Ga0105237_10000994 3300009545 Bacteria 38153
90 Ga0105237_10016843 3300009545 Bacteria 7585
91 Ga0105237_10103845 3300009545 Bacteria 2834
92 Ga0105238_10093622 3300009551 Bacteria 2993
93 Ga0105239_10000040 3300010375 Bacteria 201445
94 Ga0105239_10000162 3300010375 Bacteria 95804
95 Ga0105239_10020511 3300010375 Bacteria 7289
96 Ga0105239_10028567 3300010375 Bacteria 6132
97 Ga0105239_10214748 3300010375 Bacteria 2156
98 Ga0157373_10000284 3300013100 Bacteria 40521
99 Ga0157373_10002793 3300013100 Bacteria 13213
100 Ga0157373_10003236 3300013100 Bacteria 12311
101 Ga0157373_10006735 3300013100 Bacteria 8552
102 Ga0157373_10010686 3300013100 Bacteria 6752
103 Ga0157373_10087011 3300013100 Bacteria 2202
104 Ga0157371_10000298 3300013102 Bacteria 65719
105 Ga0157371_10000918 3300013102 Bacteria 33144
106 Ga0157371_10001041 3300013102 Bacteria 30406
107 Ga0157371_10001311 3300013102 Bacteria 26152
108 Ga0157371_10017950 3300013102 Bacteria 5243
109 Ga0157371_10021981 3300013102 Bacteria 4682
110 Ga0157371_10034017 3300013102 Bacteria 3660
111 Ga0157370_10000197 3300013104 Bacteria 75846
112 Ga0157370_10000382 3300013104 Bacteria 55802
113 Ga0157370_10038016 3300013104 Bacteria 4659
114 Ga0157370_10095953 3300013104 Bacteria 2782
115 Ga0157369_10000031 3300013105 Bacteria 203214
116 Ga0157369_10001423 3300013105 Bacteria 29363
117 Ga0157369_10072354 3300013105 Bacteria 3700
118 Ga0157374_10000391 3300013296 Bacteria 40035
119 Ga0157374_10003495 3300013296 Bacteria 13206
120 Ga0157374_10012252 3300013296 Bacteria 7455
121 Ga0157374_10062171 3300013296 Bacteria 3499
122 Ga0157378_10068949 3300013297 Bacteria 3172
123 Ga0163162_10000082 3300013306 Bacteria 86888
124 Ga0163162_10000093 3300013306 Bacteria 82738
125 Ga0163162_10027158 3300013306 Bacteria 5659
126 Ga0157372_10000026 3300013307 Bacteria 195407
127 Ga0157372_10000071 3300013307 Bacteria 109638
128 Ga0157372_10000642 3300013307 Bacteria 38382
129 Ga0157372_10012580 3300013307 Bacteria 9011
130 Ga0157372_10041404 3300013307 Bacteria 5094
131 Ga0157375_10143642 3300013308 Bacteria 2516
132 Ga0157375_10170321 3300013308 Bacteria 2325
133 Ga0157380_10000021 3300014326 Bacteria 114368
134 Ga0157380_10000054 3300014326 Bacteria 65705
135 Ga0182008_10000024 3300014497 Bacteria 199978
136 Ga0182008_10000082 3300014497 Bacteria 74716
137 Ga0182008_10000503 3300014497 Bacteria 29456
138 Ga0157377_10048959 3300014745 Bacteria 2374
139 Ga0182006_1000424 3300015261 Bacteria 33825
140 Ga0182006_1001382 3300015261 Bacteria 14763
141 Ga0182006_1002791 3300015261 Bacteria 9323
142 Ga0182006_1003339 3300015261 Bacteria 8263
143 Ga0182007_10000002 3300015262 Bacteria 564661
144 Ga0182007_10009933 3300015262 Bacteria 3792
145 Ga0182005_1000040 3300015265 Bacteria 151222
146 Ga0183373_1004 3300015682 Bacteria 537398
147 Ga0163161_10000831 3300017792 Bacteria 24092
148 Ga0163161_10000856 3300017792 Bacteria 23716
149 Ga0163161_10001453 3300017792 Bacteria 17518
150 Ga0163161_10001812 3300017792 Bacteria 15609
151 Ga0163161_10014594 3300017792 Bacteria 5470
152 Ga0209436_101268 3300025208 Bacteria 9071
153 Ga0207427_100137 3300025231 Bacteria 88182
154 Ga0209437_100089 3300025233 Bacteria 250476
155 Ga0209437_100112 3300025233 Bacteria 214292
156 Ga0209258_100476 3300025242 Bacteria 42226
157 Ga0207425_1000023 3300025245 Bacteria 341339
158 Ga0209646_1000025 3300025246 Bacteria 406493
159 Ga0209026_1000189 3300025250 Bacteria 89924
160 Ga0209026_1003466 3300025250 Bacteria 5156
161 Ga0209148_1000129 3300025254 Bacteria 175720
162 Ga0209129_1000032 3300025258 Bacteria 341150
163 Ga0209233_1000126 3300025261 Bacteria 214298
164 Ga0209455_1008622 3300025272 Bacteria 2755
165 Ga0209130_1001332 3300025284 Bacteria 16720
166 Ga0209676_1000009 3300025292 Bacteria 981719
167 Ga0209676_1000351 3300025292 Bacteria 87135
168 Ga0209025_1000047 3300025294 Bacteria 341150
169 Ga0209758_1000145 3300025297 Bacteria 170553
170 Ga0209050_1000094 3300025298 Bacteria 242893
171 Ga0207426_1000057 3300025302 Bacteria 369548
172 Ga0207426_1000604 3300025302 Bacteria 46749
173 Ga0209257_1000004 3300025304 Bacteria 1678347
174 Ga0209257_1000006 3300025304 Bacteria 1570111
175 Ga0207656_10000115 3300025321 Bacteria 30785
176 Ga0207655_1000010 3300025728 Bacteria 649325
177 Ga0207647_10000046 3300025904 Bacteria 90148
178 Ga0207647_10000617 3300025904 Bacteria 27702
179 Ga0207647_10033547 3300025904 Bacteria 3287
180 Ga0207645_10001668 3300025907 Bacteria 18063
181 Ga0207705_10000107 3300025909 Bacteria 94984
182 Ga0207654_10003529 3300025911 Bacteria 7910
183 Ga0207654_10020448 3300025911 Bacteria 3509
184 Ga0207695_10000142 3300025913 Bacteria 214715
185 Ga0207695_10006220 3300025913 Bacteria 15543
186 Ga0207695_10018989 3300025913 Bacteria 7928
187 Ga0207695_10021471 3300025913 Bacteria 7363
188 Ga0207695_10112816 3300025913 Bacteria 2695
189 Ga0207671_10000063 3300025914 Bacteria 170060
190 Ga0207671_10000407 3300025914 Bacteria 60207
191 Ga0207671_10003029 3300025914 Bacteria 17218
192 Ga0207671_10005221 3300025914 Bacteria 12074
193 Ga0207671_10006948 3300025914 Bacteria 9958
194 Ga0207657_10016593 3300025919 Bacteria 7095
195 Ga0207657_10051242 3300025919 Bacteria 3588
196 Ga0207664_10069251 3300025929 Bacteria 2837
197 Ga0207690_10000293 3300025932 Bacteria 35416
198 Ga0207706_10000669 3300025933 Bacteria 36066
199 Ga0207686_10007074 3300025934 Bacteria 6039
200 Ga0207709_10012838 3300025935 Bacteria 4619
201 Ga0207704_10000169 3300025938 Bacteria 34738
202 Ga0207661_10102425 3300025944 Bacteria 2407
203 Ga0207667_10000015 3300025949 Bacteria 417534
204 Ga0207667_10002558 3300025949 Bacteria 22619
205 Ga0207667_10005697 3300025949 Bacteria 15190
206 Ga0207667_10069562 3300025949 Bacteria 3663
207 Ga0207667_10108810 3300025949 Bacteria 2859
208 Ga0207639_10033656 3300026041 Bacteria 3782
209 Ga0207702_10001259 3300026078 Bacteria 25526
210 Ga0207702_10155054 3300026078 Bacteria 2087
211 Ga0207648_10000220 3300026089 Bacteria 61703
212 Ga0207683_10003089 3300026121 Bacteria 14546
213 Ga0210002_1001131 3300027617 Bacteria 3709
214 Ga0268266_10000032 3300028379 Bacteria 395079
215 Ga0268266_10015425 3300028379 Bacteria 6556
216 Ga0307517_10000429 3300028786 Bacteria 72171
217 Ga0307515_10000226 3300028794 Bacteria 139533
218 Ga0307515_10000507 3300028794 Bacteria 93166
219 Ga0307515_10041837 3300028794 Bacteria 7190
220 Ga0265338_10002045 3300028800 Bacteria 31180
221 Ga0265338_10035591 3300028800 Bacteria 4782
222 Ga0265338_10173311 3300028800 Bacteria 1652
223 Ga0265327_10000338 3300031251 Bacteria 88898
224 Ga0265327_10043374 3300031251 Bacteria 2407
225 Ga0307513_10233389 3300031456 Bacteria 1651
226 Ga0307509_10051189 3300031507 Bacteria 4419
227 Ga0307408_100000602 3300031548 Bacteria 30924
228 Ga0307408_100002002 3300031548 Bacteria 14726
229 Ga0307408_100002436 3300031548 Bacteria 13085
230 Ga0307408_100004578 3300031548 Bacteria 9365
231 Ga0316576_10009716 3300031727 Bacteria 6222
232 Ga0307405_10000015 3300031731 Bacteria 206299
233 Ga0307405_10011401 3300031731 Bacteria 4657
234 Ga0307407_10000027 3300031903 Bacteria 107307
235 Ga0307412_10000030 3300031911 Bacteria 208541
236 Ga0307412_10003168 3300031911 Bacteria 9142
237 Ga0307416_100000002 3300032002 Bacteria 509907
238 Ga0307414_10000038 3300032004 Bacteria 150774
239 Ga0307414_10001228 3300032004 Bacteria 13211
240 Ga0307414_10007266 3300032004 Bacteria 6222
241 Ga0307414_10028893 3300032004 Bacteria 3602
242 Ga0307414_10036885 3300032004 Bacteria 3268
243 Ga0307414_10069492 3300032004 Bacteria 2532
244 Ga0307414_10091575 3300032004 Bacteria 2260
245 Ga0307507_10000023 3300033179 Bacteria 212423
246 Ga0307510_10001152 3300033180 Bacteria 28416
247 Ga0316584_0004789 3300036712 Bacteria 8984
248 Ga0395899_0000034 3300037312 Bacteria 302623
249 Ga0395899_0000055 3300037312 Bacteria 220579
250 Ga0395899_0000084 3300037312 Bacteria 159161
251 Ga0395899_0020990 3300037312 Bacteria 4953
252 Ga0395900_0000194 3300037418 Bacteria 97768
253 Ga0395900_0008131 3300037418 Bacteria 10800
254 Ga0395900_0036640 3300037418 Bacteria 5057
255 Ga0395905_0000003 3300037471 Bacteria 1347396
256 Ga0395905_0000340 3300037471 Bacteria 66412
257 Ga0395905_0003171 3300037471 Bacteria 17718
258 Ga0395905_0022429 3300037471 Bacteria 5971
259 Ga0400483_174860 3300039062 Bacteria 22336
260 Ga0451577_0003251 3300042876 Bacteria 18269
261 Ga0466966_0010875 3300044684 Bacteria 6044
262 Ga0453684_0001838 3300044712 Bacteria 55467
263 Ga0453684_0003191 3300044712 Bacteria 37570
264 Ga0453684_0004741 3300044712 Bacteria 28097
265 Ga0453684_0015662 3300044712 Bacteria 11950
266 Ga0453684_0055232 3300044712 Bacteria 5165
267 Ga0453684_0095703 3300044712 Bacteria 3649
268 Ga0453684_0108580 3300044712 Bacteria 3376
269 Ga0466959_0017617 3300045049 Bacteria 5238
270 Ga0466959_0034565 3300045049 Bacteria 3739
271 Ga0451576_0000020 3300045051 Bacteria 529568
272 Ga0451576_0000625 3300045051 Bacteria 73634
273 Ga0451576_0020091 3300045051 Bacteria 7280
274 Ga0495627_004478 3300046453 Bacteria 5843
275 Ga0495627_018500 3300046453 Bacteria 2347
276 Ga0495650_0000198 3300046471 Bacteria 130455
277 Ga0495585_0000391 3300046492 Bacteria 42399
278 Ga0495606_0000003 3300046507 Bacteria 449402
279 Ga0495606_0007202 3300046507 Bacteria 10030
280 Ga0495606_0046189 3300046507 Bacteria 2880
281 Ga0495610_0000197 3300046512 Bacteria 67429
282 Ga0495610_0002942 3300046512 Bacteria 13760
283 Ga0495616_0006818 3300046513 Bacteria 6884
284 Ga0495631_0009584 3300046518 Bacteria 4831
285 Ga0495637_0033578 3300046520 Bacteria 2252
286 Ga0495644_0005095 3300046523 Bacteria 5142
287 Ga0495586_0030350 3300046535 Bacteria 2893
288 Ga0495609_0009453 3300046538 Bacteria 4715
289 Ga0495633_0000017 3300046558 Bacteria 249973
290 Ga0495633_0000267 3300046558 Bacteria 61184
291 Ga0495633_0003424 3300046558 Bacteria 10562
292 Ga0495668_0000010 3300046616 Bacteria 487308
293 Ga0495625_0000524 3300046660 Bacteria 56526
294 Ga0495625_0010537 3300046660 Bacteria 7635
295 Ga0495625_0013186 3300046660 Bacteria 6657
296 Ga0495625_0017936 3300046660 Bacteria 5532
297 Ga0495661_0000778 3300046665 Bacteria 30455
298 Ga0495661_0006247 3300046665 Bacteria 8376
299 Ga0495649_0000168 3300046694 Bacteria 57053
300 Ga0495683_0038225 3300047323 Bacteria 2431
301 Ga0495687_001711 3300047443 Bacteria 19448
302 Ga0495687_032152 3300047443 Bacteria 2399
303 Ga0495686_0000845 3300047472 Bacteria 39321
304 Ga0495686_0002919 3300047472 Bacteria 15334
305 Ga0495686_0079601 3300047472 Bacteria 2004
306 Ga0495614_0043223 3300048089 Bacteria 1932
307 Ga0496115_0009216 3300048918 Bacteria 7328
308 Ga0496121_0000010 3300048924 Bacteria 793488
309 Ga0496122_0000869 3300048925 Bacteria 56890
310 Ga0496124_0016764 3300048927 Bacteria 6948
311 Ga0496125_0001552 3300048928 Bacteria 32788
312 Ga0496126_0010572 3300048929 Bacteria 9652
313 Ga0496126_0013000 3300048929 Bacteria 8495
314 Ga0501031_0000669 3300049568 Bacteria 20380
315 Ga0501032_0003006 3300049569 Bacteria 13083
316 Ga0501033_0000005 3300049570 Bacteria 379089
317 Ga0501034_0000052 3300049571 Bacteria 207572
318 Ga0501034_0029160 3300049571 Bacteria 5610
319 Ga0501037_0004892 3300049573 Bacteria 9745
320 Ga0501038_0002931 3300049574 Bacteria 15917
321 Ga0501039_0008402 3300049575 Bacteria 7869
322 Ga0501043_0002243 3300049579 Bacteria 16460
323 Ga0501047_0056643 3300049581 Bacteria 3791
324 Ga0501223_000806 3300049663 Bacteria 7419
325 Ga0501223_001917 3300049663 Bacteria 4676
326 Ga0501257_002934 3300049686 Bacteria 3623
327 Ga0501259_001902 3300049688 Bacteria 3458
328 Ga0501241_001051 3300049758 Bacteria 5829
329 Ga0501264_000564 3300049761 Bacteria 5364
330 Ga0501035_0004866 3300049822 Bacteria 12739
331 Ga0501044_0001723 3300049823 Bacteria 25593
332 Ga0501045_0011792 3300049824 Bacteria 6140
333 nmdc:mga0k408_156_c2 3300050493 Bacteria 15182
334 Ga0500635_0001979 3300053080 Bacteria 5003
335 Ga0500644_0000491 3300053088 Bacteria 17275
336 Ga0500644_0006977 3300053088 Bacteria 2921
337 Ga0500651_0000455 3300053093 Bacteria 21853
338 Ga0500641_0000119 3300053096 Bacteria 30093
339 Ga0500562_000055 3300053108 Bacteria 58655
340 Ga0500569_000961 3300053109 Bacteria 5183
341 Ga0500618_000489 3300053125 Bacteria 25319
342 Ga0500658_0003022 3300053134 Bacteria 6452
343 Ga0500577_0002420 3300053142 Bacteria 4770
344 Ga0500604_0005011 3300053151 Bacteria 3506
345 Ga0500622_0000041 3300053156 Bacteria 170067
346 Ga0500622_0000045 3300053156 Bacteria 158316
347 Ga0500622_0000059 3300053156 Bacteria 134223
348 Ga0500622_0002792 3300053156 Bacteria 12270
349 Ga0500622_0016378 3300053156 Bacteria 3962
350 Ga0500624_000278 3300053157 Bacteria 17649
351 Ga0500636_0035545 3300053177 Bacteria 2948
352 Ga0500661_000611 3300055283 Bacteria 6689

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013102 Ga0157371_10000918 Ga0157371_1000091811 462
2 iso_pu_bacteria 8015556637 8015557277 498
3 3300037471 Ga0395905_0003171 Ga0395905_0003171_1288_2808 501
4 3300027617 Ga0210002_1001131 Ga0210002_10011312 502
5 2162886007 SwRhRL2b_contig_1785592 SwRhRL2b_0523.00006280 503
6 2162886007 SwRhRL2b_contig_2693654 SwRhRL2b_0752.00000170 503
7 3300005289 Ga0065704_10070132 Ga0065704_10070132312 503
8 iso_pu_bacteria 2738543023 2739303238 503
9 iso_pu_bacteria 2852627209 2852629521 503
10 iso_pu_bacteria 2902048731 2902051351 503
11 iso_pu_bacteria 2919186247 2919190255 503
12 iso_pu_bacteria 2939664404 2939668536 503
13 3300045051 Ga0451576_0000625 Ga0451576_0000625_13867_15384 504
14 iso_pu_bacteria 2522125168 2522548252 504
15 iso_pu_bacteria 2585427687 2586206310 504
16 iso_pu_bacteria 2738541283 2738755404 504
17 iso_pu_bacteria 2738541284 2738763541 504
18 iso_pu_bacteria 2738541302 2738856143 504
19 iso_pu_bacteria 2739367651 2739588296 504
20 iso_pu_bacteria 2739367656 2739613926 504
21 iso_pu_bacteria 2739367663 2739648577 504
22 iso_pu_bacteria 2775506987 2776615021 504
23 iso_pu_bacteria 2818991437 2819546278 504
24 iso_pu_bacteria 2818991444 2819586696 504
25 iso_pu_bacteria 2842722452 2842723891 504
26 iso_pu_bacteria 2842909656 2842912377 504
27 iso_pu_bacteria 2849281842 2849282804 504
28 iso_pu_bacteria 2852623160 2852624884 504
29 iso_pu_bacteria 2857627736 2857629279 504
30 iso_pu_bacteria 2884634485 2884637803 504
31 iso_pu_bacteria 2884933994 2884936221 504
32 iso_pu_bacteria 2904445276 2904446549 504
33 iso_pu_bacteria 2919437846 2919442743 504
34 iso_pu_bacteria 2919509842 2919512405 504
35 iso_pu_bacteria 2919692658 2919696781 504
36 iso_pu_bacteria 2928078545 2928082627 504
37 iso_pu_bacteria 2928147474 2928148786 504
38 iso_pu_bacteria 2929154850 2929155381 504
39 iso_pu_bacteria 2945997725 2945999360 504
40 iso_pu_bacteria 2954016120 2954021757 504
41 iso_pu_bacteria 2958512119 2958515918 504
42 iso_pu_bacteria 2965320100 2965323609 504
43 iso_pu_bacteria 2977232053 2977235783 504
44 iso_pu_bacteria 8056440228 8056444587 504
45 3300028800 Ga0265338_10002045 Ga0265338_1000204528 505
46 3300031548 Ga0307408_100000602 Ga0307408_10000060220 505
47 iso_pu_bacteria 2911138879 2911142703 505
48 iso_pu_bacteria 2523533628 2524000871 506
49 3300003320 rootH2_10002048 rootH2_1000204813 507
50 3300003322 rootL2_10012658 rootL2_100126584 507
51 3300003323 rootH1_10004301 rootH1_1000430114 507
52 3300005614 Ga0068856_100023566 Ga0068856_1000235665 507
53 3300025304 Ga0209257_1000006 Ga0209257_1000006887 507
54 3300028794 Ga0307515_10041837 Ga0307515_100418374 507
55 3300031456 Ga0307513_10233389 Ga0307513_102333891 507
56 3300031507 Ga0307509_10051189 Ga0307509_100511895 507
57 3300037312 Ga0395899_0000084 Ga0395899_0000084_128501_130027 507
58 3300049686 Ga0501257_002934 Ga0501257_002934_610_2229 507
59 3300049688 Ga0501259_001902 Ga0501259_001902_619_2205 507
60 3300049761 Ga0501264_000564 Ga0501264_000564_2195_3814 507
61 iso_pu_bacteria 2818991442 2819572090 507
62 iso_pu_bacteria 2821136567 2821141667 507
63 iso_pu_bacteria 2840677318 2840677935 507
64 iso_pu_bacteria 2883068021 2883070897 507
65 iso_pu_bacteria 2884791551 2884797796 507
66 iso_pu_bacteria 2896085136 2896085752 507
67 iso_pu_bacteria 2896109856 2896113990 507
68 iso_pu_bacteria 2904467357 2904469919 507
69 iso_pu_bacteria 2929239360 2929245275 507
70 iso_pu_bacteria 2929921140 2929927506 507
71 iso_pu_bacteria 8003151029 8003151359 507
72 2162886007 SwRhRL2b_contig_38688 SwRhRL2b_0041.00006620 508
73 3300001990 JGI24737J22298_10002164 JGI24737J22298_100021642 508
74 3300001990 JGI24737J22298_10006779 JGI24737J22298_100067792 508
75 3300002067 JGI24735J21928_10000038 JGI24735J21928_100000387 508
76 3300002737 JGI25162J39368_1000047 JGI25162J39368_100004789 508
77 3300002737 JGI25162J39368_1000940 JGI25162J39368_100094010 508
78 3300002773 JGI25152J39213_1000195 JGI25152J39213_10001957 508
79 3300002774 JGI25150J39212_1000014 JGI25150J39212_100001440 508
80 3300003187 JGI25151J46595_10000042 JGI25151J46595_1000004240 508
81 3300003214 JGI25165J46597_1001356 JGI25165J46597_100135610 508
82 3300003215 JGI25153J46596_10000009 JGI25153J46596_1000000940 508
83 3300003316 rootH1_10022825 rootH1_100228254 508
84 3300003320 rootH2_10013605 rootH2_100136053 508
85 3300003322 rootL2_10012659 rootL2_100126591 508
86 3300003323 rootH1_10003426 rootH1_1000342615 508
87 3300003323 rootH1_10050816 rootH1_100508165 508
88 3300003323 rootH1_10210593 rootH1_102105935 508
89 3300003781 Ga0055536_1000019 Ga0055536_1000019145 508
90 3300003791 Ga0055530_10001246 Ga0055530_100012466 508
91 3300004799 Ga0058863_11968118 Ga0058863_119681183 508
92 3300004803 Ga0058862_12403007 Ga0058862_124030072 508
93 3300005262 Ga0065165_1000060 Ga0065165_1000060112 508
94 3300005288 Ga0065714_10002525 Ga0065714_1000252513 508
95 3300005288 Ga0065714_10064969 Ga0065714_100649695 508
96 3300005288 Ga0065714_10065104 Ga0065714_100651047 508
97 3300005288 Ga0065714_10074878 Ga0065714_100748782 508
98 3300005289 Ga0065704_10000301 Ga0065704_1000030123 508
99 3300005289 Ga0065704_10075020 Ga0065704_100750202 508
100 3300005289 Ga0065704_10081460 Ga0065704_100814603 508
101 3300005293 Ga0065715_10003509 Ga0065715_100035093 508
102 3300005327 Ga0070658_10000014 Ga0070658_10000014172 508
103 3300005327 Ga0070658_10079249 Ga0070658_100792491 508
104 3300005328 Ga0070676_10000619 Ga0070676_100006196 508
105 3300005329 Ga0070683_100129177 Ga0070683_1001291772 508
106 3300005338 Ga0068868_100046733 Ga0068868_1000467331 508
107 3300005339 Ga0070660_100004154 Ga0070660_1000041546 508
108 3300005339 Ga0070660_100006750 Ga0070660_1000067503 508
109 3300005364 Ga0070673_100004298 Ga0070673_1000042987 508
110 3300005366 Ga0070659_100000253 Ga0070659_10000025339 508
111 3300005366 Ga0070659_100023927 Ga0070659_1000239274 508
112 3300005435 Ga0070714_100085776 Ga0070714_1000857762 508
113 3300005436 Ga0070713_100215477 Ga0070713_1002154771 508
114 3300005457 Ga0070662_100000054 Ga0070662_10000005410 508
115 3300005458 Ga0070681_10004904 Ga0070681_100049045 508
116 3300005539 Ga0068853_100006872 Ga0068853_1000068722 508
117 3300005548 Ga0070665_100000010 Ga0070665_100000010289 508
118 3300005563 Ga0068855_100000927 Ga0068855_10000092721 508
119 3300005563 Ga0068855_100003209 Ga0068855_1000032091 508
120 3300005563 Ga0068855_100036016 Ga0068855_1000360165 508
121 3300005563 Ga0068855_100161484 Ga0068855_1001614842 508
122 3300005614 Ga0068856_100000023 Ga0068856_10000002363 508
123 3300005614 Ga0068856_100095462 Ga0068856_1000954622 508
124 3300005614 Ga0068856_100102395 Ga0068856_1001023952 508
125 3300005614 Ga0068856_100113219 Ga0068856_1001132192 508
126 3300005616 Ga0068852_100001687 Ga0068852_1000016879 508
127 3300005840 Ga0068870_10025269 Ga0068870_100252692 508
128 3300006195 Ga0075366_10003370 Ga0075366_100033702 508
129 3300006195 Ga0075366_10025107 Ga0075366_100251072 508
130 3300006358 Ga0068871_100004730 Ga0068871_1000047308 508
131 3300006881 Ga0068865_100000076 Ga0068865_10000007647 508
132 3300009036 Ga0105244_10000003 Ga0105244_10000003248 508
133 3300009093 Ga0105240_10000294 Ga0105240_1000029450 508
134 3300009093 Ga0105240_10135564 Ga0105240_101355642 508
135 3300009148 Ga0105243_10021331 Ga0105243_100213312 508
136 3300009174 Ga0105241_10003146 Ga0105241_100031468 508
137 3300009176 Ga0105242_10060473 Ga0105242_100604732 508
138 3300009176 Ga0105242_10087653 Ga0105242_100876532 508
139 3300009545 Ga0105237_10000109 Ga0105237_1000010941 508
140 3300009545 Ga0105237_10000578 Ga0105237_100005787 508
141 3300009545 Ga0105237_10000994 Ga0105237_1000099434 508
142 3300009545 Ga0105237_10103845 Ga0105237_101038452 508
143 3300009551 Ga0105238_10093622 Ga0105238_100936222 508
144 3300010375 Ga0105239_10000040 Ga0105239_100000409 508
145 3300010375 Ga0105239_10000162 Ga0105239_100001623 508
146 3300010375 Ga0105239_10020511 Ga0105239_100205113 508
147 3300010375 Ga0105239_10028567 Ga0105239_100285677 508
148 3300010375 Ga0105239_10214748 Ga0105239_102147481 508
149 3300013100 Ga0157373_10000284 Ga0157373_1000028416 508
150 3300013100 Ga0157373_10002793 Ga0157373_100027939 508
151 3300013100 Ga0157373_10003236 Ga0157373_100032368 508
152 3300013100 Ga0157373_10006735 Ga0157373_100067355 508
153 3300013100 Ga0157373_10010686 Ga0157373_100106866 508
154 3300013100 Ga0157373_10087011 Ga0157373_100870112 508
155 3300013102 Ga0157371_10000298 Ga0157371_1000029832 508
156 3300013102 Ga0157371_10001041 Ga0157371_1000104114 508
157 3300013102 Ga0157371_10001311 Ga0157371_1000131112 508
158 3300013102 Ga0157371_10017950 Ga0157371_100179504 508
159 3300013102 Ga0157371_10021981 Ga0157371_100219813 508
160 3300013102 Ga0157371_10034017 Ga0157371_100340173 508
161 3300013104 Ga0157370_10000197 Ga0157370_1000019741 508
162 3300013104 Ga0157370_10000382 Ga0157370_1000038227 508
163 3300013104 Ga0157370_10038016 Ga0157370_100380167 508
164 3300013104 Ga0157370_10095953 Ga0157370_100959533 508
165 3300013105 Ga0157369_10000031 Ga0157369_1000003115 508
166 3300013105 Ga0157369_10001423 Ga0157369_1000142314 508
167 3300013105 Ga0157369_10072354 Ga0157369_100723544 508
168 3300013296 Ga0157374_10000391 Ga0157374_100003917 508
169 3300013296 Ga0157374_10003495 Ga0157374_100034952 508
170 3300013296 Ga0157374_10012252 Ga0157374_100122522 508
171 3300013296 Ga0157374_10062171 Ga0157374_100621711 508
172 3300013297 Ga0157378_10068949 Ga0157378_100689492 508
173 3300013306 Ga0163162_10000082 Ga0163162_1000008219 508
174 3300013306 Ga0163162_10000093 Ga0163162_1000009362 508
175 3300013306 Ga0163162_10027158 Ga0163162_100271585 508
176 3300013307 Ga0157372_10000026 Ga0157372_1000002654 508
177 3300013307 Ga0157372_10000071 Ga0157372_1000007143 508
178 3300013307 Ga0157372_10000642 Ga0157372_1000064214 508
179 3300013307 Ga0157372_10012580 Ga0157372_100125803 508
180 3300013308 Ga0157375_10143642 Ga0157375_101436421 508
181 3300013308 Ga0157375_10170321 Ga0157375_101703212 508
182 3300014326 Ga0157380_10000054 Ga0157380_100000545 508
183 3300014497 Ga0182008_10000024 Ga0182008_1000002461 508
184 3300014497 Ga0182008_10000082 Ga0182008_1000008239 508
185 3300014497 Ga0182008_10000503 Ga0182008_1000050321 508
186 3300014745 Ga0157377_10048959 Ga0157377_100489593 508
187 3300015261 Ga0182006_1000424 Ga0182006_100042424 508
188 3300015261 Ga0182006_1001382 Ga0182006_10013827 508
189 3300015261 Ga0182006_1002791 Ga0182006_10027917 508
190 3300015261 Ga0182006_1003339 Ga0182006_10033397 508
191 3300015262 Ga0182007_10000002 Ga0182007_1000000246 508
192 3300015262 Ga0182007_10009933 Ga0182007_100099333 508
193 3300015682 Ga0183373_1004 Ga0183373_1004425 508
194 3300017792 Ga0163161_10000831 Ga0163161_100008315 508
195 3300017792 Ga0163161_10000856 Ga0163161_100008568 508
196 3300017792 Ga0163161_10001453 Ga0163161_100014538 508
197 3300017792 Ga0163161_10001812 Ga0163161_100018125 508
198 3300017792 Ga0163161_10014594 Ga0163161_100145945 508
199 3300025231 Ga0207427_100137 Ga0207427_10013752 508
200 3300025233 Ga0209437_100089 Ga0209437_100089156 508
201 3300025233 Ga0209437_100112 Ga0209437_100112110 508
202 3300025245 Ga0207425_1000023 Ga0207425_100002340 508
203 3300025250 Ga0209026_1003466 Ga0209026_10034662 508
204 3300025258 Ga0209129_1000032 Ga0209129_1000032233 508
205 3300025261 Ga0209233_1000126 Ga0209233_100012671 508
206 3300025272 Ga0209455_1008622 Ga0209455_10086222 508
207 3300025292 Ga0209676_1000009 Ga0209676_100000940 508
208 3300025292 Ga0209676_1000351 Ga0209676_100035146 508
209 3300025294 Ga0209025_1000047 Ga0209025_1000047233 508
210 3300025297 Ga0209758_1000145 Ga0209758_100014540 508
211 3300025298 Ga0209050_1000094 Ga0209050_100009440 508
212 3300025728 Ga0207655_1000010 Ga0207655_1000010301 508
213 3300025904 Ga0207647_10000046 Ga0207647_1000004650 508
214 3300025904 Ga0207647_10000617 Ga0207647_100006179 508
215 3300025904 Ga0207647_10033547 Ga0207647_100335472 508
216 3300025907 Ga0207645_10001668 Ga0207645_100016687 508
217 3300025909 Ga0207705_10000107 Ga0207705_1000010729 508
218 3300025911 Ga0207654_10003529 Ga0207654_100035295 508
219 3300025911 Ga0207654_10020448 Ga0207654_100204483 508
220 3300025913 Ga0207695_10000142 Ga0207695_10000142167 508
221 3300025913 Ga0207695_10018989 Ga0207695_100189893 508
222 3300025913 Ga0207695_10021471 Ga0207695_100214715 508
223 3300025913 Ga0207695_10112816 Ga0207695_101128162 508
224 3300025914 Ga0207671_10000407 Ga0207671_1000040727 508
225 3300025914 Ga0207671_10003029 Ga0207671_100030299 508
226 3300025914 Ga0207671_10005221 Ga0207671_100052219 508
227 3300025914 Ga0207671_10006948 Ga0207671_100069487 508
228 3300025919 Ga0207657_10016593 Ga0207657_100165933 508
229 3300025919 Ga0207657_10051242 Ga0207657_100512422 508
230 3300025929 Ga0207664_10069251 Ga0207664_100692512 508
231 3300025932 Ga0207690_10000293 Ga0207690_1000029315 508
232 3300025933 Ga0207706_10000669 Ga0207706_1000066910 508
233 3300025934 Ga0207686_10007074 Ga0207686_100070742 508
234 3300025935 Ga0207709_10012838 Ga0207709_100128384 508
235 3300025938 Ga0207704_10000169 Ga0207704_1000016922 508
236 3300025944 Ga0207661_10102425 Ga0207661_101024252 508
237 3300025949 Ga0207667_10000015 Ga0207667_10000015208 508
238 3300025949 Ga0207667_10002558 Ga0207667_100025581 508
239 3300025949 Ga0207667_10005697 Ga0207667_100056976 508
240 3300025949 Ga0207667_10069562 Ga0207667_100695622 508
241 3300025949 Ga0207667_10108810 Ga0207667_101088103 508
242 3300026041 Ga0207639_10033656 Ga0207639_100336562 508
243 3300026078 Ga0207702_10001259 Ga0207702_100012595 508
244 3300026078 Ga0207702_10155054 Ga0207702_101550542 508
245 3300026089 Ga0207648_10000220 Ga0207648_100002202 508
246 3300026121 Ga0207683_10003089 Ga0207683_100030893 508
247 3300028379 Ga0268266_10000032 Ga0268266_10000032287 508
248 3300028786 Ga0307517_10000429 Ga0307517_1000042942 508
249 3300028794 Ga0307515_10000226 Ga0307515_1000022654 508
250 3300028794 Ga0307515_10000507 Ga0307515_1000050743 508
251 3300028800 Ga0265338_10035591 Ga0265338_100355911 508
252 3300028800 Ga0265338_10173311 Ga0265338_101733111 508
253 3300031548 Ga0307408_100002002 Ga0307408_1000020027 508
254 3300031548 Ga0307408_100002436 Ga0307408_1000024366 508
255 3300031548 Ga0307408_100004578 Ga0307408_1000045786 508
256 3300031727 Ga0316576_10009716 Ga0316576_100097163 508
257 3300031731 Ga0307405_10000015 Ga0307405_10000015125 508
258 3300031731 Ga0307405_10011401 Ga0307405_100114013 508
259 3300031903 Ga0307407_10000027 Ga0307407_100000279 508
260 3300031911 Ga0307412_10000030 Ga0307412_10000030134 508
261 3300031911 Ga0307412_10003168 Ga0307412_100031685 508
262 3300032002 Ga0307416_100000002 Ga0307416_10000000235 508
263 3300032004 Ga0307414_10000038 Ga0307414_1000003829 508
264 3300032004 Ga0307414_10001228 Ga0307414_100012285 508
265 3300032004 Ga0307414_10007266 Ga0307414_100072663 508
266 3300032004 Ga0307414_10028893 Ga0307414_100288931 508
267 3300032004 Ga0307414_10036885 Ga0307414_100368853 508
268 3300032004 Ga0307414_10069492 Ga0307414_100694922 508
269 3300032004 Ga0307414_10091575 Ga0307414_100915752 508
270 3300033179 Ga0307507_10000023 Ga0307507_1000002349 508
271 3300033180 Ga0307510_10001152 Ga0307510_100011528 508
272 3300036712 Ga0316584_0004789 Ga0316584_0004789_3944_5473 508
273 3300037312 Ga0395899_0000034 Ga0395899_0000034_117749_119278 508
274 3300037312 Ga0395899_0000055 Ga0395899_0000055_178954_180483 508
275 3300037312 Ga0395899_0020990 Ga0395899_0020990_673_2202 508
276 3300037418 Ga0395900_0000194 Ga0395900_0000194_23290_24819 508
277 3300037418 Ga0395900_0008131 Ga0395900_0008131_4534_6063 508
278 3300037418 Ga0395900_0036640 Ga0395900_0036640_2221_3750 508
279 3300037471 Ga0395905_0000003 Ga0395905_0000003_686380_687909 508
280 3300037471 Ga0395905_0000340 Ga0395905_0000340_32433_33962 508
281 3300037471 Ga0395905_0022429 Ga0395905_0022429_1255_2784 508
282 3300039062 Ga0400483_174860 Ga0400483_174860_20016_21587 508
283 3300042876 Ga0451577_0003251 Ga0451577_0003251_10199_11728 508
284 3300044684 Ga0466966_0010875 Ga0466966_0010875_2896_4425 508
285 3300044712 Ga0453684_0001838 Ga0453684_0001838_43625_45154 508
286 3300044712 Ga0453684_0003191 Ga0453684_0003191_4431_5960 508
287 3300044712 Ga0453684_0004741 Ga0453684_0004741_18185_19714 508
288 3300044712 Ga0453684_0015662 Ga0453684_0015662_1256_2785 508
289 3300044712 Ga0453684_0055232 Ga0453684_0055232_787_2316 508
290 3300044712 Ga0453684_0095703 Ga0453684_0095703_660_2189 508
291 3300044712 Ga0453684_0108580 Ga0453684_0108580_1632_3161 508
292 3300045049 Ga0466959_0017617 Ga0466959_0017617_755_2284 508
293 3300045051 Ga0451576_0000020 Ga0451576_0000020_104322_105923 508
294 3300045051 Ga0451576_0020091 Ga0451576_0020091_4153_5682 508
295 3300046453 Ga0495627_004478 Ga0495627_004478_2479_4008 508
296 3300046471 Ga0495650_0000198 Ga0495650_0000198_45105_46634 508
297 3300046492 Ga0495585_0000391 Ga0495585_0000391_10324_11853 508
298 3300046507 Ga0495606_0000003 Ga0495606_0000003_24080_25609 508
299 3300046507 Ga0495606_0007202 Ga0495606_0007202_4656_6185 508
300 3300046507 Ga0495606_0046189 Ga0495606_0046189_1068_2597 508
301 3300046512 Ga0495610_0000197 Ga0495610_0000197_65882_67411 508
302 3300046512 Ga0495610_0002942 Ga0495610_0002942_3714_5243 508
303 3300046513 Ga0495616_0006818 Ga0495616_0006818_1976_3505 508
304 3300046518 Ga0495631_0009584 Ga0495631_0009584_2516_4045 508
305 3300046520 Ga0495637_0033578 Ga0495637_0033578_89_1618 508
306 3300046523 Ga0495644_0005095 Ga0495644_0005095_2812_4341 508
307 3300046535 Ga0495586_0030350 Ga0495586_0030350_674_2203 508
308 3300046538 Ga0495609_0009453 Ga0495609_0009453_268_1797 508
309 3300046558 Ga0495633_0000267 Ga0495633_0000267_33894_35558 508
310 3300046558 Ga0495633_0003424 Ga0495633_0003424_2266_3795 508
311 3300046616 Ga0495668_0000010 Ga0495668_0000010_470218_471747 508
312 3300046660 Ga0495625_0000524 Ga0495625_0000524_12924_14453 508
313 3300046660 Ga0495625_0010537 Ga0495625_0010537_5405_6934 508
314 3300046660 Ga0495625_0013186 Ga0495625_0013186_1954_3483 508
315 3300046660 Ga0495625_0017936 Ga0495625_0017936_1380_2909 508
316 3300046665 Ga0495661_0000778 Ga0495661_0000778_12919_14448 508
317 3300046665 Ga0495661_0006247 Ga0495661_0006247_326_1855 508
318 3300046694 Ga0495649_0000168 Ga0495649_0000168_13451_14980 508
319 3300047323 Ga0495683_0038225 Ga0495683_0038225_218_1747 508
320 3300047443 Ga0495687_001711 Ga0495687_001711_3764_5293 508
321 3300047443 Ga0495687_032152 Ga0495687_032152_370_1899 508
322 3300047472 Ga0495686_0000845 Ga0495686_0000845_14915_16444 508
323 3300047472 Ga0495686_0002919 Ga0495686_0002919_582_2111 508
324 3300047472 Ga0495686_0079601 Ga0495686_0079601_86_1615 508
325 3300048089 Ga0495614_0043223 Ga0495614_0043223_208_1737 508
326 3300048918 Ga0496115_0009216 Ga0496115_0009216_3809_5338 508
327 3300048925 Ga0496122_0000869 Ga0496122_0000869_37191_38720 508
328 3300048927 Ga0496124_0016764 Ga0496124_0016764_5004_6548 508
329 3300048928 Ga0496125_0001552 Ga0496125_0001552_19616_21145 508
330 3300048929 Ga0496126_0010572 Ga0496126_0010572_7968_9497 508
331 3300049568 Ga0501031_0000669 Ga0501031_0000669_16618_18180 508
332 3300049569 Ga0501032_0003006 Ga0501032_0003006_5584_7119 508
333 3300049570 Ga0501033_0000005 Ga0501033_0000005_208785_210347 508
334 3300049571 Ga0501034_0000052 Ga0501034_0000052_180098_181660 508
335 3300049573 Ga0501037_0004892 Ga0501037_0004892_2229_3791 508
336 3300049574 Ga0501038_0002931 Ga0501038_0002931_11898_13460 508
337 3300049575 Ga0501039_0008402 Ga0501039_0008402_1738_3300 508
338 3300049579 Ga0501043_0002243 Ga0501043_0002243_5188_6750 508
339 3300049663 Ga0501223_000806 Ga0501223_000806_157_1686 508
340 3300049663 Ga0501223_001917 Ga0501223_001917_2095_3627 508
341 3300049758 Ga0501241_001051 Ga0501241_001051_1408_2937 508
342 3300049822 Ga0501035_0004866 Ga0501035_0004866_8761_10323 508
343 3300049823 Ga0501044_0001723 Ga0501044_0001723_21178_22740 508
344 3300049824 Ga0501045_0011792 Ga0501045_0011792_1853_3415 508
345 3300050493 nmdc:mga0k408_156_c2 nmdc:mga0k408_156_c2_7867_9585 508
346 3300053080 Ga0500635_0001979 Ga0500635_0001979_2907_4436 508
347 3300053088 Ga0500644_0006977 Ga0500644_0006977_966_2495 508
348 3300053093 Ga0500651_0000455 Ga0500651_0000455_17561_19090 508
349 3300053096 Ga0500641_0000119 Ga0500641_0000119_16908_18437 508
350 3300053108 Ga0500562_000055 Ga0500562_000055_26750_28279 508
351 3300053125 Ga0500618_000489 Ga0500618_000489_426_1955 508
352 3300053151 Ga0500604_0005011 Ga0500604_0005011_834_2363 508
353 3300053156 Ga0500622_0000041 Ga0500622_0000041_67420_68949 508
354 3300053156 Ga0500622_0000045 Ga0500622_0000045_80104_81633 508
355 3300053156 Ga0500622_0002792 Ga0500622_0002792_118_1647 508
356 3300053156 Ga0500622_0016378 Ga0500622_0016378_166_1695 508
357 3300053157 Ga0500624_000278 Ga0500624_000278_8428_9957 508
358 iso_pu_bacteria 2599185184 2599479059 508
359 iso_pu_bacteria 2932082852 2932086416 508
360 3300001979 JGI24740J21852_10000503 JGI24740J21852_1000050316 511
361 3300002738 JGI25154J39366_1000004 JGI25154J39366_1000004104 511
362 3300003354 JGI25160J50197_1004415 JGI25160J50197_10044154 511
363 3300003354 JGI25160J50197_1004554 JGI25160J50197_10045542 511
364 3300003794 Ga0055531_10000171 Ga0055531_100001712 511
365 3300005289 Ga0065704_10083738 Ga0065704_100837382 511
366 3300015265 Ga0182005_1000040 Ga0182005_100004086 511
367 3300025208 Ga0209436_101268 Ga0209436_1012683 511
368 3300025242 Ga0209258_100476 Ga0209258_10047613 511
369 3300025246 Ga0209646_1000025 Ga0209646_1000025233 511
370 3300025250 Ga0209026_1000189 Ga0209026_100018920 511
371 3300025254 Ga0209148_1000129 Ga0209148_100012928 511
372 3300025284 Ga0209130_1001332 Ga0209130_100133212 511
373 3300025302 Ga0207426_1000057 Ga0207426_1000057194 511
374 3300025302 Ga0207426_1000604 Ga0207426_100060422 511
375 3300025304 Ga0209257_1000004 Ga0209257_10000041246 511
376 3300045049 Ga0466959_0034565 Ga0466959_0034565_2001_3623 511
377 3300046453 Ga0495627_018500 Ga0495627_018500_366_1904 511
378 3300046558 Ga0495633_0000017 Ga0495633_0000017_111236_112774 511
379 3300048924 Ga0496121_0000010 Ga0496121_0000010_366740_368278 511
380 3300048929 Ga0496126_0013000 Ga0496126_0013000_5955_7493 511
381 3300049571 Ga0501034_0029160 Ga0501034_0029160_1240_2889 511
382 3300049581 Ga0501047_0056643 Ga0501047_0056643_2147_3685 511
383 3300053088 Ga0500644_0000491 Ga0500644_0000491_13467_15005 511
384 3300053109 Ga0500569_000961 Ga0500569_000961_3222_4760 511
385 3300053134 Ga0500658_0003022 Ga0500658_0003022_1510_3048 511
386 3300053142 Ga0500577_0002420 Ga0500577_0002420_2212_3750 511
387 3300053156 Ga0500622_0000059 Ga0500622_0000059_53108_54646 511
388 3300053177 Ga0500636_0035545 Ga0500636_0035545_1330_2868 511
389 3300055283 Ga0500661_000611 Ga0500661_000611_154_1692 511
390 2162886007 SwRhRL2b_contig_1761633 SwRhRL2b_0391.00006460 512
391 3300005289 Ga0065704_10000195 Ga0065704_10000195119 512
392 3300005548 Ga0070665_100002844 Ga0070665_1000028442 512
393 3300005834 Ga0068851_10000739 Ga0068851_100007398 512
394 3300009093 Ga0105240_10113800 Ga0105240_101138003 512
395 3300009545 Ga0105237_10016843 Ga0105237_100168435 512
396 3300013307 Ga0157372_10041404 Ga0157372_100414043 512
397 3300014326 Ga0157380_10000021 Ga0157380_1000002189 512
398 3300025321 Ga0207656_10000115 Ga0207656_1000011535 512
399 3300025913 Ga0207695_10006220 Ga0207695_1000622016 512
400 3300025914 Ga0207671_10000063 Ga0207671_10000063131 512
401 3300028379 Ga0268266_10015425 Ga0268266_100154252 512
402 3300031251 Ga0265327_10000338 Ga0265327_1000033824 512
403 3300031251 Ga0265327_10043374 Ga0265327_100433743 512

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00958

GMP_synt_C

GMP synthase C terminal domain

463

554

0.99

PF00117

GATase

Glutamine amidotransferase class-I

52

233

0.95

PF03054

tRNA_Me_trans

tRNA methyl transferase HUP domain

260

325

0.86

PF02540

NAD_synthase

NAD synthase

244

342

0.83

PF07722

Peptidase_C26

Peptidase C26

112

215

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3a4i-assembly1.cif.gz_B crystal structure of gmp synthetase ph1347 from pyrococcus horikoshii ot3 0.9481 199 512
2dpl-assembly1.cif.gz_B crystal structure of the gmp synthase from pyrococcus horikoshii ot3 0.943 203 512
2dpl-assembly1.cif.gz_A crystal structure of the gmp synthase from pyrococcus horikoshii ot3 0.9409 199 512
3a4i-assembly1.cif.gz_B crystal structure of gmp synthetase ph1347 from pyrococcus horikoshii ot3 0.9385 199 512
2dpl-assembly1.cif.gz_B crystal structure of the gmp synthase from pyrococcus horikoshii ot3 0.9365 203 512
ID Description Score Start End Superfamily
2ywcA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9453 196 387 3.40.50.620
2dplA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9412 199 387 3.40.50.620
2ywcA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9401 196 387 3.40.50.620
af_Q2G0Y6_200_393_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9384 198 391 3.40.50.620
af_Q2G0Y6_200_393_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9291 198 391 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A3C0EJG3-F1-model_v4 GMP synthase (glutamine-hydrolyzing) (EC 6.3.5.2) 0.9752 363 504 GO:0003921
GO:0005524
GO:0005829
AF-A0A7V2X9Y9-F1-model_v4 ExsB family transcriptional regulator 0.9721 200 286 GO:0003921
GO:0005524
GO:0005829
AF-X1ISV3-F1-model_v4 GMPS ATP-PPase domain-containing protein 0.9709 183 324 GO:0003921
GO:0005524
GO:0005829
AF-A0A3C0EJG3-F1-model_v4 GMP synthase (glutamine-hydrolyzing) (EC 6.3.5.2) 0.9685 363 504 GO:0003921
GO:0005524
GO:0005829
AF-A0A641V1T5-F1-model_v4 deleted 0.9658 1 155

Feature Viewer

pLDDT pTM Quality
87.21 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map