F435381

General Info

Members Datasets Scaffolds Average Seq Length
403 205 373 217

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10087928|Ga0105237_100879281
Length 255
Sequence MFYPNGIKQPSFNAFRQIAVHLNRSEINSRKPYFCALIILVGKDKIRRFAEIATFSNVLQLDAGKPFKGQWAGAFFKNNNPVVLELACGKGEYTVNLAVMFPDKNFIGIDYKGNRIWRGAKTALEDGVANVAFLRIQIETLIEYFGPGEVDEIWITFPDPQPQLSREKKRLTSSRFLNMYKVILKPGGFVNLKTDNDDLHAYTADKIAETGLTLHAKTEDVYKSEYADDVLNIKTYYEKKYLKDNKNINYLKFSF

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
5 2738541302 Pedobacter sp. CF074 Isolate Unclassified
6 2739367651 Pedobacter sp. OK291 Isolate Unclassified
7 2739367663 Pedobacter sp. YR510 Isolate Unclassified
8 2818991437 Pedobacter terrae 518 Isolate Unclassified
9 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
10 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
11 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
12 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
13 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
14 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
15 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
16 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
17 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
18 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
19 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
20 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
21 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
22 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
23 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
24 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
25 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
26 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
27 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
28 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
29 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
30 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
31 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
32 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
33 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
34 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
35 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
36 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
37 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
38 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
39 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
40 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
41 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
42 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
43 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
44 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
45 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
46 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
47 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
48 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
49 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
50 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
51 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
52 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
53 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
54 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
55 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
56 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
57 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
58 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
99 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
100 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
101 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
104 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
105 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
106 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
107 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
139 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
140 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
141 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
142 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
143 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
154 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
161 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
162 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
165 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
166 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
167 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
168 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
169 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
170 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
171 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
172 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
173 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
174 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
175 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
176 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
179 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
180 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
181 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
182 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
183 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
184 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
185 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
186 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
187 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
188 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
189 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
190 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
191 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
192 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
193 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
194 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
195 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
198 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
199 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
200 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
201 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
202 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
203 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
204 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
205 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.56
Metatranscriptomes 0
Isolates 7.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.2
Nodule 0
Rhizoplane 0.25
Rhizosphere 84.86
Stem 0
Stem Tuber 0
Unclassified 8.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_78349 2162886007 Bacteria 911
2 JGI24736J21556_1003296 3300001904 Bacteria 2809
3 JGI24740J21852_10006644 3300001979 Bacteria 4767
4 JGI24737J22298_10000056 3300001990 Bacteria 33642
5 JGI24737J22298_10025622 3300001990 Bacteria 1864
6 JGI24735J21928_10000011 3300002067 Bacteria 217841
7 JGI24735J21928_10035654 3300002067 Bacteria 1461
8 JGI24744J21845_10002991 3300002077 Bacteria 3465
9 JGI25162J39368_1000097 3300002737 Bacteria 96520
10 JGI25162J39368_1000818 3300002737 Bacteria 20543
11 JGI25157J39369_1006902 3300002741 Bacteria 1685
12 JGI25164J39214_1003544 3300002772 Bacteria 1957
13 JGI25165J46597_1001052 3300003214 Bacteria 17883
14 rootH1_10004367 3300003316 Bacteria 10924
15 rootH2_10003269 3300003320 Bacteria 51191
16 rootH2_10050402 3300003320 Bacteria 4731
17 rootL2_10139661 3300003322 Bacteria 5040
18 rootH1_10021521 3300003323 Bacteria 7424
19 rootH1_10039800 3300003323 Bacteria 1453
20 rootH1_10048874 3300003323 Bacteria 1163
21 rootH1_10086518 3300003323 Bacteria 5468
22 Ga0055536_1000002 3300003781 Bacteria 605605
23 Ga0055530_10006159 3300003791 Bacteria 5443
24 Ga0065714_10085808 3300005288 Bacteria 2131
25 Ga0065704_10002103 3300005289 Bacteria 8829
26 Ga0065704_10174714 3300005289 Bacteria 1271
27 Ga0070658_10000059 3300005327 Bacteria 112781
28 Ga0070658_10167705 3300005327 Bacteria 1844
29 Ga0070658_10173894 3300005327 Bacteria 1810
30 Ga0070658_10739388 3300005327 Unclassified 854
31 Ga0070676_10000106 3300005328 Bacteria 30173
32 Ga0070683_100008610 3300005329 Bacteria 8671
33 Ga0070680_100003849 3300005336 Bacteria 11216
34 Ga0068868_100061803 3300005338 Bacteria 2967
35 Ga0070660_100027667 3300005339 Bacteria 4234
36 Ga0070691_10027615 3300005341 Bacteria 2649
37 Ga0070673_100001457 3300005364 Bacteria 13846
38 Ga0070659_100000440 3300005366 Bacteria 31084
39 Ga0070659_100017160 3300005366 Bacteria 5442
40 Ga0070659_100034777 3300005366 Bacteria 3921
41 Ga0070663_100006389 3300005455 Bacteria 7084
42 Ga0070678_100001020 3300005456 Bacteria 14590
43 Ga0070662_100000057 3300005457 Bacteria 60160
44 Ga0070681_10006021 3300005458 Bacteria 11752
45 Ga0068867_100024079 3300005459 Bacteria 4363
46 Ga0070685_10117210 3300005466 Bacteria 1649
47 Ga0070679_100011061 3300005530 Bacteria 8584
48 Ga0070679_100045389 3300005530 Bacteria 4379
49 Ga0070679_100191160 3300005530 Bacteria 2016
50 Ga0070684_100346846 3300005535 Bacteria 1365
51 Ga0068853_100011618 3300005539 Bacteria 7157
52 Ga0068853_100126442 3300005539 Bacteria 2284
53 Ga0068853_100375129 3300005539 Bacteria 1327
54 Ga0070665_100000017 3300005548 Bacteria 448013
55 Ga0068855_100000060 3300005563 Bacteria 133838
56 Ga0068855_100000071 3300005563 Bacteria 122638
57 Ga0068855_100042312 3300005563 Bacteria 5398
58 Ga0068855_100069349 3300005563 Bacteria 4103
59 Ga0068855_100094942 3300005563 Bacteria 3438
60 Ga0068855_100139139 3300005563 Bacteria 2769
61 Ga0068857_100349481 3300005577 Bacteria 1369
62 Ga0068856_100002123 3300005614 Bacteria 20569
63 Ga0068856_100052902 3300005614 Bacteria 4005
64 Ga0068856_100094719 3300005614 Bacteria 2973
65 Ga0068856_100402592 3300005614 Bacteria 1388
66 Ga0068856_100701742 3300005614 Bacteria 1032
67 Ga0068852_100002456 3300005616 Bacteria 12766
68 Ga0068852_100011061 3300005616 Bacteria 6775
69 Ga0068852_100311938 3300005616 Bacteria 1525
70 Ga0068852_100457998 3300005616 Bacteria 1264
71 Ga0068866_10083888 3300005718 Bacteria 1718
72 Ga0068858_100075544 3300005842 Bacteria 3130
73 Ga0075366_10000507 3300006195 Bacteria 17971
74 Ga0075366_10023126 3300006195 Bacteria 3620
75 Ga0097621_100000994 3300006237 Bacteria 19912
76 Ga0068871_100003444 3300006358 Bacteria 10876
77 Ga0068865_100000810 3300006881 Bacteria 17586
78 Ga0105244_10012227 3300009036 Bacteria 5087
79 Ga0105240_10000083 3300009093 Bacteria 192934
80 Ga0105240_10019222 3300009093 Bacteria 9132
81 Ga0105240_10036572 3300009093 Bacteria 6313
82 Ga0105240_10155822 3300009093 Bacteria 2717
83 Ga0105240_10184753 3300009093 Unclassified 2456
84 Ga0105240_10199474 3300009093 Bacteria 2346
85 Ga0105240_10236810 3300009093 Bacteria 2118
86 Ga0105240_10709007 3300009093 Bacteria 1098
87 Ga0105240_11575953 3300009093 Bacteria 687
88 Ga0105243_10000003 3300009148 Bacteria 712931
89 Ga0105241_10004634 3300009174 Bacteria 10168
90 Ga0105241_10009121 3300009174 Bacteria 7302
91 Ga0105241_10033522 3300009174 Bacteria 3855
92 Ga0105241_10113641 3300009174 Bacteria 2171
93 Ga0105241_10293422 3300009174 Bacteria 1393
94 Ga0105242_10017354 3300009176 Bacteria 5607
95 Ga0105237_10003635 3300009545 Bacteria 18193
96 Ga0105237_10003965 3300009545 Bacteria 17322
97 Ga0105237_10004489 3300009545 Bacteria 16126
98 Ga0105237_10004990 3300009545 Bacteria 15125
99 Ga0105237_10087928 3300009545 Bacteria 3097
100 Ga0105237_10127040 3300009545 Bacteria 2544
101 Ga0105237_10150130 3300009545 Bacteria 2326
102 Ga0105237_10280869 3300009545 Bacteria 1667
103 Ga0105237_10535724 3300009545 Bacteria 1178
104 Ga0105238_10004801 3300009551 Bacteria 13376
105 Ga0105238_10104848 3300009551 Bacteria 2808
106 Ga0105238_10468827 3300009551 Bacteria 1258
107 Ga0105249_10068007 3300009553 Bacteria 3284
108 Ga0105239_10000026 3300010375 Bacteria 248302
109 Ga0105239_10000522 3300010375 Bacteria 55530
110 Ga0105239_10000708 3300010375 Bacteria 47248
111 Ga0105239_10000821 3300010375 Bacteria 44186
112 Ga0105239_10006547 3300010375 Bacteria 13495
113 Ga0105239_10063439 3300010375 Bacteria 4057
114 Ga0105239_10102342 3300010375 Bacteria 3170
115 Ga0105239_10157720 3300010375 Bacteria 2535
116 Ga0105246_10036080 3300011119 Bacteria 3309
117 Ga0157373_10000140 3300013100 Bacteria 57694
118 Ga0157373_10011122 3300013100 Bacteria 6623
119 Ga0157373_10033655 3300013100 Bacteria 3685
120 Ga0157373_10294760 3300013100 Bacteria 1151
121 Ga0157371_10000025 3300013102 Bacteria 279746
122 Ga0157371_10006008 3300013102 Bacteria 10115
123 Ga0157371_10012944 3300013102 Bacteria 6352
124 Ga0157370_10001039 3300013104 Bacteria 34915
125 Ga0157370_10004060 3300013104 Bacteria 16973
126 Ga0157370_10014147 3300013104 Bacteria 8181
127 Ga0157370_10082639 3300013104 Bacteria 3021
128 Ga0157370_10149518 3300013104 Bacteria 2174
129 Ga0157370_10169212 3300013104 Unclassified 2032
130 Ga0157370_10258376 3300013104 Bacteria 1610
131 Ga0157370_10319793 3300013104 Bacteria 1431
132 Ga0157369_10000038 3300013105 Bacteria 189078
133 Ga0157369_10000952 3300013105 Bacteria 36747
134 Ga0157369_10027003 3300013105 Bacteria 6366
135 Ga0157369_10087331 3300013105 Bacteria 3330
136 Ga0157369_10097101 3300013105 Bacteria 3143
137 Ga0157369_10188234 3300013105 Bacteria 2169
138 Ga0157374_10002202 3300013296 Bacteria 16438
139 Ga0157374_10004753 3300013296 Bacteria 11390
140 Ga0157374_10119190 3300013296 Bacteria 2545
141 Ga0157374_10120343 3300013296 Bacteria 2533
142 Ga0157374_10784610 3300013296 Bacteria 968
143 Ga0157374_10899302 3300013296 Bacteria 903
144 Ga0157378_10008753 3300013297 Bacteria 8812
145 Ga0157378_10086490 3300013297 Bacteria 2842
146 Ga0163162_10000026 3300013306 Bacteria 178701
147 Ga0163162_10000050 3300013306 Bacteria 120151
148 Ga0163162_10016834 3300013306 Bacteria 7147
149 Ga0163162_10019343 3300013306 Bacteria 6678
150 Ga0163162_10498881 3300013306 Bacteria 1348
151 Ga0163162_10500907 3300013306 Bacteria 1345
152 Ga0157372_10000077 3300013307 Bacteria 102192
153 Ga0157372_10000870 3300013307 Bacteria 32811
154 Ga0157372_10002434 3300013307 Bacteria 20158
155 Ga0157372_10028253 3300013307 Bacteria 6121
156 Ga0157372_10303177 3300013307 Bacteria 1858
157 Ga0157372_10436187 3300013307 Bacteria 1527
158 Ga0157375_10021287 3300013308 Bacteria 5942
159 Ga0157375_10135001 3300013308 Bacteria 2590
160 Ga0157375_10763576 3300013308 Bacteria 1117
161 Ga0182008_10000052 3300014497 Bacteria 103193
162 Ga0157377_10019190 3300014745 Bacteria 3570
163 Ga0157377_10258888 3300014745 Bacteria 1131
164 Ga0182006_1000127 3300015261 Bacteria 81679
165 Ga0182006_1000645 3300015261 Bacteria 24732
166 Ga0182007_10000024 3300015262 Bacteria 181761
167 Ga0183373_1002 3300015682 Bacteria 990153
168 Ga0183368_1066 3300015687 Bacteria 795
169 Ga0163161_10001289 3300017792 Bacteria 18683
170 Ga0163161_10002479 3300017792 Bacteria 13157
171 Ga0163161_10132150 3300017792 Bacteria 1884
172 Ga0207427_100060 3300025231 Bacteria 186274
173 Ga0209437_100021 3300025233 Bacteria 646400
174 Ga0209437_100030 3300025233 Bacteria 532466
175 Ga0209026_1000239 3300025250 Bacteria 71740
176 Ga0209026_1000787 3300025250 Bacteria 17422
177 Ga0209026_1005416 3300025250 Bacteria 3442
178 Ga0209233_1000035 3300025261 Bacteria 568478
179 Ga0209233_1001683 3300025261 Bacteria 8587
180 Ga0209676_1000022 3300025292 Bacteria 605659
181 Ga0209050_1000020 3300025298 Bacteria 605671
182 Ga0207655_1036503 3300025728 Bacteria 2177
183 Ga0207647_10000012 3300025904 Bacteria 152879
184 Ga0207647_10000877 3300025904 Bacteria 23342
185 Ga0207647_10033765 3300025904 Bacteria 3272
186 Ga0207645_10000347 3300025907 Bacteria 38694
187 Ga0207705_10000216 3300025909 Bacteria 57377
188 Ga0207705_10374279 3300025909 Bacteria 1100
189 Ga0207654_10002932 3300025911 Bacteria 8651
190 Ga0207654_10012860 3300025911 Bacteria 4295
191 Ga0207654_10126294 3300025911 Bacteria 1613
192 Ga0207654_10158487 3300025911 Bacteria 1460
193 Ga0207707_10008874 3300025912 Bacteria 8731
194 Ga0207695_10000127 3300025913 Bacteria 227338
195 Ga0207695_10007509 3300025913 Bacteria 13834
196 Ga0207695_10009583 3300025913 Bacteria 11962
197 Ga0207695_10018279 3300025913 Bacteria 8111
198 Ga0207695_10072337 3300025913 Bacteria 3518
199 Ga0207695_10237877 3300025913 Bacteria 1723
200 Ga0207695_10457902 3300025913 Bacteria 1159
201 Ga0207695_10613747 3300025913 Bacteria 969
202 Ga0207695_10731306 3300025913 Bacteria 870
203 Ga0207671_10001459 3300025914 Bacteria 27307
204 Ga0207671_10003385 3300025914 Bacteria 15963
205 Ga0207671_10004562 3300025914 Bacteria 13160
206 Ga0207671_10005084 3300025914 Bacteria 12282
207 Ga0207671_10012938 3300025914 Bacteria 6679
208 Ga0207671_10091299 3300025914 Bacteria 2295
209 Ga0207671_10284264 3300025914 Bacteria 1305
210 Ga0207671_10375550 3300025914 Bacteria 1129
211 Ga0207657_10047967 3300025919 Bacteria 3730
212 Ga0207652_10390662 3300025921 Bacteria 1256
213 Ga0207694_10017408 3300025924 Bacteria 5432
214 Ga0207694_10232444 3300025924 Bacteria 1506
215 Ga0207644_10032676 3300025931 Bacteria 3632
216 Ga0207690_10000235 3300025932 Bacteria 40691
217 Ga0207690_10015849 3300025932 Bacteria 4575
218 Ga0207690_10065986 3300025932 Bacteria 2477
219 Ga0207706_10000092 3300025933 Bacteria 93227
220 Ga0207686_10213114 3300025934 Bacteria 1390
221 Ga0207709_10000008 3300025935 Bacteria 713099
222 Ga0207709_10038814 3300025935 Bacteria 2839
223 Ga0207704_10000043 3300025938 Bacteria 88714
224 Ga0207661_10007736 3300025944 Bacteria 7651
225 Ga0207667_10000033 3300025949 Bacteria 314353
226 Ga0207667_10000964 3300025949 Bacteria 36656
227 Ga0207667_10065559 3300025949 Bacteria 3787
228 Ga0207667_10087677 3300025949 Bacteria 3219
229 Ga0207667_10123298 3300025949 Bacteria 2670
230 Ga0207667_10151158 3300025949 Bacteria 2390
231 Ga0207667_10377064 3300025949 Bacteria 1445
232 Ga0207651_10061900 3300025960 Bacteria 2605
233 Ga0207677_10011989 3300026023 Bacteria 4966
234 Ga0207703_10023399 3300026035 Bacteria 4852
235 Ga0207639_10011485 3300026041 Bacteria 6153
236 Ga0207639_10062697 3300026041 Bacteria 2876
237 Ga0207639_10515519 3300026041 Bacteria 1094
238 Ga0207639_10875294 3300026041 Bacteria 839
239 Ga0207678_10249139 3300026067 Bacteria 1521
240 Ga0207702_10000042 3300026078 Bacteria 150673
241 Ga0207702_10017227 3300026078 Bacteria 5978
242 Ga0207702_10018280 3300026078 Bacteria 5800
243 Ga0207702_10717425 3300026078 Bacteria 986
244 Ga0207648_10000423 3300026089 Bacteria 46491
245 Ga0207683_10002796 3300026121 Bacteria 15239
246 Ga0207698_10011102 3300026142 Bacteria 5823
247 Ga0207698_10032617 3300026142 Bacteria 3776
248 Ga0207698_10071108 3300026142 Bacteria 2760
249 Ga0207698_10491969 3300026142 Bacteria 1192
250 Ga0207698_10695955 3300026142 Bacteria 1011
251 Ga0268266_10000037 3300028379 Bacteria 342368
252 Ga0307517_10009500 3300028786 Bacteria 13775
253 Ga0307515_10000427 3300028794 Bacteria 101325
254 Ga0307515_10001574 3300028794 Bacteria 50970
255 Ga0307515_10112594 3300028794 Bacteria 3164
256 Ga0316176_1029716 3300030732 Bacteria 6882
257 Ga0316183_1126062 3300030742 Bacteria 44101
258 Ga0316181_1121975 3300030744 Bacteria 30956
259 Ga0265327_10056161 3300031251 Bacteria 2030
260 Ga0307408_100000332 3300031548 Bacteria 45065
261 Ga0307408_100000341 3300031548 Bacteria 43952
262 Ga0307408_100006215 3300031548 Bacteria 7932
263 Ga0307405_10000011 3300031731 Bacteria 241071
264 Ga0307405_10030133 3300031731 Bacteria 3179
265 Ga0307407_10000018 3300031903 Bacteria 135979
266 Ga0307412_10001562 3300031911 Bacteria 12620
267 Ga0307412_10015169 3300031911 Bacteria 4559
268 Ga0307412_10163167 3300031911 Bacteria 1658
269 Ga0307409_100023896 3300031995 Bacteria 4247
270 Ga0307409_100147985 3300031995 Bacteria 2034
271 Ga0307416_100001355 3300032002 Bacteria 13215
272 Ga0307416_100154009 3300032002 Bacteria 2113
273 Ga0307414_10000823 3300032004 Bacteria 15850
274 Ga0307414_10029605 3300032004 Bacteria 3565
275 Ga0307414_10066156 3300032004 Bacteria 2582
276 Ga0307414_10212678 3300032004 Bacteria 1582
277 Ga0307414_10665801 3300032004 Unclassified 939
278 Ga0307414_10950700 3300032004 Bacteria 789
279 Ga0307411_10567051 3300032005 Bacteria 971
280 Ga0307415_100471418 3300032126 Bacteria 1091
281 Ga0307507_10000510 3300033179 Bacteria 81853
282 Ga0307510_10000219 3300033180 Bacteria 50940
283 Ga0395899_0000017 3300037312 Bacteria 440179
284 Ga0395899_0000257 3300037312 Bacteria 69779
285 Ga0395899_0001310 3300037312 Bacteria 21436
286 Ga0395900_0000507 3300037418 Bacteria 54887
287 Ga0395900_0001010 3300037418 Bacteria 36362
288 Ga0395900_0002104 3300037418 Bacteria 22298
289 Ga0395898_0057901 3300037466 Unclassified 3774
290 Ga0395898_0069141 3300037466 Bacteria 3417
291 Ga0395905_0000669 3300037471 Bacteria 45547
292 Ga0395905_0004119 3300037471 Bacteria 15230
293 Ga0395901_0004148 3300038443 Bacteria 14621
294 Ga0395901_0032997 3300038443 Bacteria 5342
295 Ga0395901_0159230 3300038443 Bacteria 2371
296 Ga0466969_0015414 3300044656 Bacteria 4007
297 Ga0453684_0003110 3300044712 Bacteria 38225
298 Ga0453684_0204824 3300044712 Bacteria 2297
299 Ga0453684_0546903 3300044712 Bacteria 1276
300 Ga0495638_0233913 3300046460 Bacteria 1021
301 Ga0495651_0245256 3300046462 Bacteria 1226
302 Ga0495650_0000330 3300046471 Bacteria 84849
303 Ga0495650_0013683 3300046471 Bacteria 4276
304 Ga0495650_0048302 3300046471 Bacteria 1775
305 Ga0495650_0118952 3300046471 Bacteria 974
306 Ga0495650_0128855 3300046471 Bacteria 925
307 Ga0495585_0000280 3300046492 Bacteria 51045
308 Ga0495585_0001130 3300046492 Bacteria 21890
309 Ga0495583_0131847 3300046506 Bacteria 1045
310 Ga0495606_0000531 3300046507 Bacteria 61676
311 Ga0495606_0005446 3300046507 Bacteria 12189
312 Ga0495606_0019153 3300046507 Bacteria 5103
313 Ga0495606_0055664 3300046507 Bacteria 2557
314 Ga0495606_0067259 3300046507 Bacteria 2269
315 Ga0495606_0135281 3300046507 Bacteria 1460
316 Ga0495606_0257094 3300046507 Bacteria 966
317 Ga0495610_0000037 3300046512 Bacteria 186354
318 Ga0495610_0000574 3300046512 Bacteria 36619
319 Ga0495610_0010906 3300046512 Bacteria 5607
320 Ga0495616_0003550 3300046513 Bacteria 9966
321 Ga0495616_0003620 3300046513 Bacteria 9873
322 Ga0495628_0144089 3300046516 Bacteria 1817
323 Ga0495637_0115399 3300046520 Bacteria 1037
324 Ga0495648_0016265 3300046524 Bacteria 5366
325 Ga0495648_0067904 3300046524 Bacteria 2083
326 Ga0495654_0104811 3300046530 Bacteria 1297
327 Ga0495609_0003227 3300046538 Bacteria 9456
328 Ga0495609_0044852 3300046538 Bacteria 1982
329 Ga0495622_0142494 3300046557 Bacteria 1088
330 Ga0495633_0000072 3300046558 Bacteria 131197
331 Ga0495633_0011211 3300046558 Bacteria 4849
332 Ga0495633_0014888 3300046558 Bacteria 4046
333 Ga0495668_0000009 3300046616 Bacteria 492623
334 Ga0495668_0127927 3300046616 Bacteria 1391
335 Ga0495625_0000007 3300046660 Bacteria 565749
336 Ga0495625_0000831 3300046660 Bacteria 42424
337 Ga0495625_0001804 3300046660 Bacteria 24594
338 Ga0495625_0085398 3300046660 Bacteria 2190
339 Ga0495661_0002236 3300046665 Bacteria 15020
340 Ga0495661_0013201 3300046665 Bacteria 5555
341 Ga0495661_0085892 3300046665 Bacteria 1802
342 Ga0495671_0062761 3300046692 Bacteria 1831
343 Ga0495649_0000038 3300046694 Bacteria 128764
344 Ga0495589_0012817 3300046794 Bacteria 4334
345 Ga0495600_0304912 3300046809 Bacteria 1004
346 Ga0495660_0001638 3300046810 Bacteria 15034
347 Ga0495660_0124241 3300046810 Bacteria 1302
348 Ga0495687_001024 3300047443 Bacteria 27852
349 Ga0495687_004490 3300047443 Bacteria 9393
350 Ga0495686_0000490 3300047472 Bacteria 58423
351 Ga0495686_0000783 3300047472 Bacteria 41638
352 Ga0495686_0020548 3300047472 Bacteria 4401
353 Ga0495593_0341969 3300047673 Bacteria 748
354 Ga0495614_0035002 3300048089 Bacteria 2158
355 Ga0496116_0002515 3300048919 Bacteria 19202
356 Ga0496117_0001212 3300048920 Bacteria 38690
357 Ga0496122_0002213 3300048925 Bacteria 28370
358 Ga0496123_0013682 3300048926 Bacteria 6788
359 Ga0496124_0530026 3300048927 Bacteria 782
360 Ga0495678_004679 3300049459 Bacteria 7833
361 Ga0495682_0179652 3300049460 Bacteria 752
362 Ga0501033_0285976 3300049570 Bacteria 1163
363 Ga0501223_000715 3300049663 Bacteria 7908
364 nmdc:mga0k408_1624_c2 3300050493 Bacteria 2914
365 nmdc:mga0k408_296_c1 3300050493 Bacteria 27045
366 Ga0500635_0001990 3300053080 Bacteria 4989
367 Ga0500608_031823 3300053122 Bacteria 2505
368 Ga0500608_033783 3300053122 Bacteria 2435
369 Ga0500618_000057 3300053125 Bacteria 98383
370 Ga0500618_006639 3300053125 Bacteria 3375
371 Ga0500564_050809 3300053138 Bacteria 1897
372 Ga0500622_0001643 3300053156 Bacteria 17499
373 Ga0500634_0035279 3300053161 Bacteria 2725

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005466 Ga0070685_10117210 Ga0070685_101172103 204
2 3300005614 Ga0068856_100002123 Ga0068856_10000212311 205
3 3300026078 Ga0207702_10017227 Ga0207702_100172274 205
4 3300046558 Ga0495633_0011211 Ga0495633_0011211_3007_3645 211
5 iso_pu_bacteria 2852623160 2852626210 211
6 iso_pu_bacteria 2884933994 2884935246 211
7 iso_pu_bacteria 2896317667 2896320661 211
8 iso_pu_bacteria 2585427687 2586207193 212
9 iso_pu_bacteria 2738541302 2738852500 212
10 iso_pu_bacteria 2739367651 2739591392 212
11 iso_pu_bacteria 2739367663 2739646114 212
12 iso_pu_bacteria 2818991437 2819549643 212
13 iso_pu_bacteria 2842722452 2842727384 212
14 iso_pu_bacteria 2842909656 2842913780 212
15 iso_pu_bacteria 2849281842 2849285391 212
16 iso_pu_bacteria 2857627736 2857631986 212
17 iso_pu_bacteria 2904445276 2904447243 212
18 iso_pu_bacteria 2919437846 2919439744 212
19 iso_pu_bacteria 2945997725 2945998302 212
20 iso_pu_bacteria 2954016120 2954020760 212
21 iso_pu_bacteria 2977232053 2977235087 212
22 iso_pu_bacteria 2842903701 2842905444 213
23 iso_pu_bacteria 2896344016 2896345893 213
24 3300053122 Ga0500608_031823 Ga0500608_031823_462_1106 214
25 iso_pu_bacteria 2599185184 2599480589 214
26 iso_pu_bacteria 2721755487 2722731011 214
27 iso_pu_bacteria 2890737413 2890738426 214
28 iso_pu_bacteria 2898713307 2898713893 214
29 iso_pu_bacteria 2904780799 2904783454 214
30 iso_pu_bacteria 2919177583 2919181320 214
31 iso_pu_bacteria 2928078545 2928081339 214
32 iso_pu_bacteria 2928147474 2928150488 214
33 iso_pu_bacteria 2932082852 2932085310 214
34 iso_pu_bacteria 3003233435 3003234291 214
35 iso_pu_bacteria 8055588893 8055590089 214
36 3300001904 JGI24736J21556_1003296 JGI24736J21556_10032963 215
37 3300001979 JGI24740J21852_10006644 JGI24740J21852_100066442 215
38 3300001990 JGI24737J22298_10025622 JGI24737J22298_100256222 215
39 3300002077 JGI24744J21845_10002991 JGI24744J21845_100029915 215
40 3300002737 JGI25162J39368_1000818 JGI25162J39368_10008182 215
41 3300002772 JGI25164J39214_1003544 JGI25164J39214_10035442 215
42 3300003214 JGI25165J46597_1001052 JGI25165J46597_10010525 215
43 3300003320 rootH2_10003269 rootH2_1000326919 215
44 3300003323 rootH1_10021521 rootH1_100215211 215
45 3300005288 Ga0065714_10085808 Ga0065714_100858083 215
46 3300005328 Ga0070676_10000106 Ga0070676_1000010610 215
47 3300005336 Ga0070680_100003849 Ga0070680_1000038499 215
48 3300005338 Ga0068868_100061803 Ga0068868_1000618035 215
49 3300005339 Ga0070660_100027667 Ga0070660_1000276676 215
50 3300005341 Ga0070691_10027615 Ga0070691_100276154 215
51 3300005364 Ga0070673_100001457 Ga0070673_10000145711 215
52 3300005366 Ga0070659_100034777 Ga0070659_1000347774 215
53 3300005455 Ga0070663_100006389 Ga0070663_1000063892 215
54 3300005456 Ga0070678_100001020 Ga0070678_1000010209 215
55 3300005457 Ga0070662_100000057 Ga0070662_10000005710 215
56 3300005458 Ga0070681_10006021 Ga0070681_100060216 215
57 3300005459 Ga0068867_100024079 Ga0068867_1000240794 215
58 3300005530 Ga0070679_100011061 Ga0070679_1000110618 215
59 3300005539 Ga0068853_100011618 Ga0068853_1000116189 215
60 3300005539 Ga0068853_100126442 Ga0068853_1001264422 215
61 3300005539 Ga0068853_100375129 Ga0068853_1003751292 215
62 3300005548 Ga0070665_100000017 Ga0070665_100000017144 215
63 3300005563 Ga0068855_100000071 Ga0068855_10000007118 215
64 3300005563 Ga0068855_100139139 Ga0068855_1001391393 215
65 3300005614 Ga0068856_100052902 Ga0068856_1000529024 215
66 3300005614 Ga0068856_100402592 Ga0068856_1004025922 215
67 3300005616 Ga0068852_100002456 Ga0068852_1000024566 215
68 3300005616 Ga0068852_100457998 Ga0068852_1004579982 215
69 3300005718 Ga0068866_10083888 Ga0068866_100838883 215
70 3300006237 Ga0097621_100000994 Ga0097621_10000099416 215
71 3300006358 Ga0068871_100003444 Ga0068871_1000034443 215
72 3300006881 Ga0068865_100000810 Ga0068865_1000008109 215
73 3300009093 Ga0105240_10019222 Ga0105240_1001922212 215
74 3300009093 Ga0105240_10036572 Ga0105240_100365723 215
75 3300009093 Ga0105240_10155822 Ga0105240_101558221 215
76 3300009093 Ga0105240_10199474 Ga0105240_101994743 215
77 3300009093 Ga0105240_10709007 Ga0105240_107090071 215
78 3300009174 Ga0105241_10009121 Ga0105241_100091218 215
79 3300009174 Ga0105241_10113641 Ga0105241_101136411 215
80 3300009174 Ga0105241_10293422 Ga0105241_102934221 215
81 3300009176 Ga0105242_10017354 Ga0105242_100173546 215
82 3300009545 Ga0105237_10003965 Ga0105237_100039651 215
83 3300009545 Ga0105237_10004489 Ga0105237_1000448914 215
84 3300009545 Ga0105237_10087928 Ga0105237_100879281 215
85 3300009551 Ga0105238_10004801 Ga0105238_1000480113 215
86 3300010375 Ga0105239_10000522 Ga0105239_1000052249 215
87 3300010375 Ga0105239_10006547 Ga0105239_100065475 215
88 3300010375 Ga0105239_10102342 Ga0105239_101023423 215
89 3300010375 Ga0105239_10157720 Ga0105239_101577203 215
90 3300011119 Ga0105246_10036080 Ga0105246_100360805 215
91 3300013100 Ga0157373_10033655 Ga0157373_100336554 215
92 3300013104 Ga0157370_10149518 Ga0157370_101495182 215
93 3300013104 Ga0157370_10258376 Ga0157370_102583763 215
94 3300013105 Ga0157369_10000952 Ga0157369_1000095235 215
95 3300013105 Ga0157369_10027003 Ga0157369_100270039 215
96 3300013105 Ga0157369_10087331 Ga0157369_100873315 215
97 3300013296 Ga0157374_10002202 Ga0157374_1000220216 215
98 3300013296 Ga0157374_10004753 Ga0157374_100047537 215
99 3300013296 Ga0157374_10119190 Ga0157374_101191905 215
100 3300013306 Ga0163162_10000026 Ga0163162_1000002613 215
101 3300013307 Ga0157372_10000077 Ga0157372_1000007721 215
102 3300013307 Ga0157372_10028253 Ga0157372_100282532 215
103 3300013308 Ga0157375_10021287 Ga0157375_100212879 215
104 3300014745 Ga0157377_10019190 Ga0157377_100191905 215
105 3300025231 Ga0207427_100060 Ga0207427_100060136 215
106 3300025233 Ga0209437_100021 Ga0209437_100021531 215
107 3300025250 Ga0209026_1005416 Ga0209026_10054162 215
108 3300025261 Ga0209233_1000035 Ga0209233_1000035106 215
109 3300025904 Ga0207647_10000012 Ga0207647_1000001269 215
110 3300025907 Ga0207645_10000347 Ga0207645_1000034717 215
111 3300025911 Ga0207654_10002932 Ga0207654_100029329 215
112 3300025911 Ga0207654_10126294 Ga0207654_101262941 215
113 3300025912 Ga0207707_10008874 Ga0207707_100088748 215
114 3300025913 Ga0207695_10007509 Ga0207695_1000750912 215
115 3300025913 Ga0207695_10009583 Ga0207695_100095834 215
116 3300025913 Ga0207695_10237877 Ga0207695_102378772 215
117 3300025913 Ga0207695_10457902 Ga0207695_104579021 215
118 3300025913 Ga0207695_10613747 Ga0207695_106137471 215
119 3300025914 Ga0207671_10003385 Ga0207671_100033859 215
120 3300025914 Ga0207671_10012938 Ga0207671_1001293810 215
121 3300025914 Ga0207671_10375550 Ga0207671_103755501 215
122 3300025924 Ga0207694_10017408 Ga0207694_100174087 215
123 3300025931 Ga0207644_10032676 Ga0207644_100326763 215
124 3300025932 Ga0207690_10065986 Ga0207690_100659863 215
125 3300025933 Ga0207706_10000092 Ga0207706_1000009210 215
126 3300025934 Ga0207686_10213114 Ga0207686_102131142 215
127 3300025935 Ga0207709_10038814 Ga0207709_100388145 215
128 3300025938 Ga0207704_10000043 Ga0207704_100000438 215
129 3300025949 Ga0207667_10000964 Ga0207667_1000096424 215
130 3300025949 Ga0207667_10065559 Ga0207667_100655592 215
131 3300025949 Ga0207667_10151158 Ga0207667_101511585 215
132 3300025960 Ga0207651_10061900 Ga0207651_100619003 215
133 3300026023 Ga0207677_10011989 Ga0207677_100119894 215
134 3300026041 Ga0207639_10011485 Ga0207639_100114854 215
135 3300026041 Ga0207639_10515519 Ga0207639_105155192 215
136 3300026041 Ga0207639_10875294 Ga0207639_108752941 215
137 3300026067 Ga0207678_10249139 Ga0207678_102491392 215
138 3300026078 Ga0207702_10018280 Ga0207702_100182806 215
139 3300026089 Ga0207648_10000423 Ga0207648_1000042340 215
140 3300026121 Ga0207683_10002796 Ga0207683_100027968 215
141 3300026142 Ga0207698_10011102 Ga0207698_100111028 215
142 3300026142 Ga0207698_10491969 Ga0207698_104919691 215
143 3300028379 Ga0268266_10000037 Ga0268266_10000037173 215
144 3300028794 Ga0307515_10112594 Ga0307515_101125943 215
145 3300031251 Ga0265327_10056161 Ga0265327_100561611 215
146 3300033180 Ga0307510_10000219 Ga0307510_1000021927 215
147 3300037312 Ga0395899_0000257 Ga0395899_0000257_48573_49220 215
148 3300037312 Ga0395899_0001310 Ga0395899_0001310_12510_13157 215
149 3300037418 Ga0395900_0001010 Ga0395900_0001010_30615_31262 215
150 3300037466 Ga0395898_0057901 Ga0395898_0057901_1409_2056 215
151 3300037471 Ga0395905_0000669 Ga0395905_0000669_39252_39899 215
152 3300038443 Ga0395901_0004148 Ga0395901_0004148_8322_8969 215
153 3300038443 Ga0395901_0159230 Ga0395901_0159230_1158_1811 215
154 3300044656 Ga0466969_0015414 Ga0466969_0015414_2590_3237 215
155 3300046462 Ga0495651_0245256 Ga0495651_0245256_459_1190 215
156 3300046471 Ga0495650_0118952 Ga0495650_0118952_126_773 215
157 3300046665 Ga0495661_0002236 Ga0495661_0002236_262_909 215
158 3300047443 Ga0495687_004490 Ga0495687_004490_477_1124 215
159 3300049460 Ga0495682_0179652 Ga0495682_0179652_34_681 215
160 3300053122 Ga0500608_033783 Ga0500608_033783_948_1595 215
161 3300002067 JGI24735J21928_10035654 JGI24735J21928_100356543 216
162 3300002737 JGI25162J39368_1000097 JGI25162J39368_100009739 216
163 3300002741 JGI25157J39369_1006902 JGI25157J39369_10069022 216
164 3300003323 rootH1_10039800 rootH1_100398003 216
165 3300003323 rootH1_10048874 rootH1_100488742 216
166 3300003781 Ga0055536_1000002 Ga0055536_1000002439 216
167 3300003791 Ga0055530_10006159 Ga0055530_100061598 216
168 3300005327 Ga0070658_10000059 Ga0070658_1000005938 216
169 3300005327 Ga0070658_10173894 Ga0070658_101738942 216
170 3300005327 Ga0070658_10739388 Ga0070658_107393881 216
171 3300005329 Ga0070683_100008610 Ga0070683_10000861013 216
172 3300005366 Ga0070659_100000440 Ga0070659_10000044023 216
173 3300005366 Ga0070659_100017160 Ga0070659_1000171606 216
174 3300005530 Ga0070679_100045389 Ga0070679_1000453892 216
175 3300005530 Ga0070679_100191160 Ga0070679_1001911602 216
176 3300005535 Ga0070684_100346846 Ga0070684_1003468462 216
177 3300005563 Ga0068855_100000060 Ga0068855_1000000609 216
178 3300005563 Ga0068855_100042312 Ga0068855_1000423123 216
179 3300005563 Ga0068855_100094942 Ga0068855_1000949423 216
180 3300005577 Ga0068857_100349481 Ga0068857_1003494812 216
181 3300005614 Ga0068856_100094719 Ga0068856_1000947192 216
182 3300005614 Ga0068856_100701742 Ga0068856_1007017421 216
183 3300005616 Ga0068852_100011061 Ga0068852_1000110617 216
184 3300005616 Ga0068852_100311938 Ga0068852_1003119383 216
185 3300005842 Ga0068858_100075544 Ga0068858_1000755443 216
186 3300006195 Ga0075366_10000507 Ga0075366_1000050715 216
187 3300009036 Ga0105244_10012227 Ga0105244_100122275 216
188 3300009093 Ga0105240_10184753 Ga0105240_101847534 216
189 3300009093 Ga0105240_11575953 Ga0105240_115759531 216
190 3300009174 Ga0105241_10033522 Ga0105241_100335224 216
191 3300009545 Ga0105237_10003635 Ga0105237_1000363511 216
192 3300009545 Ga0105237_10150130 Ga0105237_101501301 216
193 3300009545 Ga0105237_10280869 Ga0105237_102808692 216
194 3300009545 Ga0105237_10535724 Ga0105237_105357242 216
195 3300009553 Ga0105249_10068007 Ga0105249_100680073 216
196 3300010375 Ga0105239_10000026 Ga0105239_10000026165 216
197 3300010375 Ga0105239_10000821 Ga0105239_100008219 216
198 3300010375 Ga0105239_10063439 Ga0105239_100634392 216
199 3300013100 Ga0157373_10000140 Ga0157373_1000014016 216
200 3300013100 Ga0157373_10011122 Ga0157373_100111224 216
201 3300013100 Ga0157373_10294760 Ga0157373_102947602 216
202 3300013102 Ga0157371_10000025 Ga0157371_10000025198 216
203 3300013102 Ga0157371_10006008 Ga0157371_100060088 216
204 3300013104 Ga0157370_10001039 Ga0157370_1000103922 216
205 3300013104 Ga0157370_10004060 Ga0157370_1000406018 216
206 3300013104 Ga0157370_10014147 Ga0157370_100141476 216
207 3300013104 Ga0157370_10082639 Ga0157370_100826393 216
208 3300013104 Ga0157370_10169212 Ga0157370_101692123 216
209 3300013105 Ga0157369_10000038 Ga0157369_1000003863 216
210 3300013105 Ga0157369_10188234 Ga0157369_101882343 216
211 3300013296 Ga0157374_10120343 Ga0157374_101203432 216
212 3300013296 Ga0157374_10899302 Ga0157374_108993021 216
213 3300013297 Ga0157378_10008753 Ga0157378_100087532 216
214 3300013297 Ga0157378_10086490 Ga0157378_100864902 216
215 3300013306 Ga0163162_10000050 Ga0163162_1000005055 216
216 3300013306 Ga0163162_10016834 Ga0163162_100168346 216
217 3300013306 Ga0163162_10500907 Ga0163162_105009072 216
218 3300013307 Ga0157372_10002434 Ga0157372_1000243414 216
219 3300013307 Ga0157372_10303177 Ga0157372_103031774 216
220 3300013307 Ga0157372_10436187 Ga0157372_104361873 216
221 3300013308 Ga0157375_10135001 Ga0157375_101350012 216
222 3300013308 Ga0157375_10763576 Ga0157375_107635762 216
223 3300014497 Ga0182008_10000052 Ga0182008_1000005230 216
224 3300014745 Ga0157377_10258888 Ga0157377_102588882 216
225 3300015261 Ga0182006_1000127 Ga0182006_100012717 216
226 3300015261 Ga0182006_1000645 Ga0182006_100064517 216
227 3300015262 Ga0182007_10000024 Ga0182007_10000024103 216
228 3300015682 Ga0183373_1002 Ga0183373_1002100 216
229 3300015687 Ga0183368_1066 Ga0183368_10661 216
230 3300017792 Ga0163161_10001289 Ga0163161_1000128917 216
231 3300017792 Ga0163161_10002479 Ga0163161_100024797 216
232 3300017792 Ga0163161_10132150 Ga0163161_101321502 216
233 3300025233 Ga0209437_100030 Ga0209437_10003063 216
234 3300025250 Ga0209026_1000239 Ga0209026_100023922 216
235 3300025261 Ga0209233_1001683 Ga0209233_10016839 216
236 3300025292 Ga0209676_1000022 Ga0209676_100002299 216
237 3300025298 Ga0209050_1000020 Ga0209050_1000020441 216
238 3300025728 Ga0207655_1036503 Ga0207655_10365033 216
239 3300025904 Ga0207647_10000877 Ga0207647_1000087716 216
240 3300025909 Ga0207705_10000216 Ga0207705_1000021643 216
241 3300025911 Ga0207654_10158487 Ga0207654_101584872 216
242 3300025913 Ga0207695_10018279 Ga0207695_100182794 216
243 3300025913 Ga0207695_10072337 Ga0207695_100723375 216
244 3300025914 Ga0207671_10004562 Ga0207671_100045625 216
245 3300025914 Ga0207671_10005084 Ga0207671_100050844 216
246 3300025914 Ga0207671_10091299 Ga0207671_100912991 216
247 3300025919 Ga0207657_10047967 Ga0207657_100479674 216
248 3300025921 Ga0207652_10390662 Ga0207652_103906622 216
249 3300025932 Ga0207690_10000235 Ga0207690_1000023539 216
250 3300025932 Ga0207690_10015849 Ga0207690_100158494 216
251 3300025944 Ga0207661_10007736 Ga0207661_1000773610 216
252 3300025949 Ga0207667_10000033 Ga0207667_10000033279 216
253 3300025949 Ga0207667_10123298 Ga0207667_101232983 216
254 3300025949 Ga0207667_10377064 Ga0207667_103770642 216
255 3300026035 Ga0207703_10023399 Ga0207703_100233993 216
256 3300026078 Ga0207702_10717425 Ga0207702_107174251 216
257 3300026142 Ga0207698_10032617 Ga0207698_100326173 216
258 3300026142 Ga0207698_10071108 Ga0207698_100711082 216
259 3300026142 Ga0207698_10695955 Ga0207698_106959551 216
260 3300028786 Ga0307517_10009500 Ga0307517_1000950010 216
261 3300028794 Ga0307515_10000427 Ga0307515_1000042726 216
262 3300028794 Ga0307515_10001574 Ga0307515_1000157413 216
263 3300031548 Ga0307408_100000332 Ga0307408_10000033243 216
264 3300031548 Ga0307408_100000341 Ga0307408_10000034126 216
265 3300031548 Ga0307408_100006215 Ga0307408_1000062154 216
266 3300031731 Ga0307405_10000011 Ga0307405_10000011104 216
267 3300031731 Ga0307405_10030133 Ga0307405_100301336 216
268 3300031903 Ga0307407_10000018 Ga0307407_1000001865 216
269 3300031911 Ga0307412_10001562 Ga0307412_100015623 216
270 3300031911 Ga0307412_10015169 Ga0307412_100151698 216
271 3300031911 Ga0307412_10163167 Ga0307412_101631672 216
272 3300031995 Ga0307409_100023896 Ga0307409_1000238963 216
273 3300031995 Ga0307409_100147985 Ga0307409_1001479852 216
274 3300032002 Ga0307416_100001355 Ga0307416_1000013557 216
275 3300032002 Ga0307416_100154009 Ga0307416_1001540092 216
276 3300032004 Ga0307414_10000823 Ga0307414_100008237 216
277 3300032004 Ga0307414_10029605 Ga0307414_100296051 216
278 3300032004 Ga0307414_10066156 Ga0307414_100661563 216
279 3300032004 Ga0307414_10212678 Ga0307414_102126782 216
280 3300032004 Ga0307414_10665801 Ga0307414_106658012 216
281 3300032004 Ga0307414_10950700 Ga0307414_109507002 216
282 3300032005 Ga0307411_10567051 Ga0307411_105670512 216
283 3300032126 Ga0307415_100471418 Ga0307415_1004714182 216
284 3300033179 Ga0307507_10000510 Ga0307507_1000051017 216
285 3300037312 Ga0395899_0000017 Ga0395899_0000017_59152_59802 216
286 3300037418 Ga0395900_0000507 Ga0395900_0000507_28500_29150 216
287 3300037418 Ga0395900_0002104 Ga0395900_0002104_8228_8878 216
288 3300037466 Ga0395898_0069141 Ga0395898_0069141_653_1303 216
289 3300037471 Ga0395905_0004119 Ga0395905_0004119_12675_13325 216
290 3300038443 Ga0395901_0032997 Ga0395901_0032997_791_1441 216
291 3300046460 Ga0495638_0233913 Ga0495638_0233913_171_821 216
292 3300046471 Ga0495650_0013683 Ga0495650_0013683_2058_2708 216
293 3300046471 Ga0495650_0048302 Ga0495650_0048302_648_1298 216
294 3300046471 Ga0495650_0128855 Ga0495650_0128855_15_665 216
295 3300046492 Ga0495585_0001130 Ga0495585_0001130_5922_6572 216
296 3300046507 Ga0495606_0005446 Ga0495606_0005446_5865_6515 216
297 3300046507 Ga0495606_0019153 Ga0495606_0019153_1453_2103 216
298 3300046507 Ga0495606_0055664 Ga0495606_0055664_1017_1667 216
299 3300046507 Ga0495606_0067259 Ga0495606_0067259_541_1191 216
300 3300046507 Ga0495606_0257094 Ga0495606_0257094_158_808 216
301 3300046512 Ga0495610_0000037 Ga0495610_0000037_61687_62337 216
302 3300046512 Ga0495610_0000574 Ga0495610_0000574_27390_28040 216
303 3300046513 Ga0495616_0003550 Ga0495616_0003550_8670_9320 216
304 3300046516 Ga0495628_0144089 Ga0495628_0144089_146_796 216
305 3300046524 Ga0495648_0016265 Ga0495648_0016265_4543_5193 216
306 3300046524 Ga0495648_0067904 Ga0495648_0067904_526_1176 216
307 3300046530 Ga0495654_0104811 Ga0495654_0104811_96_746 216
308 3300046538 Ga0495609_0003227 Ga0495609_0003227_7580_8230 216
309 3300046558 Ga0495633_0000072 Ga0495633_0000072_113797_114447 216
310 3300046558 Ga0495633_0014888 Ga0495633_0014888_2263_2913 216
311 3300046616 Ga0495668_0000009 Ga0495668_0000009_21869_22519 216
312 3300046616 Ga0495668_0127927 Ga0495668_0127927_361_1011 216
313 3300046660 Ga0495625_0000831 Ga0495625_0000831_14330_14980 216
314 3300046660 Ga0495625_0001804 Ga0495625_0001804_958_1608 216
315 3300046660 Ga0495625_0085398 Ga0495625_0085398_287_937 216
316 3300046809 Ga0495600_0304912 Ga0495600_0304912_17_667 216
317 3300046810 Ga0495660_0124241 Ga0495660_0124241_367_1017 216
318 3300047472 Ga0495686_0000490 Ga0495686_0000490_18583_19233 216
319 3300047472 Ga0495686_0000783 Ga0495686_0000783_21679_22329 216
320 3300047673 Ga0495593_0341969 Ga0495593_0341969_66_716 216
321 3300048089 Ga0495614_0035002 Ga0495614_0035002_130_780 216
322 3300049459 Ga0495678_004679 Ga0495678_004679_4406_5056 216
323 3300049663 Ga0501223_000715 Ga0501223_000715_3988_4692 216
324 3300050493 nmdc:mga0k408_296_c1 nmdc:mga0k408_296_c1_11811_12461 216
325 3300053080 Ga0500635_0001990 Ga0500635_0001990_2435_3085 216
326 3300053125 Ga0500618_000057 Ga0500618_000057_35937_36587 216
327 3300053138 Ga0500564_050809 Ga0500564_050809_1045_1695 216
328 3300053156 Ga0500622_0001643 Ga0500622_0001643_11263_11913 216
329 3300053161 Ga0500634_0035279 Ga0500634_0035279_1471_2121 216
330 3300005327 Ga0070658_10167705 Ga0070658_101677052 217
331 3300009093 Ga0105240_10236810 Ga0105240_102368102 217
332 3300025250 Ga0209026_1000787 Ga0209026_100078719 217
333 3300025909 Ga0207705_10374279 Ga0207705_103742791 217
334 3300025913 Ga0207695_10731306 Ga0207695_107313062 217
335 3300030732 Ga0316176_1029716 Ga0316176_10297163 217
336 3300030742 Ga0316183_1126062 Ga0316183_11260628 217
337 3300030744 Ga0316181_1121975 Ga0316181_112197525 217
338 2162886007 SwRhRL2b_contig_78349 SwRhRL2b_0645.00007980 218
339 3300001990 JGI24737J22298_10000056 JGI24737J22298_1000005622 218
340 3300002067 JGI24735J21928_10000011 JGI24735J21928_1000001156 218
341 3300003316 rootH1_10004367 rootH1_100043679 218
342 3300003320 rootH2_10050402 rootH2_100504027 218
343 3300003322 rootL2_10139661 rootL2_101396613 218
344 3300003323 rootH1_10086518 rootH1_100865187 218
345 3300005289 Ga0065704_10002103 Ga0065704_100021035 218
346 3300005289 Ga0065704_10174714 Ga0065704_101747141 218
347 3300005563 Ga0068855_100069349 Ga0068855_1000693492 218
348 3300006195 Ga0075366_10023126 Ga0075366_100231264 218
349 3300009093 Ga0105240_10000083 Ga0105240_1000008313 218
350 3300009148 Ga0105243_10000003 Ga0105243_10000003133 218
351 3300009174 Ga0105241_10004634 Ga0105241_1000463411 218
352 3300009545 Ga0105237_10004990 Ga0105237_100049908 218
353 3300009545 Ga0105237_10127040 Ga0105237_101270404 218
354 3300009551 Ga0105238_10104848 Ga0105238_101048483 218
355 3300009551 Ga0105238_10468827 Ga0105238_104688273 218
356 3300010375 Ga0105239_10000708 Ga0105239_1000070849 218
357 3300013102 Ga0157371_10012944 Ga0157371_100129445 218
358 3300013104 Ga0157370_10319793 Ga0157370_103197932 218
359 3300013105 Ga0157369_10097101 Ga0157369_100971012 218
360 3300013296 Ga0157374_10784610 Ga0157374_107846101 218
361 3300013306 Ga0163162_10019343 Ga0163162_100193435 218
362 3300013306 Ga0163162_10498881 Ga0163162_104988812 218
363 3300013307 Ga0157372_10000870 Ga0157372_1000087025 218
364 3300025904 Ga0207647_10033765 Ga0207647_100337655 218
365 3300025911 Ga0207654_10012860 Ga0207654_100128605 218
366 3300025913 Ga0207695_10000127 Ga0207695_1000012713 218
367 3300025914 Ga0207671_10001459 Ga0207671_1000145918 218
368 3300025914 Ga0207671_10284264 Ga0207671_102842643 218
369 3300025924 Ga0207694_10232444 Ga0207694_102324442 218
370 3300025935 Ga0207709_10000008 Ga0207709_10000008439 218
371 3300025949 Ga0207667_10087677 Ga0207667_100876772 218
372 3300026041 Ga0207639_10062697 Ga0207639_100626974 218
373 3300026078 Ga0207702_10000042 Ga0207702_1000004267 218
374 3300044712 Ga0453684_0003110 Ga0453684_0003110_3472_4152 218
375 3300044712 Ga0453684_0204824 Ga0453684_0204824_1320_1994 218
376 3300044712 Ga0453684_0546903 Ga0453684_0546903_241_924 218
377 3300046471 Ga0495650_0000330 Ga0495650_0000330_83589_84248 218
378 3300046492 Ga0495585_0000280 Ga0495585_0000280_24098_24757 218
379 3300046506 Ga0495583_0131847 Ga0495583_0131847_121_780 218
380 3300046507 Ga0495606_0000531 Ga0495606_0000531_21977_22636 218
381 3300046507 Ga0495606_0135281 Ga0495606_0135281_462_1121 218
382 3300046512 Ga0495610_0010906 Ga0495610_0010906_3907_4566 218
383 3300046513 Ga0495616_0003620 Ga0495616_0003620_793_1452 218
384 3300046520 Ga0495637_0115399 Ga0495637_0115399_68_727 218
385 3300046538 Ga0495609_0044852 Ga0495609_0044852_307_966 218
386 3300046557 Ga0495622_0142494 Ga0495622_0142494_80_739 218
387 3300046660 Ga0495625_0000007 Ga0495625_0000007_461073_461732 218
388 3300046665 Ga0495661_0013201 Ga0495661_0013201_834_1493 218
389 3300046665 Ga0495661_0085892 Ga0495661_0085892_717_1376 218
390 3300046692 Ga0495671_0062761 Ga0495671_0062761_897_1556 218
391 3300046694 Ga0495649_0000038 Ga0495649_0000038_103854_104513 218
392 3300046794 Ga0495589_0012817 Ga0495589_0012817_776_1435 218
393 3300046810 Ga0495660_0001638 Ga0495660_0001638_9212_9871 218
394 3300047443 Ga0495687_001024 Ga0495687_001024_18429_19088 218
395 3300047472 Ga0495686_0020548 Ga0495686_0020548_1304_1963 218
396 3300048919 Ga0496116_0002515 Ga0496116_0002515_4286_4942 218
397 3300048920 Ga0496117_0001212 Ga0496117_0001212_25361_26017 218
398 3300048925 Ga0496122_0002213 Ga0496122_0002213_13153_13809 218
399 3300048926 Ga0496123_0013682 Ga0496123_0013682_2434_3090 218
400 3300048927 Ga0496124_0530026 Ga0496124_0530026_48_704 218
401 3300049570 Ga0501033_0285976 Ga0501033_0285976_119_775 218
402 3300050493 nmdc:mga0k408_1624_c2 nmdc:mga0k408_1624_c2_1507_2166 218
403 3300053125 Ga0500618_006639 Ga0500618_006639_302_961 218

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02390

Methyltransf_4

Putative methyltransferase

79

251

0.93

PF13649

Methyltransf_25

Methyltransferase domain

83

188

0.84

PF13847

Methyltransf_31

Methyltransferase domain

77

238

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yzh-assembly1.cif.gz_A crystal structure of the conserved hypothetical protein, methyltransferase from streptococcus pneumoniae tigr4 0.9073 9 215
7nzj-assembly3.cif.gz_E structure of bstrmb apo 0.9028 7 216
1yzh-assembly1.cif.gz_A crystal structure of the conserved hypothetical protein, methyltransferase from streptococcus pneumoniae tigr4 0.8989 9 215
7nzj-assembly3.cif.gz_E structure of bstrmb apo 0.882 7 216
3dxz-assembly1.cif.gz_A crystal structure of ectrmb in complex with sah 0.8427 18 217
ID Description Score Start End Superfamily
1yzhA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9043 9 215 3.40.50.150
1yzhA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8959 9 215 3.40.50.150
af_Q8I3G1_737_866_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8841 41 116 3.40.50.150
af_Q9VDC8_53_204_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8458 38 152 3.40.50.150
af_Q55EX4_556_743_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8434 36 214 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A520BI54-F1-model_v4 Methyltransferase domain-containing protein 0.9915 1 110 GO:0008176
GO:0043527
AF-A0A520BI54-F1-model_v4 Methyltransferase domain-containing protein 0.9827 1 110 GO:0008176
GO:0043527
AF-A0A3N7HXB8-F1-model_v4 tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-methyltransferase) 0.9767 1 216 GO:0008176
GO:0043527
AF-A0A520AUB9-F1-model_v4 tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-methyltransferase) 0.976 1 216 GO:0008176
GO:0043527
AF-R9GQF9-F1-model_v4 tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-methyltransferase) 0.9759 1 216 GO:0008176
GO:0043527

Feature Viewer

pLDDT pTM Quality
89.56 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map