F435352

General Info

Members Datasets Scaffolds Average Seq Length
403 230 403 159

Family's Representative Sequence

Representative Sequence 3300006173|Ga0070716_100042495|Ga0070716_1000424953
Length 168
Sequence MQRDNCERRLAPRWLMLDDGIQYPESNFKQPNAARKNAQMKGAAAFALYEVLLGVTIFVIGVLALGRSVQNCLNASALSAEEDRVRQILANRMAEIQATPGPPDPTKQFTIDTGYGPVKLLQKTVPAQLTEADGTDLIGVRVVTLTAQWTRGGSKQSRSLEFYVYRAG

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
82 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
106 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
159 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
170 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
171 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
172 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
173 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
174 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
180 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
181 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
182 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
183 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
184 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
185 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
188 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
189 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
190 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
191 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
192 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
193 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
194 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
195 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
196 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
197 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
198 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
199 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
200 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
203 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
206 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
207 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
208 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
226 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
227 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
230 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 7.44
Rhizosphere 91.56
Stem 0
Stem Tuber 0
Unclassified 0.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10044386 3300001979 Bacteria 1319
2 JGI24737J22298_10077988 3300001990 Bacteria 987
3 JGI24035J26624_1016423 3300002126 Bacteria 762
4 JGI25406J46586_10000007 3300003203 Bacteria 112227
5 JGI25405J52794_10026340 3300003911 Bacteria 1194
6 Ga0065714_10087437 3300005288 Bacteria 2058
7 Ga0065714_10162582 3300005288 Bacteria 1044
8 Ga0065704_10005941 3300005289 Archaea 3069
9 Ga0065704_10090082 3300005289 Unclassified 2813
10 Ga0065704_10386652 3300005289 Unclassified 760
11 Ga0065712_10000743 3300005290 Bacteria 8391
12 Ga0065712_10002353 3300005290 Bacteria 7377
13 Ga0065712_10003030 3300005290 Bacteria 7040
14 Ga0065712_10096943 3300005290 Bacteria 2157
15 Ga0065715_10000207 3300005293 Bacteria 34609
16 Ga0065715_10000498 3300005293 Bacteria 12786
17 Ga0065715_10001221 3300005293 Bacteria 10495
18 Ga0065715_10013197 3300005293 Bacteria 2313
19 Ga0065715_10103982 3300005293 Bacteria 2989
20 Ga0065715_10182609 3300005293 Unclassified 1466
21 Ga0065707_10020793 3300005295 Bacteria 2282
22 Ga0065707_10119762 3300005295 Bacteria 2151
23 Ga0070676_10482707 3300005328 Bacteria 877
24 Ga0070683_100001160 3300005329 Bacteria 19949
25 Ga0070683_100042303 3300005329 Bacteria 4195
26 Ga0070683_100099306 3300005329 Bacteria 2740
27 Ga0070683_100357635 3300005329 Bacteria 1391
28 Ga0070690_100073475 3300005330 Bacteria 2225
29 Ga0070690_100143078 3300005330 Bacteria 1625
30 Ga0070670_100225631 3300005331 Bacteria 1630
31 Ga0070666_10115268 3300005335 Bacteria 1861
32 Ga0070680_100224941 3300005336 Bacteria 1584
33 Ga0070682_101376899 3300005337 Bacteria 602
34 Ga0068868_100101705 3300005338 Bacteria 2326
35 Ga0068868_100349071 3300005338 Unclassified 1267
36 Ga0070660_100758572 3300005339 Bacteria 815
37 Ga0070689_100165638 3300005340 Bacteria 1789
38 Ga0070687_100008262 3300005343 Unclassified 4399
39 Ga0070661_100015362 3300005344 Bacteria 5404
40 Ga0070661_100077487 3300005344 Bacteria 2451
41 Ga0070692_10196918 3300005345 Bacteria 1178
42 Ga0070668_100081982 3300005347 Bacteria 2529
43 Ga0070669_100412766 3300005353 Bacteria 1107
44 Ga0070675_100037728 3300005354 Bacteria 3938
45 Ga0070675_100307055 3300005354 Unclassified 1399
46 Ga0070675_101982509 3300005354 Unclassified 537
47 Ga0070671_100054761 3300005355 Bacteria 3317
48 Ga0070671_100080611 3300005355 Bacteria 2722
49 Ga0070671_101575751 3300005355 Unclassified 582
50 Ga0070674_100686984 3300005356 Bacteria 874
51 Ga0070673_100034250 3300005364 Bacteria 3841
52 Ga0070673_100140336 3300005364 Bacteria 2037
53 Ga0070688_100003944 3300005365 Bacteria 7694
54 Ga0070688_100156486 3300005365 Bacteria 1562
55 Ga0070659_100077473 3300005366 Bacteria 2652
56 Ga0070659_100784550 3300005366 Bacteria 828
57 Ga0070709_10021283 3300005434 Bacteria 3775
58 Ga0070714_100046211 3300005435 Bacteria 3692
59 Ga0070714_100060349 3300005435 Bacteria 3254
60 Ga0070714_100740358 3300005435 Bacteria 950
61 Ga0070713_100102069 3300005436 Bacteria 2486
62 Ga0070713_100468879 3300005436 Unclassified 1185
63 Ga0070713_100973462 3300005436 Unclassified 818
64 Ga0070710_10063452 3300005437 Bacteria 2110
65 Ga0070710_10175046 3300005437 Unclassified 1340
66 Ga0070711_100054248 3300005439 Bacteria 2765
67 Ga0070711_100084863 3300005439 Bacteria 2266
68 Ga0070711_100221310 3300005439 Unclassified 1471
69 Ga0070711_100574878 3300005439 Bacteria 937
70 Ga0070705_100030938 3300005440 Bacteria 2959
71 Ga0070705_100264995 3300005440 Bacteria 1214
72 Ga0070705_100279084 3300005440 Unclassified 1187
73 Ga0070705_100332104 3300005440 Bacteria 1102
74 Ga0070700_100218563 3300005441 Unclassified 1349
75 Ga0070694_100014825 3300005444 Bacteria 4883
76 Ga0070708_100072522 3300005445 Unclassified 3102
77 Ga0070708_100222076 3300005445 Bacteria 1772
78 Ga0070708_100307519 3300005445 Bacteria 1493
79 Ga0070708_100745494 3300005445 Unclassified 921
80 Ga0070708_101134639 3300005445 Archaea 732
81 Ga0070663_100066682 3300005455 Unclassified 2609
82 Ga0070678_100018503 3300005456 Bacteria 4516
83 Ga0070662_100420083 3300005457 Bacteria 1106
84 Ga0070681_10007306 3300005458 Bacteria 10783
85 Ga0070685_10087111 3300005466 Unclassified 1884
86 Ga0070685_10106826 3300005466 Bacteria 1718
87 Ga0070706_100000339 3300005467 Bacteria 56563
88 Ga0070706_100024434 3300005467 Bacteria 5563
89 Ga0070706_100058536 3300005467 Bacteria 3555
90 Ga0070706_100218255 3300005467 Bacteria 1780
91 Ga0070707_100002484 3300005468 Bacteria 17582
92 Ga0070707_100011119 3300005468 Bacteria 8385
93 Ga0070707_100396072 3300005468 Bacteria 1341
94 Ga0070707_101340515 3300005468 Unclassified 682
95 Ga0070698_100009148 3300005471 Bacteria 10632
96 Ga0070698_100560040 3300005471 Unclassified 1083
97 Ga0070698_100731409 3300005471 Bacteria 932
98 Ga0070699_100170922 3300005518 Unclassified 1926
99 Ga0070699_100228330 3300005518 Bacteria 1660
100 Ga0070679_100076366 3300005530 Bacteria 3340
101 Ga0070684_100000906 3300005535 Bacteria 20999
102 Ga0070684_100022922 3300005535 Bacteria 5214
103 Ga0070697_100006683 3300005536 Bacteria 8947
104 Ga0070697_100009911 3300005536 Bacteria 7431
105 Ga0070697_100102474 3300005536 Bacteria 2378
106 Ga0070697_100108682 3300005536 Bacteria 2309
107 Ga0070697_100147501 3300005536 Archaea 1981
108 Ga0070697_100337685 3300005536 Bacteria 1300
109 Ga0070697_100364457 3300005536 Unclassified 1249
110 Ga0070697_100748175 3300005536 Unclassified 864
111 Ga0070697_100997009 3300005536 Unclassified 744
112 Ga0070697_101249257 3300005536 Unclassified 662
113 Ga0070697_101267076 3300005536 Unclassified 657
114 Ga0070672_100392265 3300005543 Bacteria 1189
115 Ga0070672_100515044 3300005543 Bacteria 1036
116 Ga0070686_100199584 3300005544 Bacteria 1433
117 Ga0070686_100406710 3300005544 Unclassified 1036
118 Ga0070695_100122790 3300005545 Bacteria 1779
119 Ga0070696_100883557 3300005546 Bacteria 740
120 Ga0070693_100264154 3300005547 Bacteria 1146
121 Ga0070665_100009195 3300005548 Bacteria 10008
122 Ga0070665_100033252 3300005548 Bacteria 5189
123 Ga0070665_100427934 3300005548 Bacteria 1333
124 Ga0070665_100611713 3300005548 Unclassified 1103
125 Ga0070665_100727297 3300005548 Unclassified 1006
126 Ga0070664_100048790 3300005564 Bacteria 3579
127 Ga0070664_100230805 3300005564 Unclassified 1659
128 Ga0070664_100391119 3300005564 Unclassified 1270
129 Ga0070664_100486864 3300005564 Unclassified 1136
130 Ga0068857_100370096 3300005577 Bacteria 1329
131 Ga0068856_100071281 3300005614 Bacteria 3440
132 Ga0070702_100562797 3300005615 Unclassified 848
133 Ga0068852_100934270 3300005616 Bacteria 885
134 Ga0068859_100045431 3300005617 Bacteria 4413
135 Ga0068864_100348513 3300005618 Bacteria 1396
136 Ga0068863_100014811 3300005841 Bacteria 7496
137 Ga0068863_100170893 3300005841 Bacteria 2085
138 Ga0068863_100493051 3300005841 Bacteria 1206
139 Ga0068858_100062936 3300005842 Unclassified 3432
140 Ga0068860_100012546 3300005843 Bacteria 8343
141 Ga0081455_10008112 3300005937 Bacteria 10961
142 Ga0081455_10015384 3300005937 Bacteria 7437
143 Ga0081455_10149334 3300005937 Unclassified 1804
144 Ga0081455_10324941 3300005937 Bacteria 1094
145 Ga0081540_1034410 3300005983 Bacteria 2733
146 Ga0081539_10018351 3300005985 Unclassified 4860
147 Ga0081539_10124217 3300005985 Bacteria 1277
148 Ga0070717_10002989 3300006028 Bacteria 12038
149 Ga0070717_10005420 3300006028 Bacteria 9316
150 Ga0070717_10007985 3300006028 Bacteria 7882
151 Ga0070717_10440747 3300006028 Bacteria 1173
152 Ga0070717_11628631 3300006028 Unclassified 585
153 Ga0070715_10030900 3300006163 Bacteria 2170
154 Ga0070716_100009952 3300006173 Bacteria 4755
155 Ga0070716_100042495 3300006173 Bacteria 2538
156 Ga0070716_100194419 3300006173 Unclassified 1343
157 Ga0070712_100091054 3300006175 Unclassified 2234
158 Ga0070712_100451505 3300006175 Unclassified 1070
159 Ga0070712_100527677 3300006175 Bacteria 992
160 Ga0097621_100007456 3300006237 Bacteria 7824
161 Ga0097621_100300909 3300006237 Bacteria 1417
162 Ga0068871_100087696 3300006358 Bacteria 2588
163 Ga0075428_100469676 3300006844 Bacteria 1347
164 Ga0068865_100542291 3300006881 Unclassified 976
165 Ga0097620_100045431 3300006931 Bacteria 4413
166 Ga0099794_10016746 3300007265 Bacteria 3255
167 Ga0099794_10363287 3300007265 Bacteria 754
168 Ga0099795_10013639 3300007788 Unclassified 2499
169 Ga0105245_10693640 3300009098 Bacteria 1051
170 Ga0105245_11442154 3300009098 Unclassified 739
171 Ga0105247_10158430 3300009101 Bacteria 1497
172 Ga0114129_10152218 3300009147 Bacteria 3165
173 Ga0105242_10181906 3300009176 Bacteria 1855
174 Ga0105242_11163927 3300009176 Bacteria 789
175 Ga0105248_10120157 3300009177 Bacteria 2964
176 Ga0105237_10361322 3300009545 Bacteria 1456
177 Ga0105249_10044041 3300009553 Bacteria 4059
178 Ga0105249_10632126 3300009553 Bacteria 1127
179 Ga0099796_10142143 3300010159 Unclassified 939
180 Ga0105239_10176563 3300010375 Bacteria 2389
181 Ga0105239_10295888 3300010375 Bacteria 1823
182 Ga0105239_10748994 3300010375 Bacteria 1118
183 Ga0105246_10081459 3300011119 Bacteria 2307
184 Ga0157371_10057249 3300013102 Bacteria 2764
185 Ga0157370_11193063 3300013104 Bacteria 687
186 Ga0157369_10029470 3300013105 Bacteria 6064
187 Ga0157374_10051482 3300013296 Bacteria 3832
188 Ga0157374_10231992 3300013296 Bacteria 1813
189 Ga0157374_10415588 3300013296 Bacteria 1343
190 Ga0157374_10574872 3300013296 Unclassified 1136
191 Ga0157374_10799955 3300013296 Unclassified 959
192 Ga0157378_10094767 3300013297 Unclassified 2718
193 Ga0157378_10339142 3300013297 Bacteria 1465
194 Ga0157378_10489151 3300013297 Bacteria 1227
195 Ga0163162_10141092 3300013306 Bacteria 2523
196 Ga0163162_10388665 3300013306 Unclassified 1528
197 Ga0157375_10011525 3300013308 Bacteria 7806
198 Ga0157375_10018938 3300013308 Bacteria 6250
199 Ga0157375_10829395 3300013308 Unclassified 1072
200 Ga0157375_10932479 3300013308 Bacteria 1011
201 Ga0157375_10992730 3300013308 Unclassified 980
202 Ga0163163_10498797 3300014325 Unclassified 1279
203 Ga0163163_10569052 3300014325 Unclassified 1196
204 Ga0182008_10024362 3300014497 Bacteria 3082
205 Ga0157377_10093133 3300014745 Unclassified 1783
206 Ga0157377_10186565 3300014745 Bacteria 1308
207 Ga0157379_10043413 3300014968 Unclassified 4013
208 Ga0157376_10036042 3300014969 Bacteria 4004
209 Ga0157376_10158948 3300014969 Bacteria 2046
210 Ga0157376_11562527 3300014969 Unclassified 693
211 Ga0182005_1020140 3300015265 Bacteria 1837
212 Ga0207666_1001705 3300025271 Bacteria 2615
213 Ga0207673_1000263 3300025290 Bacteria 5362
214 Ga0207697_10000283 3300025315 Bacteria 28184
215 Ga0207697_10027753 3300025315 Bacteria 2314
216 Ga0207697_10066632 3300025315 Bacteria 1505
217 Ga0207697_10069289 3300025315 Bacteria 1476
218 Ga0207697_10089166 3300025315 Bacteria 1306
219 Ga0207653_10015096 3300025885 Bacteria 2424
220 Ga0207685_10098006 3300025905 Bacteria 1248
221 Ga0207685_10135499 3300025905 Bacteria 1098
222 Ga0207685_10528244 3300025905 Bacteria 625
223 Ga0207699_10240092 3300025906 Unclassified 1244
224 Ga0207645_10308159 3300025907 Bacteria 1055
225 Ga0207684_10000276 3300025910 Bacteria 75551
226 Ga0207684_10012811 3300025910 Bacteria 7266
227 Ga0207684_10182478 3300025910 Bacteria 1810
228 Ga0207684_11089450 3300025910 Unclassified 665
229 Ga0207654_10229130 3300025911 Unclassified 1236
230 Ga0207707_10013996 3300025912 Bacteria 6995
231 Ga0207671_10078645 3300025914 Unclassified 2470
232 Ga0207693_10018783 3300025915 Bacteria 5501
233 Ga0207693_10141252 3300025915 Bacteria 1893
234 Ga0207693_10240714 3300025915 Bacteria 1420
235 Ga0207693_10305774 3300025915 Bacteria 1245
236 Ga0207693_10317287 3300025915 Bacteria 1220
237 Ga0207663_10154654 3300025916 Bacteria 1612
238 Ga0207663_10232178 3300025916 Bacteria 1348
239 Ga0207663_10462119 3300025916 Bacteria 980
240 Ga0207660_10152433 3300025917 Bacteria 1777
241 Ga0207657_10185109 3300025919 Bacteria 1682
242 Ga0207652_10018051 3300025921 Bacteria 5784
243 Ga0207646_10057803 3300025922 Unclassified 3466
244 Ga0207646_10152576 3300025922 Unclassified 2083
245 Ga0207646_10962634 3300025922 Bacteria 755
246 Ga0207681_10102490 3300025923 Bacteria 2067
247 Ga0207650_10574951 3300025925 Unclassified 946
248 Ga0207659_10005770 3300025926 Bacteria 7544
249 Ga0207659_10017139 3300025926 Bacteria 4729
250 Ga0207659_10335432 3300025926 Unclassified 1251
251 Ga0207659_10614130 3300025926 Unclassified 927
252 Ga0207687_10373832 3300025927 Bacteria 1166
253 Ga0207700_10003614 3300025928 Bacteria 9012
254 Ga0207700_10173697 3300025928 Bacteria 1799
255 Ga0207700_11057421 3300025928 Unclassified 726
256 Ga0207700_11078699 3300025928 Unclassified 718
257 Ga0207664_10304549 3300025929 Bacteria 1403
258 Ga0207664_10424569 3300025929 Bacteria 1184
259 Ga0207644_10031152 3300025931 Bacteria 3714
260 Ga0207644_10468301 3300025931 Unclassified 1037
261 Ga0207690_10045520 3300025932 Bacteria 2899
262 Ga0207690_10725297 3300025932 Bacteria 818
263 Ga0207706_10109238 3300025933 Bacteria 2434
264 Ga0207706_10225435 3300025933 Unclassified 1640
265 Ga0207686_10076283 3300025934 Bacteria 2173
266 Ga0207686_10155657 3300025934 Bacteria 1596
267 Ga0207709_10222011 3300025935 Bacteria 1363
268 Ga0207670_10005975 3300025936 Bacteria 6723
269 Ga0207670_10168820 3300025936 Bacteria 1639
270 Ga0207665_10004405 3300025939 Bacteria 9357
271 Ga0207665_10075199 3300025939 Bacteria 2313
272 Ga0207665_10374186 3300025939 Bacteria 1080
273 Ga0207691_10825885 3300025940 Bacteria 778
274 Ga0207689_10105406 3300025942 Bacteria 2316
275 Ga0207661_10016865 3300025944 Bacteria 5394
276 Ga0207661_10078628 3300025944 Bacteria 2716
277 Ga0207661_10329510 3300025944 Bacteria 1374
278 Ga0207661_10331618 3300025944 Unclassified 1369
279 Ga0207679_10116654 3300025945 Bacteria 2117
280 Ga0207651_10117812 3300025960 Bacteria 2007
281 Ga0207651_10554881 3300025960 Unclassified 999
282 Ga0207712_10371239 3300025961 Bacteria 1195
283 Ga0207677_10179145 3300026023 Bacteria 1665
284 Ga0207703_10017150 3300026035 Bacteria 5648
285 Ga0207678_10018313 3300026067 Bacteria 6151
286 Ga0207708_10087970 3300026075 Bacteria 2393
287 Ga0207708_10132111 3300026075 Bacteria 1953
288 Ga0207702_10309698 3300026078 Bacteria 1501
289 Ga0207702_10754568 3300026078 Unclassified 961
290 Ga0207641_10009842 3300026088 Bacteria 7873
291 Ga0207641_10318453 3300026088 Bacteria 1474
292 Ga0207674_10659807 3300026116 Bacteria 1010
293 Ga0207675_100095589 3300026118 Unclassified 2796
294 Ga0207683_10062417 3300026121 Bacteria 3282
295 Ga0207698_11347267 3300026142 Bacteria 728
296 Ga0209974_10110634 3300027876 Unclassified 967
297 Ga0207428_10208656 3300027907 Bacteria 1468
298 Ga0268266_10360171 3300028379 Unclassified 1368
299 Ga0268266_10405232 3300028379 Bacteria 1290
300 Ga0268265_10822752 3300028380 Unclassified 907
301 Ga0268264_10009325 3300028381 Bacteria 8127
302 Ga0373923_0117904 3300035111 Bacteria 1184
303 Ga0373923_0257913 3300035111 Bacteria 817
304 Ga0373923_0344683 3300035111 Bacteria 711
305 Ga0373945_0254054 3300035116 Unclassified 743
306 Ga0373953_0110406 3300035117 Bacteria 1163
307 Ga0373943_0215971 3300035170 Bacteria 1067
308 Ga0373955_0164186 3300035172 Bacteria 1312
309 Ga0373931_0190214 3300035691 Bacteria 1221
310 Ga0373935_0102903 3300035692 Bacteria 1885
311 Ga0373927_0056961 3300035695 Bacteria 2528
312 Ga0373927_0075969 3300035695 Bacteria 2176
313 Ga0373947_0044084 3300035725 Unclassified 2665
314 Ga0373947_0160787 3300035725 Bacteria 1452
315 Ga0373947_0252296 3300035725 Bacteria 1167
316 Ga0373937_0575582 3300036401 Unclassified 1069
317 Ga0373925_0132965 3300037068 Bacteria 1941
318 Ga0373925_0208767 3300037068 Bacteria 1555
319 Ga0395901_0951339 3300038443 Bacteria 838
320 Ga0436363_1285604 3300039450 Unclassified 817
321 Ga0451839_0701758 3300041496 Unclassified 552
322 Ga0451849_0190349 3300041505 Bacteria 874
323 Ga0439455_0022226 3300042012 Bacteria 1519
324 Ga0439455_0045259 3300042012 Bacteria 1137
325 Ga0439458_0017469 3300042157 Bacteria 1639
326 Ga0466964_0050526 3300044706 Bacteria 1705
327 Ga0495603_0689353 3300046455 Unclassified 584
328 Ga0495629_0014300 3300046459 Bacteria 5711
329 Ga0495629_0275004 3300046459 Unclassified 1156
330 Ga0495641_0322853 3300046461 Unclassified 697
331 Ga0495651_0565635 3300046462 Bacteria 721
332 Ga0495662_0117782 3300046476 Bacteria 1303
333 Ga0495664_0608584 3300046477 Unclassified 649
334 Ga0495608_0620488 3300046511 Unclassified 648
335 Ga0495618_0079287 3300046514 Bacteria 2094
336 Ga0495628_0041449 3300046516 Bacteria 3675
337 Ga0495630_0102765 3300046517 Bacteria 2162
338 Ga0495666_0107968 3300046526 Unclassified 1309
339 Ga0495652_0072665 3300046529 Bacteria 2866
340 Ga0495665_0164032 3300046531 Unclassified 1158
341 Ga0495640_0137821 3300046533 Bacteria 1575
342 Ga0495586_0014764 3300046535 Unclassified 4151
343 Ga0495621_0248858 3300046539 Unclassified 726
344 Ga0495645_0038377 3300046543 Bacteria 3493
345 Ga0495667_0090383 3300046559 Bacteria 1984
346 Ga0495634_0780433 3300046642 Unclassified 546
347 Ga0495657_0162571 3300046675 Bacteria 1381
348 Ga0495613_0155920 3300046689 Bacteria 1627
349 Ga0495624_0124449 3300046690 Bacteria 1583
350 Ga0495589_0496954 3300046794 Unclassified 557
351 Ga0495600_0482521 3300046809 Bacteria 764
352 Ga0495581_0052708 3300047315 Bacteria 2350
353 Ga0495604_0073944 3300047317 Bacteria 2570
354 Ga0495604_0258325 3300047317 Unclassified 1185
355 Ga0495674_1069899 3300047319 Unclassified 615
356 Ga0495676_0228856 3300047321 Unclassified 1278
357 Ga0495680_0378578 3300047322 Unclassified 981
358 Ga0495684_0044677 3300047471 Unclassified 3391
359 Ga0495593_0128596 3300047673 Unclassified 1287
360 Ga0495602_0032574 3300048088 Bacteria 4905
361 Ga0496100_1006071 3300048903 Unclassified 656
362 Ga0496101_0288662 3300048904 Bacteria 1283
363 Ga0496102_0163065 3300048905 Bacteria 2097
364 Ga0496103_0108734 3300048906 Bacteria 1760
365 Ga0496103_0252799 3300048906 Bacteria 1134
366 Ga0496104_0300915 3300048907 Bacteria 1516
367 Ga0496104_0690496 3300048907 Unclassified 929
368 Ga0496104_1442038 3300048907 Bacteria 591
369 Ga0496105_0046748 3300048908 Bacteria 3572
370 Ga0496105_0266275 3300048908 Bacteria 1385
371 Ga0496106_0475183 3300048909 Bacteria 1004
372 Ga0496107_0090600 3300048910 Bacteria 2234
373 Ga0496107_0449958 3300048910 Bacteria 957
374 Ga0496108_0030767 3300048911 Unclassified 4448
375 Ga0496108_0061085 3300048911 Bacteria 3171
376 Ga0496108_0388529 3300048911 Unclassified 1219
377 Ga0496109_0007567 3300048912 Bacteria 9206
378 Ga0496109_0032681 3300048912 Bacteria 4679
379 Ga0496109_0709483 3300048912 Bacteria 943
380 Ga0496110_0134596 3300048913 Bacteria 2233
381 Ga0496110_1181500 3300048913 Bacteria 674
382 Ga0496112_0042548 3300048915 Bacteria 4444
383 Ga0496112_0054932 3300048915 Bacteria 3914
384 Ga0496112_0221898 3300048915 Bacteria 1846
385 Ga0496112_0257172 3300048915 Bacteria 1696
386 Ga0496112_0318935 3300048915 Bacteria 1498
387 Ga0496113_0025847 3300048916 Bacteria 4191
388 Ga0496113_0134394 3300048916 Bacteria 1943
389 Ga0496114_0036536 3300048917 Bacteria 4061
390 Ga0496115_0052267 3300048918 Bacteria 3277
391 nmdc:mga05p37_126512_c1 3300050507 Bacteria 3138
392 nmdc:mga08y16_1109609_c1 3300050511 Unclassified 766
393 nmdc:mga0n895_348828_c1 3300050512 Bacteria 1499
394 nmdc:mga0n895_539053_c1 3300050512 Unclassified 1173
395 nmdc:mga0rr50_332162_c1 3300050513 Unclassified 1276
396 nmdc:mga0rr50_929613_c1 3300050513 Bacteria 741
397 nmdc:mga08x19_81412_c1 3300050514 Unclassified 2126
398 nmdc:mga0a205_102958_c1 3300050515 Bacteria 2753
399 Ga0495601_0180453 3300053077 Bacteria 1380
400 Ga0495601_0795689 3300053077 Unclassified 600
401 Ga0495619_0209497 3300053085 Bacteria 1350
402 Ga0495619_0520337 3300053085 Unclassified 817
403 Ga0500566_0139636 3300053094 Unclassified 1287

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005467 Ga0070706_100058536 Ga0070706_1000585364 130
2 3300005468 Ga0070707_100011119 Ga0070707_1000111199 130
3 3300005471 Ga0070698_100560040 Ga0070698_1005600401 130
4 3300005518 Ga0070699_100170922 Ga0070699_1001709223 130
5 3300005536 Ga0070697_100997009 Ga0070697_1009970092 130
6 3300006028 Ga0070717_10007985 Ga0070717_100079858 130
7 3300013297 Ga0157378_10094767 Ga0157378_100947675 130
8 3300005354 Ga0070675_101982509 Ga0070675_1019825091 131
9 3300005355 Ga0070671_101575751 Ga0070671_1015757511 131
10 3300025931 Ga0207644_10468301 Ga0207644_104683012 131
11 3300046539 Ga0495621_0248858 Ga0495621_0248858_227_622 131
12 3300005467 Ga0070706_100000339 Ga0070706_10000033932 132
13 3300005467 Ga0070706_100024434 Ga0070706_1000244344 132
14 3300005467 Ga0070706_100218255 Ga0070706_1002182552 132
15 3300005468 Ga0070707_100002484 Ga0070707_1000024849 132
16 3300005471 Ga0070698_100009148 Ga0070698_10000914811 132
17 3300005536 Ga0070697_100006683 Ga0070697_1000066834 132
18 3300005536 Ga0070697_100337685 Ga0070697_1003376852 132
19 3300005536 Ga0070697_100748175 Ga0070697_1007481751 132
20 3300006028 Ga0070717_10002989 Ga0070717_1000298910 132
21 3300006028 Ga0070717_11628631 Ga0070717_116286312 132
22 3300025910 Ga0207684_10000276 Ga0207684_1000027627 132
23 3300025910 Ga0207684_10182478 Ga0207684_101824783 132
24 3300025910 Ga0207684_11089450 Ga0207684_110894501 132
25 3300025922 Ga0207646_10152576 Ga0207646_101525763 132
26 3300005445 Ga0070708_101134639 Ga0070708_1011346391 134
27 3300005536 Ga0070697_100147501 Ga0070697_1001475013 134
28 3300005536 Ga0070697_101267076 Ga0070697_1012670761 134
29 3300006175 Ga0070712_100091054 Ga0070712_1000910545 134
30 3300050514 nmdc:mga08x19_81412_c1 nmdc:mga08x19_81412_c1_1591_1995 134
31 3300007265 Ga0099794_10016746 Ga0099794_100167464 135
32 3300037068 Ga0373925_0208767 Ga0373925_0208767_983_1402 135
33 3300039450 Ga0436363_1285604 Ga0436363_1285604_303_713 135
34 3300003203 JGI25406J46586_10000007 JGI25406J46586_10000007109 138
35 3300005293 Ga0065715_10182609 Ga0065715_101826093 138
36 3300005329 Ga0070683_100001160 Ga0070683_1000011607 138
37 3300005330 Ga0070690_100073475 Ga0070690_1000734752 138
38 3300005336 Ga0070680_100224941 Ga0070680_1002249412 138
39 3300005338 Ga0068868_100349071 Ga0068868_1003490712 138
40 3300005339 Ga0070660_100758572 Ga0070660_1007585722 138
41 3300005354 Ga0070675_100037728 Ga0070675_1000377283 138
42 3300005434 Ga0070709_10021283 Ga0070709_100212834 138
43 3300005435 Ga0070714_100046211 Ga0070714_1000462114 138
44 3300005436 Ga0070713_100102069 Ga0070713_1001020692 138
45 3300005437 Ga0070710_10063452 Ga0070710_100634523 138
46 3300005439 Ga0070711_100574878 Ga0070711_1005748782 138
47 3300005440 Ga0070705_100279084 Ga0070705_1002790842 138
48 3300005445 Ga0070708_100072522 Ga0070708_1000725223 138
49 3300005468 Ga0070707_100396072 Ga0070707_1003960722 138
50 3300005543 Ga0070672_100392265 Ga0070672_1003922652 138
51 3300005543 Ga0070672_100515044 Ga0070672_1005150442 138
52 3300005544 Ga0070686_100406710 Ga0070686_1004067102 138
53 3300005548 Ga0070665_100033252 Ga0070665_1000332525 138
54 3300005564 Ga0070664_100048790 Ga0070664_1000487904 138
55 3300005614 Ga0068856_100071281 Ga0068856_1000712814 138
56 3300005616 Ga0068852_100934270 Ga0068852_1009342702 138
57 3300006028 Ga0070717_10005420 Ga0070717_100054208 138
58 3300006163 Ga0070715_10030900 Ga0070715_100309002 138
59 3300006173 Ga0070716_100009952 Ga0070716_1000099524 138
60 3300006237 Ga0097621_100007456 Ga0097621_1000074563 138
61 3300006237 Ga0097621_100300909 Ga0097621_1003009092 138
62 3300006358 Ga0068871_100087696 Ga0068871_1000876965 138
63 3300009176 Ga0105242_11163927 Ga0105242_111639271 138
64 3300010375 Ga0105239_10295888 Ga0105239_102958883 138
65 3300011119 Ga0105246_10081459 Ga0105246_100814593 138
66 3300013102 Ga0157371_10057249 Ga0157371_100572493 138
67 3300013104 Ga0157370_11193063 Ga0157370_111930631 138
68 3300013105 Ga0157369_10029470 Ga0157369_100294705 138
69 3300013296 Ga0157374_10051482 Ga0157374_100514824 138
70 3300014745 Ga0157377_10186565 Ga0157377_101865653 138
71 3300025905 Ga0207685_10135499 Ga0207685_101354992 138
72 3300025905 Ga0207685_10528244 Ga0207685_105282442 138
73 3300025912 Ga0207707_10013996 Ga0207707_100139963 138
74 3300025915 Ga0207693_10018783 Ga0207693_100187833 138
75 3300025916 Ga0207663_10462119 Ga0207663_104621192 138
76 3300025919 Ga0207657_10185109 Ga0207657_101851092 138
77 3300025921 Ga0207652_10018051 Ga0207652_100180518 138
78 3300025926 Ga0207659_10017139 Ga0207659_100171394 138
79 3300025926 Ga0207659_10614130 Ga0207659_106141302 138
80 3300025928 Ga0207700_10003614 Ga0207700_100036148 138
81 3300025929 Ga0207664_10424569 Ga0207664_104245692 138
82 3300025931 Ga0207644_10031152 Ga0207644_100311525 138
83 3300025932 Ga0207690_10725297 Ga0207690_107252972 138
84 3300025939 Ga0207665_10004405 Ga0207665_100044054 138
85 3300025939 Ga0207665_10374186 Ga0207665_103741862 138
86 3300025940 Ga0207691_10825885 Ga0207691_108258851 138
87 3300025944 Ga0207661_10016865 Ga0207661_100168652 138
88 3300025945 Ga0207679_10116654 Ga0207679_101166543 138
89 3300026078 Ga0207702_10309698 Ga0207702_103096983 138
90 3300026121 Ga0207683_10062417 Ga0207683_100624172 138
91 3300035111 Ga0373923_0117904 Ga0373923_0117904_32_448 138
92 3300042157 Ga0439458_0017469 Ga0439458_0017469_15_431 138
93 3300046477 Ga0495664_0608584 Ga0495664_0608584_42_458 138
94 3300046809 Ga0495600_0482521 Ga0495600_0482521_15_431 138
95 3300047321 Ga0495676_0228856 Ga0495676_0228856_831_1247 138
96 3300048907 Ga0496104_0300915 Ga0496104_0300915_66_482 138
97 3300048912 Ga0496109_0709483 Ga0496109_0709483_487_903 138
98 3300050511 nmdc:mga08y16_1109609_c1 nmdc:mga08y16_1109609_c1_44_460 138
99 3300005293 Ga0065715_10000207 Ga0065715_1000020724 139
100 3300007265 Ga0099794_10363287 Ga0099794_103632872 139
101 3300041496 Ga0451839_0701758 Ga0451839_0701758_13_438 139
102 3300005546 Ga0070696_100883557 Ga0070696_1008835572 140
103 3300046794 Ga0495589_0496954 Ga0495589_0496954_26_505 147
104 3300005536 Ga0070697_100364457 Ga0070697_1003644572 150
105 3300035117 Ga0373953_0110406 Ga0373953_0110406_657_1136 152
106 3300035172 Ga0373955_0164186 Ga0373955_0164186_702_1181 152
107 3300036401 Ga0373937_0575582 Ga0373937_0575582_372_851 152
108 3300046514 Ga0495618_0079287 Ga0495618_0079287_591_1070 152
109 3300046516 Ga0495628_0041449 Ga0495628_0041449_2576_3055 152
110 3300046535 Ga0495586_0014764 Ga0495586_0014764_538_1017 152
111 3300046543 Ga0495645_0038377 Ga0495645_0038377_2598_3077 152
112 3300046559 Ga0495667_0090383 Ga0495667_0090383_1095_1574 152
113 3300046675 Ga0495657_0162571 Ga0495657_0162571_691_1170 152
114 3300047317 Ga0495604_0073944 Ga0495604_0073944_1261_1740 152
115 3300048088 Ga0495602_0032574 Ga0495602_0032574_1285_1764 152
116 3300053077 Ga0495601_0180453 Ga0495601_0180453_446_925 152
117 3300005289 Ga0065704_10386652 Ga0065704_103866521 154
118 3300005536 Ga0070697_100009911 Ga0070697_1000099119 154
119 3300025922 Ga0207646_10962634 Ga0207646_109626342 154
120 3300005440 Ga0070705_100264995 Ga0070705_1002649952 156
121 3300005518 Ga0070699_100228330 Ga0070699_1002283301 156
122 3300009177 Ga0105248_10120157 Ga0105248_101201573 156
123 3300005445 Ga0070708_100222076 Ga0070708_1002220763 157
124 3300005536 Ga0070697_101249257 Ga0070697_1012492571 157
125 3300014745 Ga0157377_10093133 Ga0157377_100931333 157
126 3300005436 Ga0070713_100973462 Ga0070713_1009734621 158
127 3300005437 Ga0070710_10175046 Ga0070710_101750462 158
128 3300025905 Ga0207685_10098006 Ga0207685_100980062 158
129 3300025906 Ga0207699_10240092 Ga0207699_102400922 158
130 3300025916 Ga0207663_10154654 Ga0207663_101546543 158
131 3300025928 Ga0207700_11078699 Ga0207700_110786992 158
132 3300005289 Ga0065704_10005941 Ga0065704_100059413 159
133 3300005328 Ga0070676_10482707 Ga0070676_104827072 159
134 3300005343 Ga0070687_100008262 Ga0070687_1000082622 159
135 3300005356 Ga0070674_100686984 Ga0070674_1006869841 159
136 3300005435 Ga0070714_100740358 Ga0070714_1007403582 159
137 3300005436 Ga0070713_100468879 Ga0070713_1004688792 159
138 3300005439 Ga0070711_100054248 Ga0070711_1000542483 159
139 3300005439 Ga0070711_100084863 Ga0070711_1000848633 159
140 3300005445 Ga0070708_100307519 Ga0070708_1003075192 159
141 3300005468 Ga0070707_101340515 Ga0070707_1013405151 159
142 3300005536 Ga0070697_100102474 Ga0070697_1001024743 159
143 3300005536 Ga0070697_100108682 Ga0070697_1001086821 159
144 3300005548 Ga0070665_100611713 Ga0070665_1006117132 159
145 3300005937 Ga0081455_10008112 Ga0081455_100081129 159
146 3300005937 Ga0081455_10015384 Ga0081455_100153848 159
147 3300005937 Ga0081455_10149334 Ga0081455_101493343 159
148 3300005937 Ga0081455_10324941 Ga0081455_103249412 159
149 3300006028 Ga0070717_10440747 Ga0070717_104407471 159
150 3300006175 Ga0070712_100451505 Ga0070712_1004515052 159
151 3300006881 Ga0068865_100542291 Ga0068865_1005422912 159
152 3300010159 Ga0099796_10142143 Ga0099796_101421431 159
153 3300025271 Ga0207666_1001705 Ga0207666_10017053 159
154 3300025315 Ga0207697_10066632 Ga0207697_100666322 159
155 3300025315 Ga0207697_10069289 Ga0207697_100692893 159
156 3300025907 Ga0207645_10308159 Ga0207645_103081592 159
157 3300025915 Ga0207693_10141252 Ga0207693_101412523 159
158 3300025915 Ga0207693_10240714 Ga0207693_102407141 159
159 3300025915 Ga0207693_10305774 Ga0207693_103057741 159
160 3300025916 Ga0207663_10232178 Ga0207663_102321782 159
161 3300025923 Ga0207681_10102490 Ga0207681_101024903 159
162 3300025927 Ga0207687_10373832 Ga0207687_103738323 159
163 3300025928 Ga0207700_11057421 Ga0207700_110574212 159
164 3300025929 Ga0207664_10304549 Ga0207664_103045492 159
165 3300025933 Ga0207706_10225435 Ga0207706_102254352 159
166 3300025935 Ga0207709_10222011 Ga0207709_102220112 159
167 3300025961 Ga0207712_10371239 Ga0207712_103712392 159
168 3300026088 Ga0207641_10318453 Ga0207641_103184533 159
169 3300026118 Ga0207675_100095589 Ga0207675_1000955891 159
170 3300027876 Ga0209974_10110634 Ga0209974_101106342 159
171 3300028380 Ga0268265_10822752 Ga0268265_108227521 159
172 3300035116 Ga0373945_0254054 Ga0373945_0254054_206_685 159
173 3300035692 Ga0373935_0102903 Ga0373935_0102903_956_1435 159
174 3300035695 Ga0373927_0056961 Ga0373927_0056961_1433_1912 159
175 3300035695 Ga0373927_0075969 Ga0373927_0075969_1147_1626 159
176 3300035725 Ga0373947_0044084 Ga0373947_0044084_303_782 159
177 3300037068 Ga0373925_0132965 Ga0373925_0132965_1407_1886 159
178 3300042012 Ga0439455_0022226 Ga0439455_0022226_986_1465 159
179 3300046459 Ga0495629_0014300 Ga0495629_0014300_3837_4316 159
180 3300046459 Ga0495629_0275004 Ga0495629_0275004_46_525 159
181 3300046462 Ga0495651_0565635 Ga0495651_0565635_229_708 159
182 3300046476 Ga0495662_0117782 Ga0495662_0117782_626_1105 159
183 3300046517 Ga0495630_0102765 Ga0495630_0102765_1225_1704 159
184 3300046526 Ga0495666_0107968 Ga0495666_0107968_439_918 159
185 3300046531 Ga0495665_0164032 Ga0495665_0164032_396_875 159
186 3300046533 Ga0495640_0137821 Ga0495640_0137821_902_1381 159
187 3300046689 Ga0495613_0155920 Ga0495613_0155920_68_547 159
188 3300046690 Ga0495624_0124449 Ga0495624_0124449_730_1209 159
189 3300047315 Ga0495581_0052708 Ga0495581_0052708_1291_1770 159
190 3300047319 Ga0495674_1069899 Ga0495674_1069899_46_525 159
191 3300047471 Ga0495684_0044677 Ga0495684_0044677_2444_2923 159
192 3300047673 Ga0495593_0128596 Ga0495593_0128596_425_904 159
193 3300048907 Ga0496104_0690496 Ga0496104_0690496_11_490 159
194 3300048915 Ga0496112_0318935 Ga0496112_0318935_91_570 159
195 3300053077 Ga0495601_0795689 Ga0495601_0795689_82_561 159
196 3300053085 Ga0495619_0520337 Ga0495619_0520337_279_758 159
197 3300053094 Ga0500566_0139636 Ga0500566_0139636_615_1094 159
198 3300005983 Ga0081540_1034410 Ga0081540_10344103 161
199 3300006173 Ga0070716_100042495 Ga0070716_1000424953 162
200 3300025910 Ga0207684_10012811 Ga0207684_100128113 162
201 3300025922 Ga0207646_10057803 Ga0207646_100578032 162
202 3300025939 Ga0207665_10075199 Ga0207665_100751993 162
203 3300025915 Ga0207693_10317287 Ga0207693_103172872 164
204 3300047322 Ga0495680_0378578 Ga0495680_0378578_154_669 164
205 3300005295 Ga0065707_10020793 Ga0065707_100207932 165
206 3300005435 Ga0070714_100060349 Ga0070714_1000603494 165
207 3300005445 Ga0070708_100745494 Ga0070708_1007454942 168
208 3300035111 Ga0373923_0257913 Ga0373923_0257913_118_633 168
209 3300001990 JGI24737J22298_10077988 JGI24737J22298_100779882 169
210 3300002126 JGI24035J26624_1016423 JGI24035J26624_10164232 169
211 3300005289 Ga0065704_10090082 Ga0065704_100900822 169
212 3300005329 Ga0070683_100099306 Ga0070683_1000993061 169
213 3300005344 Ga0070661_100077487 Ga0070661_1000774873 169
214 3300005347 Ga0070668_100081982 Ga0070668_1000819823 169
215 3300005440 Ga0070705_100030938 Ga0070705_1000309384 169
216 3300005441 Ga0070700_100218563 Ga0070700_1002185632 169
217 3300005444 Ga0070694_100014825 Ga0070694_1000148255 169
218 3300005535 Ga0070684_100000906 Ga0070684_1000009066 169
219 3300005545 Ga0070695_100122790 Ga0070695_1001227903 169
220 3300005564 Ga0070664_100230805 Ga0070664_1002308052 169
221 3300005617 Ga0068859_100045431 Ga0068859_1000454312 169
222 3300005618 Ga0068864_100348513 Ga0068864_1003485133 169
223 3300005841 Ga0068863_100014811 Ga0068863_1000148113 169
224 3300005842 Ga0068858_100062936 Ga0068858_1000629362 169
225 3300005843 Ga0068860_100012546 Ga0068860_1000125468 169
226 3300005985 Ga0081539_10018351 Ga0081539_100183512 169
227 3300006931 Ga0097620_100045431 Ga0097620_1000454312 169
228 3300009098 Ga0105245_10693640 Ga0105245_106936402 169
229 3300009545 Ga0105237_10361322 Ga0105237_103613223 169
230 3300013308 Ga0157375_10011525 Ga0157375_100115255 169
231 3300014968 Ga0157379_10043413 Ga0157379_100434135 169
232 3300025290 Ga0207673_1000263 Ga0207673_10002636 169
233 3300025315 Ga0207697_10000283 Ga0207697_100002838 169
234 3300025885 Ga0207653_10015096 Ga0207653_100150963 169
235 3300025914 Ga0207671_10078645 Ga0207671_100786452 169
236 3300025926 Ga0207659_10005770 Ga0207659_100057704 169
237 3300025932 Ga0207690_10045520 Ga0207690_100455205 169
238 3300025933 Ga0207706_10109238 Ga0207706_101092383 169
239 3300025936 Ga0207670_10005975 Ga0207670_100059756 169
240 3300025942 Ga0207689_10105406 Ga0207689_101054061 169
241 3300025944 Ga0207661_10078628 Ga0207661_100786282 169
242 3300026035 Ga0207703_10017150 Ga0207703_100171504 169
243 3300026088 Ga0207641_10009842 Ga0207641_100098424 169
244 3300028381 Ga0268264_10009325 Ga0268264_100093258 169
245 3300048906 Ga0496103_0252799 Ga0496103_0252799_30_539 169
246 3300048909 Ga0496106_0475183 Ga0496106_0475183_347_856 169
247 3300048910 Ga0496107_0090600 Ga0496107_0090600_680_1189 169
248 3300014497 Ga0182008_10024362 Ga0182008_100243623 170
249 3300015265 Ga0182005_1020140 Ga0182005_10201403 170
250 3300044706 Ga0466964_0050526 Ga0466964_0050526_751_1263 170
251 3300001979 JGI24740J21852_10044386 JGI24740J21852_100443861 171
252 3300003911 JGI25405J52794_10026340 JGI25405J52794_100263401 171
253 3300005288 Ga0065714_10087437 Ga0065714_100874374 171
254 3300005288 Ga0065714_10162582 Ga0065714_101625822 171
255 3300005290 Ga0065712_10000743 Ga0065712_100007434 171
256 3300005290 Ga0065712_10002353 Ga0065712_100023533 171
257 3300005290 Ga0065712_10003030 Ga0065712_100030304 171
258 3300005290 Ga0065712_10096943 Ga0065712_100969432 171
259 3300005293 Ga0065715_10000498 Ga0065715_1000049814 171
260 3300005293 Ga0065715_10001221 Ga0065715_100012214 171
261 3300005293 Ga0065715_10013197 Ga0065715_100131973 171
262 3300005293 Ga0065715_10103982 Ga0065715_101039823 171
263 3300005295 Ga0065707_10119762 Ga0065707_101197623 171
264 3300005329 Ga0070683_100042303 Ga0070683_1000423033 171
265 3300005329 Ga0070683_100357635 Ga0070683_1003576352 171
266 3300005330 Ga0070690_100143078 Ga0070690_1001430783 171
267 3300005331 Ga0070670_100225631 Ga0070670_1002256312 171
268 3300005335 Ga0070666_10115268 Ga0070666_101152683 171
269 3300005337 Ga0070682_101376899 Ga0070682_1013768991 171
270 3300005338 Ga0068868_100101705 Ga0068868_1001017052 171
271 3300005340 Ga0070689_100165638 Ga0070689_1001656382 171
272 3300005344 Ga0070661_100015362 Ga0070661_1000153624 171
273 3300005345 Ga0070692_10196918 Ga0070692_101969182 171
274 3300005353 Ga0070669_100412766 Ga0070669_1004127663 171
275 3300005354 Ga0070675_100307055 Ga0070675_1003070552 171
276 3300005355 Ga0070671_100054761 Ga0070671_1000547613 171
277 3300005355 Ga0070671_100080611 Ga0070671_1000806113 171
278 3300005364 Ga0070673_100034250 Ga0070673_1000342503 171
279 3300005364 Ga0070673_100140336 Ga0070673_1001403362 171
280 3300005365 Ga0070688_100003944 Ga0070688_1000039442 171
281 3300005365 Ga0070688_100156486 Ga0070688_1001564861 171
282 3300005366 Ga0070659_100077473 Ga0070659_1000774733 171
283 3300005366 Ga0070659_100784550 Ga0070659_1007845502 171
284 3300005439 Ga0070711_100221310 Ga0070711_1002213102 171
285 3300005440 Ga0070705_100332104 Ga0070705_1003321042 171
286 3300005455 Ga0070663_100066682 Ga0070663_1000666823 171
287 3300005456 Ga0070678_100018503 Ga0070678_1000185036 171
288 3300005457 Ga0070662_100420083 Ga0070662_1004200832 171
289 3300005458 Ga0070681_10007306 Ga0070681_1000730612 171
290 3300005466 Ga0070685_10087111 Ga0070685_100871113 171
291 3300005466 Ga0070685_10106826 Ga0070685_101068263 171
292 3300005471 Ga0070698_100731409 Ga0070698_1007314092 171
293 3300005530 Ga0070679_100076366 Ga0070679_1000763662 171
294 3300005535 Ga0070684_100022922 Ga0070684_1000229225 171
295 3300005544 Ga0070686_100199584 Ga0070686_1001995841 171
296 3300005547 Ga0070693_100264154 Ga0070693_1002641542 171
297 3300005548 Ga0070665_100009195 Ga0070665_1000091952 171
298 3300005548 Ga0070665_100427934 Ga0070665_1004279342 171
299 3300005548 Ga0070665_100727297 Ga0070665_1007272972 171
300 3300005564 Ga0070664_100391119 Ga0070664_1003911193 171
301 3300005564 Ga0070664_100486864 Ga0070664_1004868642 171
302 3300005577 Ga0068857_100370096 Ga0068857_1003700961 171
303 3300005615 Ga0070702_100562797 Ga0070702_1005627972 171
304 3300005841 Ga0068863_100170893 Ga0068863_1001708932 171
305 3300005841 Ga0068863_100493051 Ga0068863_1004930512 171
306 3300005985 Ga0081539_10124217 Ga0081539_101242173 171
307 3300006173 Ga0070716_100194419 Ga0070716_1001944193 171
308 3300006175 Ga0070712_100527677 Ga0070712_1005276771 171
309 3300006844 Ga0075428_100469676 Ga0075428_1004696763 171
310 3300007788 Ga0099795_10013639 Ga0099795_100136391 171
311 3300009098 Ga0105245_11442154 Ga0105245_114421541 171
312 3300009101 Ga0105247_10158430 Ga0105247_101584302 171
313 3300009147 Ga0114129_10152218 Ga0114129_101522184 171
314 3300009176 Ga0105242_10181906 Ga0105242_101819062 171
315 3300009553 Ga0105249_10044041 Ga0105249_100440415 171
316 3300009553 Ga0105249_10632126 Ga0105249_106321262 171
317 3300010375 Ga0105239_10176563 Ga0105239_101765633 171
318 3300010375 Ga0105239_10748994 Ga0105239_107489942 171
319 3300013296 Ga0157374_10231992 Ga0157374_102319923 171
320 3300013296 Ga0157374_10415588 Ga0157374_104155882 171
321 3300013296 Ga0157374_10574872 Ga0157374_105748722 171
322 3300013296 Ga0157374_10799955 Ga0157374_107999551 171
323 3300013297 Ga0157378_10339142 Ga0157378_103391421 171
324 3300013297 Ga0157378_10489151 Ga0157378_104891512 171
325 3300013306 Ga0163162_10141092 Ga0163162_101410922 171
326 3300013306 Ga0163162_10388665 Ga0163162_103886653 171
327 3300013308 Ga0157375_10018938 Ga0157375_100189381 171
328 3300013308 Ga0157375_10829395 Ga0157375_108293952 171
329 3300013308 Ga0157375_10932479 Ga0157375_109324792 171
330 3300013308 Ga0157375_10992730 Ga0157375_109927302 171
331 3300014325 Ga0163163_10498797 Ga0163163_104987972 171
332 3300014325 Ga0163163_10569052 Ga0163163_105690523 171
333 3300014969 Ga0157376_10036042 Ga0157376_100360422 171
334 3300014969 Ga0157376_10158948 Ga0157376_101589483 171
335 3300014969 Ga0157376_11562527 Ga0157376_115625272 171
336 3300025315 Ga0207697_10027753 Ga0207697_100277533 171
337 3300025315 Ga0207697_10089166 Ga0207697_100891662 171
338 3300025911 Ga0207654_10229130 Ga0207654_102291302 171
339 3300025917 Ga0207660_10152433 Ga0207660_101524332 171
340 3300025925 Ga0207650_10574951 Ga0207650_105749512 171
341 3300025926 Ga0207659_10335432 Ga0207659_103354322 171
342 3300025928 Ga0207700_10173697 Ga0207700_101736973 171
343 3300025934 Ga0207686_10076283 Ga0207686_100762833 171
344 3300025934 Ga0207686_10155657 Ga0207686_101556572 171
345 3300025936 Ga0207670_10168820 Ga0207670_101688202 171
346 3300025944 Ga0207661_10329510 Ga0207661_103295102 171
347 3300025944 Ga0207661_10331618 Ga0207661_103316182 171
348 3300025960 Ga0207651_10117812 Ga0207651_101178122 171
349 3300025960 Ga0207651_10554881 Ga0207651_105548811 171
350 3300026023 Ga0207677_10179145 Ga0207677_101791452 171
351 3300026067 Ga0207678_10018313 Ga0207678_100183133 171
352 3300026075 Ga0207708_10087970 Ga0207708_100879702 171
353 3300026075 Ga0207708_10132111 Ga0207708_101321113 171
354 3300026078 Ga0207702_10754568 Ga0207702_107545682 171
355 3300026116 Ga0207674_10659807 Ga0207674_106598072 171
356 3300026142 Ga0207698_11347267 Ga0207698_113472672 171
357 3300027907 Ga0207428_10208656 Ga0207428_102086561 171
358 3300028379 Ga0268266_10360171 Ga0268266_103601711 171
359 3300028379 Ga0268266_10405232 Ga0268266_104052321 171
360 3300035111 Ga0373923_0344683 Ga0373923_0344683_25_540 171
361 3300035170 Ga0373943_0215971 Ga0373943_0215971_524_1039 171
362 3300035691 Ga0373931_0190214 Ga0373931_0190214_460_975 171
363 3300035725 Ga0373947_0160787 Ga0373947_0160787_32_547 171
364 3300035725 Ga0373947_0252296 Ga0373947_0252296_594_1109 171
365 3300038443 Ga0395901_0951339 Ga0395901_0951339_208_723 171
366 3300041505 Ga0451849_0190349 Ga0451849_0190349_253_768 171
367 3300042012 Ga0439455_0045259 Ga0439455_0045259_30_545 171
368 3300046455 Ga0495603_0689353 Ga0495603_0689353_33_548 171
369 3300046461 Ga0495641_0322853 Ga0495641_0322853_73_588 171
370 3300046511 Ga0495608_0620488 Ga0495608_0620488_38_553 171
371 3300046529 Ga0495652_0072665 Ga0495652_0072665_1502_2017 171
372 3300046642 Ga0495634_0780433 Ga0495634_0780433_21_536 171
373 3300047317 Ga0495604_0258325 Ga0495604_0258325_58_573 171
374 3300048903 Ga0496100_1006071 Ga0496100_1006071_129_644 171
375 3300048904 Ga0496101_0288662 Ga0496101_0288662_295_810 171
376 3300048905 Ga0496102_0163065 Ga0496102_0163065_1534_2049 171
377 3300048906 Ga0496103_0108734 Ga0496103_0108734_323_838 171
378 3300048907 Ga0496104_1442038 Ga0496104_1442038_58_573 171
379 3300048908 Ga0496105_0046748 Ga0496105_0046748_586_1101 171
380 3300048908 Ga0496105_0266275 Ga0496105_0266275_779_1294 171
381 3300048910 Ga0496107_0449958 Ga0496107_0449958_224_739 171
382 3300048911 Ga0496108_0030767 Ga0496108_0030767_2701_3216 171
383 3300048911 Ga0496108_0061085 Ga0496108_0061085_1956_2471 171
384 3300048911 Ga0496108_0388529 Ga0496108_0388529_564_1079 171
385 3300048912 Ga0496109_0007567 Ga0496109_0007567_1583_2098 171
386 3300048912 Ga0496109_0032681 Ga0496109_0032681_727_1242 171
387 3300048913 Ga0496110_0134596 Ga0496110_0134596_1615_2130 171
388 3300048913 Ga0496110_1181500 Ga0496110_1181500_47_562 171
389 3300048915 Ga0496112_0042548 Ga0496112_0042548_507_1022 171
390 3300048915 Ga0496112_0054932 Ga0496112_0054932_2938_3453 171
391 3300048915 Ga0496112_0221898 Ga0496112_0221898_496_1011 171
392 3300048915 Ga0496112_0257172 Ga0496112_0257172_1103_1618 171
393 3300048916 Ga0496113_0025847 Ga0496113_0025847_2467_2982 171
394 3300048916 Ga0496113_0134394 Ga0496113_0134394_681_1196 171
395 3300048917 Ga0496114_0036536 Ga0496114_0036536_1647_2162 171
396 3300048918 Ga0496115_0052267 Ga0496115_0052267_1890_2405 171
397 3300050507 nmdc:mga05p37_126512_c1 nmdc:mga05p37_126512_c1_1276_1791 171
398 3300050512 nmdc:mga0n895_348828_c1 nmdc:mga0n895_348828_c1_478_993 171
399 3300050512 nmdc:mga0n895_539053_c1 nmdc:mga0n895_539053_c1_573_1088 171
400 3300050513 nmdc:mga0rr50_332162_c1 nmdc:mga0rr50_332162_c1_507_1022 171
401 3300050513 nmdc:mga0rr50_929613_c1 nmdc:mga0rr50_929613_c1_150_665 171
402 3300050515 nmdc:mga0a205_102958_c1 nmdc:mga0a205_102958_c1_1046_1561 171
403 3300053085 Ga0495619_0209497 Ga0495619_0209497_493_1008 171

Feature Viewer

pLDDT pTM Quality
70.37 0.46 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map