F435358

General Info

Members Datasets Scaffolds Average Seq Length
403 218 806 190

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100038959|Ga0075428_1000389592
Length 191
Sequence MKILVIDNYDSFTYNLVQYLGELGTEPDVVRNDVHTVDELLGRGADRVVISPGPCRPVDAGVSIEAARRFPAEGVPVLGVCLGHQAMAEAFGGTVEIGEPVHGKTAEVRHDGRSIFRDVENPLTAGRYHSLVVAPDLPDELEQSAESHGTVMGIRHRTLPAEGVQFHPESVLTGSGKRILRNFIDGAAGGA

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
136 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
137 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
153 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
154 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
159 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
160 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
161 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
191 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
192 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
195 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
196 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
197 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
198 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
199 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
200 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
201 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
204 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
207 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
210 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
215 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
216 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
217 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.49
Nodule 0
Rhizoplane 11.41
Rhizosphere 87.1
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100038959 3300006844 Bacteria 5231
2 Ga0070683_100011373 3300005329 Bacteria 7691
3 Ga0070683_100072591 3300005329 Bacteria 3212
4 Ga0070690_100122980 3300005330 Bacteria 1744
5 Ga0070690_100509548 3300005330 Bacteria 901
6 Ga0070670_100131952 3300005331 Bacteria 2157
7 Ga0070670_100219502 3300005331 Bacteria 1654
8 Ga0068869_100210563 3300005334 Bacteria 1537
9 Ga0070682_100002376 3300005337 Bacteria 10428
10 Ga0070682_100186686 3300005337 Bacteria 1453
11 Ga0068868_100006416 3300005338 Bacteria 8324
12 Ga0068868_100208842 3300005338 Bacteria 1631
13 Ga0068868_100543731 3300005338 Bacteria 1023
14 Ga0070660_100005049 3300005339 Bacteria 9117
15 Ga0070660_100263048 3300005339 Bacteria 1409
16 Ga0070689_100056882 3300005340 Bacteria 3034
17 Ga0070691_10058619 3300005341 Bacteria 1849
18 Ga0070687_100337915 3300005343 Bacteria 968
19 Ga0070687_100376372 3300005343 Bacteria 924
20 Ga0070661_100025720 3300005344 Bacteria 4231
21 Ga0070661_100161131 3300005344 Bacteria 1699
22 Ga0070668_100111672 3300005347 Bacteria 2176
23 Ga0070669_100087069 3300005353 Bacteria 2335
24 Ga0070675_100017193 3300005354 Bacteria 5748
25 Ga0070675_100088699 3300005354 Bacteria 2588
26 Ga0070671_100065570 3300005355 Bacteria 3025
27 Ga0070674_100103138 3300005356 Bacteria 2082
28 Ga0070674_100381338 3300005356 Bacteria 1147
29 Ga0070673_100015704 3300005364 Bacteria 5328
30 Ga0070688_100136081 3300005365 Bacteria 1663
31 Ga0070659_100025561 3300005366 Bacteria 4536
32 Ga0070659_100138793 3300005366 Bacteria 1978
33 Ga0070659_100279064 3300005366 Bacteria 1390
34 Ga0070659_100300587 3300005366 Bacteria 1338
35 Ga0070667_100345238 3300005367 Bacteria 1347
36 Ga0070714_101222751 3300005435 Bacteria 733
37 Ga0070710_10031587 3300005437 Bacteria 2861
38 Ga0070701_10409056 3300005438 Bacteria 861
39 Ga0070711_100754041 3300005439 Bacteria 823
40 Ga0070705_100158383 3300005440 Bacteria 1511
41 Ga0070700_100002373 3300005441 Bacteria 9591
42 Ga0070700_100006964 3300005441 Bacteria 6070
43 Ga0070700_100330864 3300005441 Bacteria 1122
44 Ga0070694_100162298 3300005444 Bacteria 1641
45 Ga0070694_100859825 3300005444 Bacteria 747
46 Ga0070678_100112465 3300005456 Bacteria 2132
47 Ga0070662_100016739 3300005457 Bacteria 4928
48 Ga0070662_100052889 3300005457 Bacteria 2938
49 Ga0070681_10225685 3300005458 Bacteria 1788
50 Ga0070685_10022328 3300005466 Bacteria 3449
51 Ga0070684_100007514 3300005535 Bacteria 8480
52 Ga0070684_100020850 3300005535 Bacteria 5440
53 Ga0070684_100318033 3300005535 Bacteria 1430
54 Ga0068853_100075967 3300005539 Bacteria 2933
55 Ga0070672_100154046 3300005543 Bacteria 1903
56 Ga0070693_100084488 3300005547 Bacteria 1900
57 Ga0070665_100047104 3300005548 Bacteria 4328
58 Ga0070704_100381694 3300005549 Bacteria 1197
59 Ga0070664_100013126 3300005564 Bacteria 6743
60 Ga0070664_100050249 3300005564 Bacteria 3528
61 Ga0070664_100186136 3300005564 Bacteria 1848
62 Ga0068854_100021099 3300005578 Bacteria 4417
63 Ga0068854_100044507 3300005578 Bacteria 3151
64 Ga0068854_100507354 3300005578 Bacteria 1017
65 Ga0068856_100038269 3300005614 Bacteria 4708
66 Ga0068856_100577265 3300005614 Bacteria 1145
67 Ga0070702_100059675 3300005615 Bacteria 2215
68 Ga0070702_100200196 3300005615 Bacteria 1321
69 Ga0068852_100196070 3300005616 Bacteria 1908
70 Ga0068859_100440220 3300005617 Bacteria 1400
71 Ga0068859_100575001 3300005617 Bacteria 1220
72 Ga0068864_100048115 3300005618 Bacteria 3665
73 Ga0068864_100179128 3300005618 Bacteria 1937
74 Ga0068866_10071310 3300005718 Bacteria 1837
75 Ga0068866_10194850 3300005718 Bacteria 1206
76 Ga0068861_100080765 3300005719 Bacteria 2544
77 Ga0068863_100152604 3300005841 Bacteria 2211
78 Ga0068858_100378168 3300005842 Bacteria 1359
79 Ga0068862_100213460 3300005844 Bacteria 1744
80 Ga0081455_10017773 3300005937 Bacteria 6803
81 Ga0081538_10113501 3300005981 Bacteria 1323
82 Ga0075365_10000831 3300006038 Bacteria 12779
83 Ga0075363_100013439 3300006048 Bacteria 3969
84 Ga0070712_100038613 3300006175 Bacteria 3264
85 Ga0075428_100320208 3300006844 Bacteria 1666
86 Ga0075431_100024906 3300006847 Bacteria 6136
87 Ga0075431_100589012 3300006847 Bacteria 1097
88 Ga0075433_10786611 3300006852 Bacteria 832
89 Ga0075429_100008626 3300006880 Bacteria 8868
90 Ga0068865_100182423 3300006881 Bacteria 1617
91 Ga0068865_100253577 3300006881 Bacteria 1390
92 Ga0068865_100459083 3300006881 Bacteria 1055
93 Ga0075436_100136547 3300006914 Bacteria 1722
94 Ga0097620_100440210 3300006931 Bacteria 1400
95 Ga0097620_100574983 3300006931 Bacteria 1220
96 Ga0105251_10311076 3300009011 Bacteria 715
97 Ga0111539_10017607 3300009094 Bacteria 8843
98 Ga0111539_10019823 3300009094 Bacteria 8289
99 Ga0111539_10216118 3300009094 Bacteria 2233
100 Ga0111539_10560046 3300009094 Bacteria 1331
101 Ga0111539_10631221 3300009094 Bacteria 1247
102 Ga0111539_11015574 3300009094 Bacteria 964
103 Ga0105245_10004999 3300009098 Bacteria 11657
104 Ga0105245_10008895 3300009098 Bacteria 8764
105 Ga0105245_10443880 3300009098 Bacteria 1305
106 Ga0114129_10044517 3300009147 Bacteria 6244
107 Ga0114129_10499226 3300009147 Bacteria 1589
108 Ga0105243_10002741 3300009148 Bacteria 14645
109 Ga0105243_11846619 3300009148 Bacteria 636
110 Ga0105242_10062243 3300009176 Bacteria 3070
111 Ga0105242_10526706 3300009176 Bacteria 1129
112 Ga0105248_10356867 3300009177 Bacteria 1646
113 Ga0105237_10910775 3300009545 Bacteria 886
114 Ga0105238_10585468 3300009551 Bacteria 1122
115 Ga0105249_10276881 3300009553 Bacteria 1674
116 Ga0105249_10302265 3300009553 Bacteria 1605
117 Ga0105239_10010852 3300010375 Bacteria 10177
118 Ga0105239_10240416 3300010375 Bacteria 2032
119 Ga0105239_11590839 3300010375 Bacteria 756
120 Ga0105246_10064631 3300011119 Bacteria 2557
121 Ga0105246_10086721 3300011119 Bacteria 2245
122 Ga0105246_10418121 3300011119 Bacteria 1118
123 Ga0157371_10110188 3300013102 Bacteria 1954
124 Ga0157369_10964227 3300013105 Bacteria 874
125 Ga0157374_10284246 3300013296 Bacteria 1634
126 Ga0157378_10337727 3300013297 Bacteria 1468
127 Ga0163162_10380202 3300013306 Bacteria 1545
128 Ga0157372_10039794 3300013307 Bacteria 5190
129 Ga0157372_10278580 3300013307 Bacteria 1944
130 Ga0157375_10044027 3300013308 Bacteria 4332
131 Ga0157375_10426300 3300013308 Bacteria 1492
132 Ga0157375_10734224 3300013308 Bacteria 1140
133 Ga0157375_12269364 3300013308 Bacteria 647
134 Ga0163163_10135575 3300014325 Bacteria 2503
135 Ga0163163_10472404 3300014325 Bacteria 1315
136 Ga0163163_11594612 3300014325 Bacteria 714
137 Ga0157377_10002155 3300014745 Bacteria 8643
138 Ga0157377_10022649 3300014745 Bacteria 3320
139 Ga0157377_10125124 3300014745 Bacteria 1563
140 Ga0157379_10184994 3300014968 Bacteria 1882
141 Ga0157379_11063535 3300014968 Bacteria 774
142 Ga0157376_10594977 3300014969 Bacteria 1100
143 Ga0206353_11433295 3300020082 Bacteria 679
144 Ga0207642_10135610 3300025899 Bacteria 1291
145 Ga0207642_10231036 3300025899 Bacteria 1039
146 Ga0207710_10065617 3300025900 Bacteria 1655
147 Ga0207688_10000778 3300025901 Bacteria 15888
148 Ga0207688_10025379 3300025901 Bacteria 3254
149 Ga0207680_10967976 3300025903 Bacteria 610
150 Ga0207643_10187468 3300025908 Bacteria 1254
151 Ga0207705_10072327 3300025909 Bacteria 2501
152 Ga0207695_10910051 3300025913 Bacteria 759
153 Ga0207693_10010070 3300025915 Bacteria 7680
154 Ga0207663_10046696 3300025916 Bacteria 2669
155 Ga0207663_10191812 3300025916 Bacteria 1468
156 Ga0207660_10267032 3300025917 Bacteria 1355
157 Ga0207662_10305573 3300025918 Bacteria 1058
158 Ga0207657_10000816 3300025919 Bacteria 32902
159 Ga0207657_10266179 3300025919 Bacteria 1363
160 Ga0207657_10460902 3300025919 Bacteria 997
161 Ga0207649_10036631 3300025920 Bacteria 2957
162 Ga0207649_10037930 3300025920 Bacteria 2915
163 Ga0207649_10385334 3300025920 Bacteria 1046
164 Ga0207694_10613198 3300025924 Bacteria 915
165 Ga0207659_10021963 3300025926 Bacteria 4244
166 Ga0207659_10089006 3300025926 Bacteria 2301
167 Ga0207659_10239604 3300025926 Bacteria 1467
168 Ga0207687_10047947 3300025927 Bacteria 2963
169 Ga0207687_10118175 3300025927 Bacteria 1979
170 Ga0207687_10336762 3300025927 Bacteria 1226
171 Ga0207644_10127816 3300025931 Bacteria 1942
172 Ga0207690_10049411 3300025932 Bacteria 2804
173 Ga0207690_10271971 3300025932 Bacteria 1316
174 Ga0207690_10575885 3300025932 Bacteria 917
175 Ga0207706_10006909 3300025933 Bacteria 10497
176 Ga0207706_10042476 3300025933 Bacteria 4029
177 Ga0207706_10810207 3300025933 Bacteria 795
178 Ga0207686_10117668 3300025934 Bacteria 1803
179 Ga0207686_10201389 3300025934 Bacteria 1426
180 Ga0207709_10022639 3300025935 Bacteria 3566
181 Ga0207670_10067500 3300025936 Bacteria 2461
182 Ga0207670_10124144 3300025936 Bacteria 1881
183 Ga0207669_10006612 3300025937 Bacteria 5314
184 Ga0207669_10074601 3300025937 Bacteria 2146
185 Ga0207669_10117602 3300025937 Bacteria 1797
186 Ga0207704_10059876 3300025938 Bacteria 2353
187 Ga0207704_10232007 3300025938 Bacteria 1373
188 Ga0207704_10369659 3300025938 Bacteria 1122
189 Ga0207691_10014945 3300025940 Bacteria 7397
190 Ga0207691_10146358 3300025940 Bacteria 2080
191 Ga0207691_10234119 3300025940 Bacteria 1590
192 Ga0207711_10191856 3300025941 Bacteria 1862
193 Ga0207711_10270520 3300025941 Bacteria 1563
194 Ga0207689_10031485 3300025942 Bacteria 4415
195 Ga0207689_10104660 3300025942 Bacteria 2325
196 Ga0207661_10021381 3300025944 Bacteria 4846
197 Ga0207661_10198352 3300025944 Bacteria 1763
198 Ga0207661_10351443 3300025944 Bacteria 1330
199 Ga0207679_10023432 3300025945 Bacteria 4222
200 Ga0207679_10099667 3300025945 Bacteria 2269
201 Ga0207679_10178973 3300025945 Bacteria 1752
202 Ga0207651_10469346 3300025960 Bacteria 1083
203 Ga0207712_10071440 3300025961 Bacteria 2496
204 Ga0207668_10135738 3300025972 Bacteria 1885
205 Ga0207668_10172111 3300025972 Bacteria 1699
206 Ga0207668_10430928 3300025972 Bacteria 1121
207 Ga0207668_10743196 3300025972 Bacteria 865
208 Ga0207640_10484961 3300025981 Bacteria 1026
209 Ga0207640_10689325 3300025981 Bacteria 875
210 Ga0207658_10106951 3300025986 Bacteria 2204
211 Ga0207658_11105413 3300025986 Bacteria 724
212 Ga0207677_10044545 3300026023 Bacteria 2957
213 Ga0207677_10097155 3300026023 Bacteria 2157
214 Ga0207677_10116129 3300026023 Bacteria 2003
215 Ga0207677_10183293 3300026023 Bacteria 1649
216 Ga0207677_10619267 3300026023 Bacteria 952
217 Ga0207703_10106393 3300026035 Bacteria 2386
218 Ga0207703_10134898 3300026035 Bacteria 2136
219 Ga0207678_10011857 3300026067 Bacteria 7653
220 Ga0207678_10078684 3300026067 Bacteria 2823
221 Ga0207678_10095321 3300026067 Bacteria 2543
222 Ga0207678_10302284 3300026067 Bacteria 1375
223 Ga0207708_10000779 3300026075 Bacteria 24028
224 Ga0207708_10005182 3300026075 Bacteria 9615
225 Ga0207708_10007220 3300026075 Bacteria 8214
226 Ga0207641_10631028 3300026088 Bacteria 1051
227 Ga0207641_11421991 3300026088 Bacteria 695
228 Ga0207648_10055056 3300026089 Bacteria 3473
229 Ga0207648_10333703 3300026089 Bacteria 1364
230 Ga0207676_10076283 3300026095 Bacteria 2708
231 Ga0207676_10079168 3300026095 Bacteria 2664
232 Ga0207676_10177390 3300026095 Bacteria 1862
233 Ga0207674_10058280 3300026116 Bacteria 3913
234 Ga0207674_10076299 3300026116 Bacteria 3360
235 Ga0207675_100046839 3300026118 Bacteria 4039
236 Ga0207675_100065908 3300026118 Bacteria 3384
237 Ga0207675_100563992 3300026118 Bacteria 1139
238 Ga0207683_10020927 3300026121 Bacteria 5598
239 Ga0207683_10120063 3300026121 Bacteria 2359
240 Ga0207683_10341179 3300026121 Bacteria 1374
241 Ga0207698_10069183 3300026142 Bacteria 2790
242 Ga0207698_10076949 3300026142 Bacteria 2673
243 Ga0207428_10425829 3300027907 Bacteria 970
244 Ga0268266_10027465 3300028379 Bacteria 4839
245 Ga0268266_10115648 3300028379 Bacteria 2382
246 Ga0268266_10181424 3300028379 Bacteria 1917
247 Ga0268265_10512376 3300028380 Bacteria 1132
248 Ga0268265_11301294 3300028380 Bacteria 727
249 Ga0268264_10488551 3300028381 Bacteria 1199
250 Ga0268264_10946327 3300028381 Bacteria 866
251 Ga0265319_1000005 3300028563 Bacteria 249025
252 Ga0265320_10099552 3300031240 Bacteria 1339
253 Ga0265327_10013637 3300031251 Bacteria 5385
254 Ga0307408_100165612 3300031548 Bacteria 1760
255 Ga0307405_10229781 3300031731 Bacteria 1367
256 Ga0307405_10355955 3300031731 Bacteria 1131
257 Ga0307405_10921387 3300031731 Bacteria 740
258 Ga0307413_10498023 3300031824 Bacteria 978
259 Ga0307410_10292630 3300031852 Bacteria 1282
260 Ga0307407_10117017 3300031903 Bacteria 1683
261 Ga0307409_100073425 3300031995 Bacteria 2728
262 Ga0307416_100093631 3300032002 Bacteria 2589
263 Ga0307416_100724669 3300032002 Bacteria 1085
264 Ga0307414_10119701 3300032004 Bacteria 2022
265 Ga0307411_10047827 3300032005 Bacteria 2768
266 Ga0307411_10064428 3300032005 Bacteria 2454
267 Ga0307415_100270471 3300032126 Bacteria 1392
268 Ga0307415_100367306 3300032126 Bacteria 1217
269 Ga0373947_0179494 3300035725 Bacteria 1378
270 Ga0395900_0231920 3300037418 Bacteria 1856
271 Ga0395898_0337878 3300037466 Bacteria 1436
272 Ga0395898_0433580 3300037466 Bacteria 1252
273 Ga0395901_0122748 3300038443 Bacteria 2730
274 Ga0395901_0995266 3300038443 Bacteria 815
275 Ga0451791_0232791 3300041451 Bacteria 1202
276 Ga0451802_2001490 3300041460 Bacteria 629
277 Ga0466961_0043016 3300044693 Bacteria 2894
278 Ga0466957_0088205 3300044842 Bacteria 1941
279 Ga0466957_0090937 3300044842 Bacteria 1912
280 Ga0466960_0000491 3300044901 Bacteria 13495
281 Ga0466960_0003151 3300044901 Bacteria 6324
282 Ga0466960_0024474 3300044901 Bacteria 2724
283 Ga0466960_0027424 3300044901 Bacteria 2598
284 Ga0466960_0042956 3300044901 Bacteria 2148
285 Ga0466960_0053007 3300044901 Bacteria 1965
286 Ga0466960_0122928 3300044901 Bacteria 1361
287 Ga0466960_0672694 3300044901 Bacteria 619
288 Ga0466967_0003470 3300045976 Bacteria 10294
289 Ga0466967_0038543 3300045976 Bacteria 4100
290 Ga0466967_0204429 3300045976 Bacteria 1871
291 Ga0466967_0264894 3300045976 Bacteria 1645
292 Ga0466967_0337385 3300045976 Bacteria 1457
293 Ga0466967_0438285 3300045976 Bacteria 1275
294 Ga0495603_0094954 3300046455 Bacteria 1742
295 Ga0495641_0083008 3300046461 Bacteria 1435
296 Ga0495643_0205241 3300046522 Bacteria 944
297 Ga0495586_0467510 3300046535 Bacteria 727
298 Ga0495676_0131625 3300047321 Bacteria 1805
299 Ga0496100_0021292 3300048903 Bacteria 3902
300 Ga0496100_0139813 3300048903 Bacteria 1715
301 Ga0496101_0058313 3300048904 Bacteria 2795
302 Ga0496101_0219840 3300048904 Bacteria 1474
303 Ga0496101_0883633 3300048904 Bacteria 704
304 Ga0496102_0013958 3300048905 Bacteria 6973
305 Ga0496102_0075458 3300048905 Bacteria 3100
306 Ga0496103_0135992 3300048906 Bacteria 1571
307 Ga0496104_0154245 3300048907 Bacteria 2204
308 Ga0496104_0164341 3300048907 Bacteria 2128
309 Ga0496104_0207288 3300048907 Bacteria 1872
310 Ga0496105_0030421 3300048908 Bacteria 4424
311 Ga0496105_0222754 3300048908 Bacteria 1535
312 Ga0496105_0990064 3300048908 Bacteria 629
313 Ga0496106_0019282 3300048909 Bacteria 5057
314 Ga0496106_0043344 3300048909 Bacteria 3376
315 Ga0496106_0068014 3300048909 Bacteria 2716
316 Ga0496106_0490949 3300048909 Bacteria 986
317 Ga0496107_0012239 3300048910 Bacteria 5988
318 Ga0496107_0386195 3300048910 Bacteria 1041
319 Ga0496108_0085891 3300048911 Bacteria 2671
320 Ga0496108_0212340 3300048911 Bacteria 1680
321 Ga0496108_0417026 3300048911 Bacteria 1172
322 Ga0496108_0584464 3300048911 Bacteria 973
323 Ga0496109_0019272 3300048912 Bacteria 6012
324 Ga0496109_0021840 3300048912 Bacteria 5665
325 Ga0496109_0052722 3300048912 Bacteria 3708
326 Ga0496109_0095387 3300048912 Bacteria 2754
327 Ga0496109_0152827 3300048912 Bacteria 2161
328 Ga0496110_0017360 3300048913 Bacteria 6019
329 Ga0496110_0085299 3300048913 Bacteria 2819
330 Ga0496110_0231328 3300048913 Bacteria 1681
331 Ga0496110_0998122 3300048913 Bacteria 744
332 Ga0496111_0026466 3300048914 Bacteria 4097
333 Ga0496111_0096607 3300048914 Bacteria 2168
334 Ga0496112_0007185 3300048915 Bacteria 9863
335 Ga0496112_0007790 3300048915 Bacteria 9534
336 Ga0496112_0094131 3300048915 Bacteria 2966
337 Ga0496112_0175416 3300048915 Bacteria 2108
338 Ga0496114_0088118 3300048917 Bacteria 2633
339 Ga0496114_0360878 3300048917 Bacteria 1285
340 Ga0496114_0444447 3300048917 Bacteria 1148
341 Ga0496115_0105263 3300048918 Bacteria 2315
342 Ga0496115_0118960 3300048918 Bacteria 2173
343 Ga0501031_0042396 3300049568 Bacteria 2970
344 Ga0501031_0120640 3300049568 Bacteria 1713
345 Ga0501031_0656883 3300049568 Bacteria 674
346 Ga0501033_0114878 3300049570 Bacteria 1956
347 Ga0501034_0735822 3300049571 Bacteria 882
348 Ga0501036_0043091 3300049572 Bacteria 3821
349 Ga0501037_0042343 3300049573 Bacteria 3346
350 Ga0501038_0043019 3300049574 Bacteria 3930
351 Ga0501039_0045898 3300049575 Bacteria 3376
352 Ga0501039_0716032 3300049575 Bacteria 782
353 Ga0501040_0682318 3300049576 Bacteria 743
354 Ga0501042_0418643 3300049578 Bacteria 971
355 Ga0501042_0554107 3300049578 Bacteria 836
356 Ga0501046_0008737 3300049580 Bacteria 8799
357 Ga0501047_0422866 3300049581 Bacteria 1163
358 Ga0501048_0041630 3300049582 Bacteria 3289
359 Ga0501048_0516348 3300049582 Bacteria 857
360 Ga0501048_0827727 3300049582 Bacteria 665
361 Ga0501067_0179990 3300049583 Bacteria 1177
362 Ga0501068_0238348 3300049584 Bacteria 1157
363 Ga0501068_0285040 3300049584 Bacteria 1056
364 Ga0501069_0035977 3300049585 Bacteria 2729
365 Ga0501070_0408489 3300049586 Bacteria 1097
366 Ga0501070_0751151 3300049586 Bacteria 769
367 Ga0501070_0799003 3300049586 Bacteria 741
368 Ga0501071_0278125 3300049587 Bacteria 1267
369 Ga0501072_0170120 3300049588 Bacteria 1739
370 Ga0501073_0028662 3300049589 Bacteria 3978
371 Ga0501074_0027001 3300049590 Bacteria 4160
372 Ga0501074_0138187 3300049590 Bacteria 1743
373 Ga0501074_0292629 3300049590 Bacteria 1157
374 Ga0501075_0368573 3300049591 Bacteria 1095
375 Ga0501076_0185394 3300049592 Bacteria 1697
376 Ga0501077_0191110 3300049593 Bacteria 1301
377 Ga0501079_0029742 3300049741 Bacteria 4195
378 Ga0501079_0490493 3300049741 Bacteria 966
379 Ga0501080_0013443 3300049742 Bacteria 7530
380 Ga0501080_0020493 3300049742 Bacteria 6122
381 Ga0501083_0052390 3300049744 Bacteria 2741
382 Ga0501035_0007123 3300049822 Bacteria 10454
383 Ga0501044_0035358 3300049823 Bacteria 5232
384 nmdc:mga03n38_18257_c1 3300050490 Bacteria 2766
385 nmdc:mga0yw44_11026_c1 3300050492 Bacteria 4642
386 nmdc:mga05p37_278887_c1 3300050507 Bacteria 1994
387 nmdc:mga05p37_698034_c1 3300050507 Bacteria 1128
388 nmdc:mga09592_220380_c1 3300050508 Bacteria 1644
389 nmdc:mga09592_353828_c1 3300050508 Bacteria 1271
390 nmdc:mga0qj67_59341_c1 3300050509 Bacteria 3034
391 nmdc:mga06r32_264787_c1 3300050510 Bacteria 1706
392 nmdc:mga06r32_44307_c1 3300050510 Bacteria 4237
393 nmdc:mga08y16_19365_c1 3300050511 Bacteria 7174
394 nmdc:mga08y16_225210_c1 3300050511 Bacteria 1940
395 nmdc:mga08y16_592760_c1 3300050511 Bacteria 1118
396 nmdc:mga08y16_597472_c1 3300050511 Bacteria 1113
397 nmdc:mga08y16_622498_c1 3300050511 Bacteria 1086
398 nmdc:mga0n895_342408_c1 3300050512 Bacteria 1514
399 nmdc:mga0a205_121723_c1 3300050515 Bacteria 2508
400 Ga0495655_0013424 3300053083 Bacteria 1694
401 Ga0500556_0001333 3300053104 Bacteria 10926
402 Ga0500616_0005943 3300053153 Bacteria 8147
403 Ga0501082_0184027 3300060353 Bacteria 1817
404 Ga0075428_100038959
405 Ga0070683_100011373
406 Ga0070683_100072591
407 Ga0070690_100122980
408 Ga0070690_100509548
409 Ga0070670_100131952
410 Ga0070670_100219502
411 Ga0068869_100210563
412 Ga0070682_100002376
413 Ga0070682_100186686
414 Ga0068868_100006416
415 Ga0068868_100208842
416 Ga0068868_100543731
417 Ga0070660_100005049
418 Ga0070660_100263048
419 Ga0070689_100056882
420 Ga0070691_10058619
421 Ga0070687_100337915
422 Ga0070687_100376372
423 Ga0070661_100025720
424 Ga0070661_100161131
425 Ga0070668_100111672
426 Ga0070669_100087069
427 Ga0070675_100017193
428 Ga0070675_100088699
429 Ga0070671_100065570
430 Ga0070674_100103138
431 Ga0070674_100381338
432 Ga0070673_100015704
433 Ga0070688_100136081
434 Ga0070659_100025561
435 Ga0070659_100138793
436 Ga0070659_100279064
437 Ga0070659_100300587
438 Ga0070667_100345238
439 Ga0070714_101222751
440 Ga0070710_10031587
441 Ga0070701_10409056
442 Ga0070711_100754041
443 Ga0070705_100158383
444 Ga0070700_100002373
445 Ga0070700_100006964
446 Ga0070700_100330864
447 Ga0070694_100162298
448 Ga0070694_100859825
449 Ga0070678_100112465
450 Ga0070662_100016739
451 Ga0070662_100052889
452 Ga0070681_10225685
453 Ga0070685_10022328
454 Ga0070684_100007514
455 Ga0070684_100020850
456 Ga0070684_100318033
457 Ga0068853_100075967
458 Ga0070672_100154046
459 Ga0070693_100084488
460 Ga0070665_100047104
461 Ga0070704_100381694
462 Ga0070664_100013126
463 Ga0070664_100050249
464 Ga0070664_100186136
465 Ga0068854_100021099
466 Ga0068854_100044507
467 Ga0068854_100507354
468 Ga0068856_100038269
469 Ga0068856_100577265
470 Ga0070702_100059675
471 Ga0070702_100200196
472 Ga0068852_100196070
473 Ga0068859_100440220
474 Ga0068859_100575001
475 Ga0068864_100048115
476 Ga0068864_100179128
477 Ga0068866_10071310
478 Ga0068866_10194850
479 Ga0068861_100080765
480 Ga0068863_100152604
481 Ga0068858_100378168
482 Ga0068862_100213460
483 Ga0081455_10017773
484 Ga0081538_10113501
485 Ga0075365_10000831
486 Ga0075363_100013439
487 Ga0070712_100038613
488 Ga0075428_100320208
489 Ga0075431_100024906
490 Ga0075431_100589012
491 Ga0075433_10786611
492 Ga0075429_100008626
493 Ga0068865_100182423
494 Ga0068865_100253577
495 Ga0068865_100459083
496 Ga0075436_100136547
497 Ga0097620_100440210
498 Ga0097620_100574983
499 Ga0105251_10311076
500 Ga0111539_10017607
501 Ga0111539_10019823
502 Ga0111539_10216118
503 Ga0111539_10560046
504 Ga0111539_10631221
505 Ga0111539_11015574
506 Ga0105245_10004999
507 Ga0105245_10008895
508 Ga0105245_10443880
509 Ga0114129_10044517
510 Ga0114129_10499226
511 Ga0105243_10002741
512 Ga0105243_11846619
513 Ga0105242_10062243
514 Ga0105242_10526706
515 Ga0105248_10356867
516 Ga0105237_10910775
517 Ga0105238_10585468
518 Ga0105249_10276881
519 Ga0105249_10302265
520 Ga0105239_10010852
521 Ga0105239_10240416
522 Ga0105239_11590839
523 Ga0105246_10064631
524 Ga0105246_10086721
525 Ga0105246_10418121
526 Ga0157371_10110188
527 Ga0157369_10964227
528 Ga0157374_10284246
529 Ga0157378_10337727
530 Ga0163162_10380202
531 Ga0157372_10039794
532 Ga0157372_10278580
533 Ga0157375_10044027
534 Ga0157375_10426300
535 Ga0157375_10734224
536 Ga0157375_12269364
537 Ga0163163_10135575
538 Ga0163163_10472404
539 Ga0163163_11594612
540 Ga0157377_10002155
541 Ga0157377_10022649
542 Ga0157377_10125124
543 Ga0157379_10184994
544 Ga0157379_11063535
545 Ga0157376_10594977
546 Ga0206353_11433295
547 Ga0207642_10135610
548 Ga0207642_10231036
549 Ga0207710_10065617
550 Ga0207688_10000778
551 Ga0207688_10025379
552 Ga0207680_10967976
553 Ga0207643_10187468
554 Ga0207705_10072327
555 Ga0207695_10910051
556 Ga0207693_10010070
557 Ga0207663_10046696
558 Ga0207663_10191812
559 Ga0207660_10267032
560 Ga0207662_10305573
561 Ga0207657_10000816
562 Ga0207657_10266179
563 Ga0207657_10460902
564 Ga0207649_10036631
565 Ga0207649_10037930
566 Ga0207649_10385334
567 Ga0207694_10613198
568 Ga0207659_10021963
569 Ga0207659_10089006
570 Ga0207659_10239604
571 Ga0207687_10047947
572 Ga0207687_10118175
573 Ga0207687_10336762
574 Ga0207644_10127816
575 Ga0207690_10049411
576 Ga0207690_10271971
577 Ga0207690_10575885
578 Ga0207706_10006909
579 Ga0207706_10042476
580 Ga0207706_10810207
581 Ga0207686_10117668
582 Ga0207686_10201389
583 Ga0207709_10022639
584 Ga0207670_10067500
585 Ga0207670_10124144
586 Ga0207669_10006612
587 Ga0207669_10074601
588 Ga0207669_10117602
589 Ga0207704_10059876
590 Ga0207704_10232007
591 Ga0207704_10369659
592 Ga0207691_10014945
593 Ga0207691_10146358
594 Ga0207691_10234119
595 Ga0207711_10191856
596 Ga0207711_10270520
597 Ga0207689_10031485
598 Ga0207689_10104660
599 Ga0207661_10021381
600 Ga0207661_10198352
601 Ga0207661_10351443
602 Ga0207679_10023432
603 Ga0207679_10099667
604 Ga0207679_10178973
605 Ga0207651_10469346
606 Ga0207712_10071440
607 Ga0207668_10135738
608 Ga0207668_10172111
609 Ga0207668_10430928
610 Ga0207668_10743196
611 Ga0207640_10484961
612 Ga0207640_10689325
613 Ga0207658_10106951
614 Ga0207658_11105413
615 Ga0207677_10044545
616 Ga0207677_10097155
617 Ga0207677_10116129
618 Ga0207677_10183293
619 Ga0207677_10619267
620 Ga0207703_10106393
621 Ga0207703_10134898
622 Ga0207678_10011857
623 Ga0207678_10078684
624 Ga0207678_10095321
625 Ga0207678_10302284
626 Ga0207708_10000779
627 Ga0207708_10005182
628 Ga0207708_10007220
629 Ga0207641_10631028
630 Ga0207641_11421991
631 Ga0207648_10055056
632 Ga0207648_10333703
633 Ga0207676_10076283
634 Ga0207676_10079168
635 Ga0207676_10177390
636 Ga0207674_10058280
637 Ga0207674_10076299
638 Ga0207675_100046839
639 Ga0207675_100065908
640 Ga0207675_100563992
641 Ga0207683_10020927
642 Ga0207683_10120063
643 Ga0207683_10341179
644 Ga0207698_10069183
645 Ga0207698_10076949
646 Ga0207428_10425829
647 Ga0268266_10027465
648 Ga0268266_10115648
649 Ga0268266_10181424
650 Ga0268265_10512376
651 Ga0268265_11301294
652 Ga0268264_10488551
653 Ga0268264_10946327
654 Ga0265319_1000005
655 Ga0265320_10099552
656 Ga0265327_10013637
657 Ga0307408_100165612
658 Ga0307405_10229781
659 Ga0307405_10355955
660 Ga0307405_10921387
661 Ga0307413_10498023
662 Ga0307410_10292630
663 Ga0307407_10117017
664 Ga0307409_100073425
665 Ga0307416_100093631
666 Ga0307416_100724669
667 Ga0307414_10119701
668 Ga0307411_10047827
669 Ga0307411_10064428
670 Ga0307415_100270471
671 Ga0307415_100367306
672 Ga0373947_0179494
673 Ga0395900_0231920
674 Ga0395898_0337878
675 Ga0395898_0433580
676 Ga0395901_0122748
677 Ga0395901_0995266
678 Ga0451791_0232791
679 Ga0451802_2001490
680 Ga0466961_0043016
681 Ga0466957_0088205
682 Ga0466957_0090937
683 Ga0466960_0000491
684 Ga0466960_0003151
685 Ga0466960_0024474
686 Ga0466960_0027424
687 Ga0466960_0042956
688 Ga0466960_0053007
689 Ga0466960_0122928
690 Ga0466960_0672694
691 Ga0466967_0003470
692 Ga0466967_0038543
693 Ga0466967_0204429
694 Ga0466967_0264894
695 Ga0466967_0337385
696 Ga0466967_0438285
697 Ga0495603_0094954
698 Ga0495641_0083008
699 Ga0495643_0205241
700 Ga0495586_0467510
701 Ga0495676_0131625
702 Ga0496100_0021292
703 Ga0496100_0139813
704 Ga0496101_0058313
705 Ga0496101_0219840
706 Ga0496101_0883633
707 Ga0496102_0013958
708 Ga0496102_0075458
709 Ga0496103_0135992
710 Ga0496104_0154245
711 Ga0496104_0164341
712 Ga0496104_0207288
713 Ga0496105_0030421
714 Ga0496105_0222754
715 Ga0496105_0990064
716 Ga0496106_0019282
717 Ga0496106_0043344
718 Ga0496106_0068014
719 Ga0496106_0490949
720 Ga0496107_0012239
721 Ga0496107_0386195
722 Ga0496108_0085891
723 Ga0496108_0212340
724 Ga0496108_0417026
725 Ga0496108_0584464
726 Ga0496109_0019272
727 Ga0496109_0021840
728 Ga0496109_0052722
729 Ga0496109_0095387
730 Ga0496109_0152827
731 Ga0496110_0017360
732 Ga0496110_0085299
733 Ga0496110_0231328
734 Ga0496110_0998122
735 Ga0496111_0026466
736 Ga0496111_0096607
737 Ga0496112_0007185
738 Ga0496112_0007790
739 Ga0496112_0094131
740 Ga0496112_0175416
741 Ga0496114_0088118
742 Ga0496114_0360878
743 Ga0496114_0444447
744 Ga0496115_0105263
745 Ga0496115_0118960
746 Ga0501031_0042396
747 Ga0501031_0120640
748 Ga0501031_0656883
749 Ga0501033_0114878
750 Ga0501034_0735822
751 Ga0501036_0043091
752 Ga0501037_0042343
753 Ga0501038_0043019
754 Ga0501039_0045898
755 Ga0501039_0716032
756 Ga0501040_0682318
757 Ga0501042_0418643
758 Ga0501042_0554107
759 Ga0501046_0008737
760 Ga0501047_0422866
761 Ga0501048_0041630
762 Ga0501048_0516348
763 Ga0501048_0827727
764 Ga0501067_0179990
765 Ga0501068_0238348
766 Ga0501068_0285040
767 Ga0501069_0035977
768 Ga0501070_0408489
769 Ga0501070_0751151
770 Ga0501070_0799003
771 Ga0501071_0278125
772 Ga0501072_0170120
773 Ga0501073_0028662
774 Ga0501074_0027001
775 Ga0501074_0138187
776 Ga0501074_0292629
777 Ga0501075_0368573
778 Ga0501076_0185394
779 Ga0501077_0191110
780 Ga0501079_0029742
781 Ga0501079_0490493
782 Ga0501080_0013443
783 Ga0501080_0020493
784 Ga0501083_0052390
785 Ga0501035_0007123
786 Ga0501044_0035358
787 nmdc:mga03n38_18257_c1
788 nmdc:mga0yw44_11026_c1
789 nmdc:mga05p37_278887_c1
790 nmdc:mga05p37_698034_c1
791 nmdc:mga09592_220380_c1
792 nmdc:mga09592_353828_c1
793 nmdc:mga0qj67_59341_c1
794 nmdc:mga06r32_264787_c1
795 nmdc:mga06r32_44307_c1
796 nmdc:mga08y16_19365_c1
797 nmdc:mga08y16_225210_c1
798 nmdc:mga08y16_592760_c1
799 nmdc:mga08y16_597472_c1
800 nmdc:mga08y16_622498_c1
801 nmdc:mga0n895_342408_c1
802 nmdc:mga0a205_121723_c1
803 Ga0495655_0013424
804 Ga0500556_0001333
805 Ga0500616_0005943
806 Ga0501082_0184027

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00117

GATase

Glutamine amidotransferase class-I

4

187

0.94

PF07722

Peptidase_C26

Peptidase C26

24

169

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qur-assembly1.cif.gz_A mapping the allosteric communication network of aminodeoxychorismate synthase 0.9112 3 191
8hx6-assembly1.cif.gz_A crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae 0.9087 1 184
1wl8-assembly1.cif.gz_A crystal structure of ph1346 protein from pyrococcus horikoshii 0.9079 1 185
1qdl-assembly1.cif.gz_B-2 the crystal structure of anthranilate synthase from sulfolobus solfataricus 0.9053 2 188
2d7j-assembly1.cif.gz_A crystal structure analysis of glutamine amidotransferase from pyrococcus horikoshii ot3 0.9039 3 185
ID Description Score Start End Superfamily
af_P00903_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9421 3 187 3.40.50.880
af_K7L2D7_74_267_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9357 1 187 3.40.50.880
af_Q2G099_1_189_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9335 3 186 3.40.50.880
af_P00903_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9275 3 187 3.40.50.880
af_Q57690_3_195_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.92 2 187 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A533RQB3-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.9745 3 167 GO:0000162
GO:0004049
GO:0005829
AF-A0A7V9J8A7-F1-model_v4 Gamma-glutamyl-gamma-aminobutyrate hydrolase family protein 0.9697 2 112 GO:0000162
GO:0004049
GO:0005829
GO:0016787
AF-A0A1D1ZU99-F1-model_v4 anthranilate synthase (EC 4.1.3.27) 0.9693 2 171 GO:0000162
GO:0004049
GO:0005829
GO:0006541
AF-A0A1M3BN39-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.9687 1 186 GO:0000162
GO:0004049
GO:0005829
GO:0006541
AF-A0A2E3FFE5-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.9671 3 171 GO:0000162
GO:0004049
GO:0005829
GO:0006541

Map