F435193

General Info

Members Datasets Scaffolds Average Seq Length
402 225 804 468

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0011573|Ga0495672_0011573_3639_5159
Length 506
Sequence LLGGDDPAFDAQVELIHCARQARPVDFAFVHLHSFVDLMSNRTSFAIAAFLCFSFGPTAAGQTPVNWEALTTETVNVLADYIKVNTTNPPGNEIEAARFLKRILDREGIEARILDTVELAGRRGANLYARLRSNGSKKAIALVHHMDVVPATQTAWTVDAFAGVVKDGYVWGRGAIDMKGFGIVQLMAMVAIKRSGLPLTRDIVYIANADEEMGSTGALVFVQRHPELLRDVEYLMTEGGGNEVHDGKLEYYGVGIAEKRTFWQRLSVTGTPSHASRPTKLNPVPRLIAALEKIARYETPLHVTPGVDKYFRDISRRYPEPRRTWLGDVKKGLANPKAREWILSDVYWNAILRNTISLTVLQGSPKTNVIPAEASADIDVRLLPDTDPAAFLATLKRIVNDTAVHFTTTIQPKTPLENPIETDLFRAIERASRDRDPGALVTTPMLTAATDRPTYRAVGIISYGFDPFKLEASELQKGMHGNDERISVANMGFGVKYLYDVLRYAQ

Samples

Sample ID Description Type Environment
1 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
165 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
177 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
178 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
179 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
180 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
181 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
182 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
183 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
184 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
185 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
186 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
187 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
190 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
191 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
192 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
193 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
194 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
195 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
196 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
197 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
198 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
199 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
200 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
207 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
208 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
209 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
210 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
211 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
212 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
213 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
214 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
215 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
216 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
217 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 1.49
Rhizosphere 98.26
Stem 0
Stem Tuber 0
Unclassified 15.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495672_0011573 3300047320 Bacteria 6218
2 JGI24751J29686_10000038 3300002459 Bacteria 80932
3 JGI25406J46586_10010758 3300003203 Bacteria 4042
4 Ga0065712_10004694 3300005290 Bacteria 4792
5 Ga0065715_10090773 3300005293 Bacteria 6490
6 Ga0065715_10129884 3300005293 Unclassified 2009
7 Ga0065707_10009053 3300005295 Unclassified 2363
8 Ga0070658_10009779 3300005327 Bacteria 7701
9 Ga0070676_10018367 3300005328 Bacteria 3875
10 Ga0070676_10092191 3300005328 Bacteria 1858
11 Ga0070683_100006085 3300005329 Bacteria 10117
12 Ga0070683_100066740 3300005329 Bacteria 3351
13 Ga0070683_100121962 3300005329 Bacteria 2463
14 Ga0070683_100157242 3300005329 Bacteria 2156
15 Ga0070690_100026085 3300005330 Unclassified 3602
16 Ga0070690_100131489 3300005330 Unclassified 1691
17 Ga0070670_100000073 3300005331 Bacteria 98443
18 Ga0070670_100023928 3300005331 Bacteria 5255
19 Ga0070670_100090104 3300005331 Bacteria 2636
20 Ga0070670_100164648 3300005331 Unclassified 1922
21 Ga0070670_100267587 3300005331 Unclassified 1491
22 Ga0068869_100034183 3300005334 Unclassified 3594
23 Ga0070666_10076489 3300005335 Bacteria 2284
24 Ga0070680_100000068 3300005336 Bacteria 54600
25 Ga0070680_100001380 3300005336 Bacteria 17567
26 Ga0070680_100010009 3300005336 Bacteria 7305
27 Ga0070680_100022228 3300005336 Bacteria 5048
28 Ga0070680_100030845 3300005336 Bacteria 4307
29 Ga0070682_100000600 3300005337 Bacteria 21930
30 Ga0070682_100004186 3300005337 Bacteria 8006
31 Ga0068868_100007035 3300005338 Bacteria 7997
32 Ga0068868_100073287 3300005338 Unclassified 2734
33 Ga0070689_100002495 3300005340 Bacteria 12028
34 Ga0070689_100090879 3300005340 Bacteria 2406
35 Ga0070687_100005568 3300005343 Bacteria 5108
36 Ga0070661_100007782 3300005344 Bacteria 7395
37 Ga0070692_10060952 3300005345 Unclassified 1987
38 Ga0070668_100016318 3300005347 Bacteria 5553
39 Ga0070669_100001748 3300005353 Bacteria 15648
40 Ga0070669_100033076 3300005353 Bacteria 3737
41 Ga0070669_100163281 3300005353 Bacteria 1732
42 Ga0070675_100005979 3300005354 Bacteria 9328
43 Ga0070674_100042569 3300005356 Bacteria 3086
44 Ga0070673_100037839 3300005364 Bacteria 3679
45 Ga0070673_100040473 3300005364 Bacteria 3576
46 Ga0070673_100077205 3300005364 Unclassified 2691
47 Ga0070673_100077850 3300005364 Bacteria 2680
48 Ga0070673_100089287 3300005364 Bacteria 2516
49 Ga0070688_100003101 3300005365 Bacteria 8497
50 Ga0070659_100006362 3300005366 Bacteria 8529
51 Ga0070659_100017712 3300005366 Bacteria 5365
52 Ga0070659_100028181 3300005366 Bacteria 4335
53 Ga0070667_100058699 3300005367 Bacteria 3253
54 Ga0070667_100076525 3300005367 Unclassified 2857
55 Ga0070709_10005922 3300005434 Bacteria 6633
56 Ga0070714_100183929 3300005435 Unclassified 1903
57 Ga0070711_100139056 3300005439 Bacteria 1818
58 Ga0070705_100027760 3300005440 Bacteria 3093
59 Ga0070705_100029045 3300005440 Bacteria 3036
60 Ga0070700_100031105 3300005441 Bacteria 3195
61 Ga0070694_100012909 3300005444 Bacteria 5209
62 Ga0070694_100205709 3300005444 Bacteria 1469
63 Ga0070708_100001511 3300005445 Bacteria 17756
64 Ga0070708_100082432 3300005445 Bacteria 2913
65 Ga0070663_100179498 3300005455 Bacteria 1641
66 Ga0070681_10000118 3300005458 Bacteria 59540
67 Ga0070681_10004646 3300005458 Bacteria 13115
68 Ga0070681_10004802 3300005458 Bacteria 12956
69 Ga0070681_10004927 3300005458 Bacteria 12829
70 Ga0070681_10010306 3300005458 Bacteria 9226
71 Ga0068867_100245659 3300005459 Bacteria 1453
72 Ga0070685_10029050 3300005466 Bacteria 3069
73 Ga0070706_100000015 3300005467 Bacteria 188425
74 Ga0070707_100001722 3300005468 Bacteria 21109
75 Ga0070698_100008421 3300005471 Bacteria 11147
76 Ga0070699_100006181 3300005518 Bacteria 10463
77 Ga0070679_100001362 3300005530 Bacteria 21579
78 Ga0070679_100002095 3300005530 Bacteria 17975
79 Ga0070679_100023052 3300005530 Bacteria 6089
80 Ga0070679_100036868 3300005530 Bacteria 4854
81 Ga0070679_100049650 3300005530 Bacteria 4179
82 Ga0070679_100121567 3300005530 Bacteria 2596
83 Ga0070684_100002351 3300005535 Bacteria 13945
84 Ga0070684_100009007 3300005535 Bacteria 7840
85 Ga0070684_100016923 3300005535 Bacteria 5972
86 Ga0070684_100103701 3300005535 Bacteria 2544
87 Ga0070697_100034456 3300005536 Bacteria 4082
88 Ga0068853_100004345 3300005539 Bacteria 10966
89 Ga0068853_100132392 3300005539 Unclassified 2234
90 Ga0070672_100010581 3300005543 Bacteria 6403
91 Ga0070672_100046407 3300005543 Unclassified 3366
92 Ga0070686_100000048 3300005544 Bacteria 98569
93 Ga0070686_100012826 3300005544 Unclassified 4783
94 Ga0070695_100086707 3300005545 Bacteria 2081
95 Ga0070696_100031954 3300005546 Bacteria 3610
96 Ga0070696_100061782 3300005546 Bacteria 2621
97 Ga0070693_100000951 3300005547 Bacteria 12863
98 Ga0070665_100158496 3300005548 Bacteria 2265
99 Ga0070704_100048368 3300005549 Bacteria 2977
100 Ga0068855_100137573 3300005563 Bacteria 2786
101 Ga0068855_100169019 3300005563 Bacteria 2477
102 Ga0068855_100190934 3300005563 Bacteria 2310
103 Ga0070664_100002525 3300005564 Bacteria 14755
104 Ga0070664_100002580 3300005564 Bacteria 14610
105 Ga0070664_100019798 3300005564 Bacteria 5539
106 Ga0070664_100094362 3300005564 Bacteria 2594
107 Ga0070664_100094600 3300005564 Bacteria 2591
108 Ga0068857_100002670 3300005577 Bacteria 14644
109 Ga0068857_100014339 3300005577 Bacteria 6908
110 Ga0068857_100046286 3300005577 Bacteria 3861
111 Ga0068857_100072381 3300005577 Bacteria 3071
112 Ga0068854_100142893 3300005578 Unclassified 1838
113 Ga0068856_100005300 3300005614 Bacteria 12724
114 Ga0070702_100065952 3300005615 Bacteria 2122
115 Ga0070702_100138783 3300005615 Bacteria 1546
116 Ga0068859_100021382 3300005617 Bacteria 6493
117 Ga0068859_100036108 3300005617 Unclassified 4960
118 Ga0068859_100074466 3300005617 Bacteria 3434
119 Ga0068859_100086985 3300005617 Bacteria 3172
120 Ga0068864_100018626 3300005618 Bacteria 5802
121 Ga0068864_100025577 3300005618 Bacteria 4973
122 Ga0068866_10005031 3300005718 Bacteria 5442
123 Ga0068861_100008097 3300005719 Bacteria 7232
124 Ga0068861_100053839 3300005719 Bacteria 3063
125 Ga0068870_10074620 3300005840 Bacteria 1858
126 Ga0068863_100067508 3300005841 Bacteria 3382
127 Ga0068858_100039784 3300005842 Bacteria 4358
128 Ga0068858_100133958 3300005842 Unclassified 2324
129 Ga0068860_100027298 3300005843 Bacteria 5500
130 Ga0068860_100038764 3300005843 Unclassified 4559
131 Ga0068860_100101842 3300005843 Unclassified 2740
132 Ga0068860_100126324 3300005843 Unclassified 2451
133 Ga0068862_100018132 3300005844 Bacteria 5861
134 Ga0068862_100119066 3300005844 Unclassified 2325
135 Ga0081539_10000487 3300005985 Bacteria 83994
136 Ga0081539_10003495 3300005985 Bacteria 19198
137 Ga0070712_100143547 3300006175 Unclassified 1825
138 Ga0075428_100074933 3300006844 Bacteria 3697
139 Ga0075428_100081296 3300006844 Bacteria 3536
140 Ga0075428_100083970 3300006844 Bacteria 3474
141 Ga0075431_100048446 3300006847 Bacteria 4383
142 Ga0075431_100082081 3300006847 Bacteria 3328
143 Ga0075431_100096741 3300006847 Bacteria 3048
144 Ga0075431_100156989 3300006847 Bacteria 2340
145 Ga0075433_10008152 3300006852 Bacteria 8343
146 Ga0075433_10031197 3300006852 Unclassified 4554
147 Ga0075433_10050622 3300006852 Bacteria 3616
148 Ga0075433_10079658 3300006852 Bacteria 2886
149 Ga0075433_10124968 3300006852 Unclassified 2285
150 Ga0075434_100005224 3300006871 Bacteria 11795
151 Ga0075434_100043034 3300006871 Unclassified 4478
152 Ga0075434_100049269 3300006871 Bacteria 4182
153 Ga0075434_100158964 3300006871 Bacteria 2279
154 Ga0075434_100289786 3300006871 Bacteria 1657
155 Ga0075429_100004221 3300006880 Bacteria 12308
156 Ga0075429_100026319 3300006880 Bacteria 5050
157 Ga0075429_100121025 3300006880 Bacteria 2288
158 Ga0068865_100000914 3300006881 Bacteria 16744
159 Ga0068865_100079584 3300006881 Unclassified 2348
160 Ga0075436_100001583 3300006914 Bacteria 15548
161 Ga0097620_100021382 3300006931 Bacteria 6493
162 Ga0097620_100036109 3300006931 Unclassified 4960
163 Ga0097620_100074470 3300006931 Bacteria 3434
164 Ga0097620_100086983 3300006931 Bacteria 3172
165 Ga0105240_10134905 3300009093 Viruses 2957
166 Ga0105240_10272504 3300009093 Bacteria 1948
167 Ga0111539_10069133 3300009094 Bacteria 4170
168 Ga0111539_10079327 3300009094 Bacteria 3862
169 Ga0111539_10156522 3300009094 Bacteria 2666
170 Ga0105245_10037627 3300009098 Bacteria 4302
171 Ga0105245_10131724 3300009098 Bacteria 2346
172 Ga0114129_10004897 3300009147 Bacteria 18898
173 Ga0114129_10007019 3300009147 Bacteria 16035
174 Ga0114129_10032375 3300009147 Bacteria 7388
175 Ga0114129_10208549 3300009147 Unclassified 2643
176 Ga0114129_10347846 3300009147 Bacteria 1964
177 Ga0105243_10001952 3300009148 Bacteria 17560
178 Ga0105243_10235334 3300009148 Bacteria 1627
179 Ga0105241_10020033 3300009174 Bacteria 4940
180 Ga0105241_10221376 3300009174 Bacteria 1591
181 Ga0105242_10004104 3300009176 Bacteria 11327
182 Ga0105248_10086392 3300009177 Bacteria 3530
183 Ga0105248_10092690 3300009177 Unclassified 3402
184 Ga0105248_10160575 3300009177 Bacteria 2535
185 Ga0105248_10164693 3300009177 Bacteria 2500
186 Ga0105238_10002642 3300009551 Bacteria 17857
187 Ga0105238_10053023 3300009551 Bacteria 4076
188 Ga0105249_10011040 3300009553 Bacteria 7936
189 Ga0105249_10044992 3300009553 Bacteria 4014
190 Ga0105239_10101185 3300010375 Bacteria 3188
191 Ga0105239_10169469 3300010375 Bacteria 2441
192 Ga0105246_10097449 3300011119 Unclassified 2134
193 Ga0157373_10006338 3300013100 Bacteria 8839
194 Ga0157373_10009488 3300013100 Bacteria 7189
195 Ga0157373_10017090 3300013100 Bacteria 5283
196 Ga0157373_10038074 3300013100 Bacteria 3447
197 Ga0157371_10155280 3300013102 Bacteria 1633
198 Ga0157370_10000523 3300013104 Bacteria 48075
199 Ga0157374_10172489 3300013296 Bacteria 2110
200 Ga0157378_10015544 3300013297 Bacteria 6666
201 Ga0157378_10025558 3300013297 Bacteria 5200
202 Ga0157378_10083860 3300013297 Bacteria 2885
203 Ga0157378_10193603 3300013297 Bacteria 1919
204 Ga0163162_10008612 3300013306 Bacteria 9941
205 Ga0163162_10105875 3300013306 Unclassified 2907
206 Ga0157372_10033659 3300013307 Bacteria 5631
207 Ga0157372_10041883 3300013307 Bacteria 5064
208 Ga0157372_10298166 3300013307 Bacteria 1875
209 Ga0157375_10027894 3300013308 Bacteria 5283
210 Ga0157375_10071749 3300013308 Bacteria 3478
211 Ga0157375_10103893 3300013308 Bacteria 2929
212 Ga0157375_10158174 3300013308 Unclassified 2406
213 Ga0163163_10000466 3300014325 Bacteria 36943
214 Ga0163163_10029203 3300014325 Bacteria 5303
215 Ga0157380_10000188 3300014326 Bacteria 35876
216 Ga0157377_10016406 3300014745 Bacteria 3810
217 Ga0157379_10010442 3300014968 Bacteria 8094
218 Ga0157376_10055570 3300014969 Unclassified 3304
219 Ga0207682_10061594 3300025893 Bacteria 1571
220 Ga0207642_10009682 3300025899 Bacteria 3362
221 Ga0207710_10000389 3300025900 Bacteria 29876
222 Ga0207688_10009828 3300025901 Bacteria 5206
223 Ga0207688_10114300 3300025901 Bacteria 1570
224 Ga0207645_10015612 3300025907 Bacteria 5040
225 Ga0207643_10001129 3300025908 Bacteria 15875
226 Ga0207643_10020307 3300025908 Bacteria 3645
227 Ga0207705_10041043 3300025909 Unclassified 3319
228 Ga0207684_10000083 3300025910 Bacteria 176092
229 Ga0207707_10000012 3300025912 Bacteria 280486
230 Ga0207707_10002760 3300025912 Bacteria 15659
231 Ga0207707_10015795 3300025912 Bacteria 6582
232 Ga0207707_10021170 3300025912 Bacteria 5683
233 Ga0207693_10039760 3300025915 Bacteria 3704
234 Ga0207660_10001050 3300025917 Bacteria 18298
235 Ga0207660_10011883 3300025917 Bacteria 5679
236 Ga0207660_10124727 3300025917 Bacteria 1954
237 Ga0207662_10031125 3300025918 Bacteria 3100
238 Ga0207652_10001285 3300025921 Bacteria 22359
239 Ga0207652_10050448 3300025921 Bacteria 3566
240 Ga0207652_10166778 3300025921 Bacteria 1975
241 Ga0207646_10006075 3300025922 Bacteria 12578
242 Ga0207681_10010472 3300025923 Bacteria 5675
243 Ga0207681_10023874 3300025923 Unclassified 3917
244 Ga0207681_10031671 3300025923 Bacteria 3456
245 Ga0207650_10000006 3300025925 Bacteria 544730
246 Ga0207650_10157820 3300025925 Bacteria 1795
247 Ga0207650_10244381 3300025925 Unclassified 1451
248 Ga0207644_10213179 3300025931 Unclassified 1528
249 Ga0207690_10004343 3300025932 Bacteria 8374
250 Ga0207690_10011300 3300025932 Bacteria 5335
251 Ga0207690_10032080 3300025932 Unclassified 3368
252 Ga0207706_10009165 3300025933 Bacteria 9100
253 Ga0207706_10016085 3300025933 Bacteria 6760
254 Ga0207686_10009924 3300025934 Bacteria 5175
255 Ga0207709_10087014 3300025935 Bacteria 2030
256 Ga0207670_10000236 3300025936 Bacteria 35069
257 Ga0207704_10011143 3300025938 Unclassified 4415
258 Ga0207704_10020308 3300025938 Unclassified 3511
259 Ga0207704_10030612 3300025938 Bacteria 3019
260 Ga0207704_10086330 3300025938 Bacteria 2046
261 Ga0207665_10022514 3300025939 Bacteria 4146
262 Ga0207691_10008611 3300025940 Bacteria 9789
263 Ga0207711_10004191 3300025941 Bacteria 12348
264 Ga0207711_10109806 3300025941 Bacteria 2452
265 Ga0207689_10002536 3300025942 Bacteria 16961
266 Ga0207689_10091962 3300025942 Bacteria 2492
267 Ga0207689_10172759 3300025942 Unclassified 1782
268 Ga0207689_10176400 3300025942 Bacteria 1762
269 Ga0207661_10000659 3300025944 Bacteria 22272
270 Ga0207661_10029359 3300025944 Unclassified 4223
271 Ga0207661_10066411 3300025944 Unclassified 2930
272 Ga0207661_10144480 3300025944 Bacteria 2051
273 Ga0207679_10005396 3300025945 Bacteria 8007
274 Ga0207679_10013846 3300025945 Bacteria 5290
275 Ga0207679_10020892 3300025945 Unclassified 4428
276 Ga0207679_10029348 3300025945 Bacteria 3828
277 Ga0207679_10066759 3300025945 Bacteria 2696
278 Ga0207667_10150220 3300025949 Bacteria 2398
279 Ga0207667_10152452 3300025949 Bacteria 2378
280 Ga0207651_10008666 3300025960 Bacteria 5510
281 Ga0207651_10195914 3300025960 Unclassified 1615
282 Ga0207712_10017290 3300025961 Bacteria 4682
283 Ga0207640_10175596 3300025981 Unclassified 1601
284 Ga0207658_10164583 3300025986 Bacteria 1821
285 Ga0207703_10184764 3300026035 Unclassified 1842
286 Ga0207639_10015732 3300026041 Bacteria 5338
287 Ga0207678_10196663 3300026067 Bacteria 1723
288 Ga0207708_10012864 3300026075 Bacteria 6243
289 Ga0207708_10038646 3300026075 Bacteria 3635
290 Ga0207702_10025855 3300026078 Unclassified 4873
291 Ga0207641_10105095 3300026088 Unclassified 2494
292 Ga0207648_10089521 3300026089 Bacteria 2689
293 Ga0207648_10091227 3300026089 Bacteria 2664
294 Ga0207676_10006815 3300026095 Bacteria 8090
295 Ga0207674_10000834 3300026116 Bacteria 40210
296 Ga0207674_10003778 3300026116 Bacteria 18471
297 Ga0207674_10007051 3300026116 Bacteria 13138
298 Ga0207674_10068021 3300026116 Bacteria 3585
299 Ga0207674_10130401 3300026116 Bacteria 2478
300 Ga0207674_10148528 3300026116 Bacteria 2301
301 Ga0207675_100003117 3300026118 Bacteria 16262
302 Ga0207675_100022340 3300026118 Bacteria 5891
303 Ga0207675_100028675 3300026118 Bacteria 5185
304 Ga0207675_100056048 3300026118 Bacteria 3677
305 Ga0207683_10012296 3300026121 Bacteria 7306
306 Ga0207683_10127280 3300026121 Unclassified 2290
307 Ga0209968_1006983 3300027526 Unclassified 1704
308 Ga0268266_10141588 3300028379 Bacteria 2159
309 Ga0268265_10033069 3300028380 Bacteria 3756
310 Ga0268265_10055846 3300028380 Bacteria 3002
311 Ga0307408_100007389 3300031548 Bacteria 7268
312 Ga0307408_100058290 3300031548 Bacteria 2807
313 Ga0307405_10007336 3300031731 Bacteria 5503
314 Ga0307413_10001317 3300031824 Bacteria 9272
315 Ga0307413_10079091 3300031824 Bacteria 2101
316 Ga0307406_10000571 3300031901 Bacteria 21267
317 Ga0307407_10046700 3300031903 Unclassified 2453
318 Ga0307412_10007059 3300031911 Bacteria 6373
319 Ga0307409_100105192 3300031995 Unclassified 2352
320 Ga0307409_100126277 3300031995 Bacteria 2176
321 Ga0307409_100185650 3300031995 Bacteria 1845
322 Ga0307416_100049119 3300032002 Bacteria 3352
323 Ga0307414_10014388 3300032004 Bacteria 4742
324 Ga0307414_10021049 3300032004 Unclassified 4081
325 Ga0307414_10098378 3300032004 Bacteria 2195
326 Ga0307411_10012828 3300032005 Bacteria 4593
327 Ga0307415_100017633 3300032126 Bacteria 4285
328 Ga0373944_0002300 3300035089 Bacteria 4862
329 Ga0373951_0003140 3300035091 Bacteria 4071
330 Ga0373943_0005645 3300035170 Bacteria 5613
331 Ga0373942_0005511 3300035207 Unclassified 2934
332 Ga0373927_0002599 3300035695 Bacteria 13156
333 Ga0373947_0000975 3300035725 Bacteria 17477
334 Ga0373937_0116155 3300036401 Bacteria 2492
335 Ga0373925_0001709 3300037068 Bacteria 18501
336 Ga0395898_0326292 3300037466 Bacteria 1464
337 Ga0466966_0056454 3300044684 Bacteria 2484
338 Ga0451576_0023656 3300045051 Bacteria 6650
339 Ga0466967_0232939 3300045976 Unclassified 1754
340 Ga0495603_0002024 3300046455 Bacteria 11933
341 Ga0495590_0035889 3300046457 Bacteria 1730
342 Ga0495629_0003783 3300046459 Bacteria 11396
343 Ga0495651_0039640 3300046462 Bacteria 3667
344 Ga0495580_0015645 3300046472 Bacteria 5716
345 Ga0495582_0003153 3300046473 Bacteria 9254
346 Ga0495639_0000175 3300046475 Bacteria 33683
347 Ga0495664_0006160 3300046477 Bacteria 6621
348 Ga0495630_0005659 3300046517 Bacteria 8830
349 Ga0495666_0001281 3300046526 Bacteria 12179
350 Ga0495665_0000126 3300046531 Bacteria 36841
351 Ga0495621_0015358 3300046539 Bacteria 2441
352 Ga0495645_0084122 3300046543 Bacteria 2278
353 Ga0495634_0001786 3300046642 Bacteria 18595
354 Ga0495588_0000742 3300046674 Bacteria 14870
355 Ga0495588_0012305 3300046674 Bacteria 4040
356 Ga0495599_0017205 3300046678 Bacteria 4493
357 Ga0495658_0000622 3300046683 Bacteria 19288
358 Ga0495613_0020842 3300046689 Bacteria 4887
359 Ga0495581_0003733 3300047315 Bacteria 8776
360 Ga0495674_0013264 3300047319 Bacteria 7749
361 Ga0495685_026034 3300047447 Bacteria 2014
362 Ga0495684_0002789 3300047471 Bacteria 13787
363 Ga0495593_0000199 3300047673 Bacteria 31561
364 Ga0495602_0125298 3300048088 Bacteria 2059
365 Ga0495614_0007404 3300048089 Bacteria 4887
366 Ga0496102_0010938 3300048905 Bacteria 7815
367 Ga0496106_0130713 3300048909 Bacteria 1969
368 Ga0496106_0168291 3300048909 Bacteria 1736
369 Ga0496109_0136869 3300048912 Bacteria 2289
370 Ga0496112_0000740 3300048915 Bacteria 22777
371 Ga0496112_0031350 3300048915 Bacteria 5156
372 Ga0501047_0030651 3300049581 Bacteria 5185
373 Ga0501076_0070900 3300049592 Bacteria 2787
374 Ga0501202_002390 3300049652 Unclassified 3148
375 Ga0501223_005881 3300049663 Bacteria 2561
376 Ga0501227_002240 3300049665 Unclassified 4280
377 Ga0501233_001572 3300049668 Bacteria 3921
378 Ga0501235_000854 3300049669 Bacteria 6238
379 Ga0501243_010681 3300049675 Viruses 1436
380 Ga0501249_003904 3300049679 Bacteria 3012
381 Ga0501225_0003567 3300049705 Bacteria 4695
382 Ga0501079_0045070 3300049741 Bacteria 3404
383 Ga0501081_0085245 3300049743 Unclassified 2217
384 Ga0501266_005820 3300049763 Bacteria 1532
385 nmdc:mga05p37_103422_c1 3300050507 Bacteria 3506
386 nmdc:mga09592_116305_c1 3300050508 Bacteria 2295
387 nmdc:mga09592_14441_c1 3300050508 Bacteria 6446
388 nmdc:mga06r32_25712_c1 3300050510 Bacteria 5480
389 nmdc:mga06r32_73620_c1 3300050510 Unclassified 3310
390 nmdc:mga08y16_181568_c1 3300050511 Bacteria 2185
391 nmdc:mga08y16_86430_c1 3300050511 Unclassified 3268
392 nmdc:mga0n895_36030_c1 3300050512 Bacteria 4775
393 nmdc:mga0n895_41164_c1 3300050512 Bacteria 4491
394 nmdc:mga0n895_53683_c1 3300050512 Bacteria 3961
395 nmdc:mga0rr50_19621_c1 3300050513 Bacteria 4569
396 nmdc:mga0a205_10060_c1 3300050515 Bacteria 8678
397 nmdc:mga0a205_21072_c1 3300050515 Bacteria 6163
398 nmdc:mga0a205_31860_c1 3300050515 Unclassified 2291
399 nmdc:mga0a205_38389_c1 3300050515 Bacteria 4607
400 nmdc:mga0a205_41713_c1 3300050515 Bacteria 4420
401 nmdc:mga0a205_59234_c1 3300050515 Bacteria 3699
402 Ga0500628_000544 3300053129 Bacteria 6914
403 Ga0495672_0011573
404 JGI24751J29686_10000038
405 JGI25406J46586_10010758
406 Ga0065712_10004694
407 Ga0065715_10090773
408 Ga0065715_10129884
409 Ga0065707_10009053
410 Ga0070658_10009779
411 Ga0070676_10018367
412 Ga0070676_10092191
413 Ga0070683_100006085
414 Ga0070683_100066740
415 Ga0070683_100121962
416 Ga0070683_100157242
417 Ga0070690_100026085
418 Ga0070690_100131489
419 Ga0070670_100000073
420 Ga0070670_100023928
421 Ga0070670_100090104
422 Ga0070670_100164648
423 Ga0070670_100267587
424 Ga0068869_100034183
425 Ga0070666_10076489
426 Ga0070680_100000068
427 Ga0070680_100001380
428 Ga0070680_100010009
429 Ga0070680_100022228
430 Ga0070680_100030845
431 Ga0070682_100000600
432 Ga0070682_100004186
433 Ga0068868_100007035
434 Ga0068868_100073287
435 Ga0070689_100002495
436 Ga0070689_100090879
437 Ga0070687_100005568
438 Ga0070661_100007782
439 Ga0070692_10060952
440 Ga0070668_100016318
441 Ga0070669_100001748
442 Ga0070669_100033076
443 Ga0070669_100163281
444 Ga0070675_100005979
445 Ga0070674_100042569
446 Ga0070673_100037839
447 Ga0070673_100040473
448 Ga0070673_100077205
449 Ga0070673_100077850
450 Ga0070673_100089287
451 Ga0070688_100003101
452 Ga0070659_100006362
453 Ga0070659_100017712
454 Ga0070659_100028181
455 Ga0070667_100058699
456 Ga0070667_100076525
457 Ga0070709_10005922
458 Ga0070714_100183929
459 Ga0070711_100139056
460 Ga0070705_100027760
461 Ga0070705_100029045
462 Ga0070700_100031105
463 Ga0070694_100012909
464 Ga0070694_100205709
465 Ga0070708_100001511
466 Ga0070708_100082432
467 Ga0070663_100179498
468 Ga0070681_10000118
469 Ga0070681_10004646
470 Ga0070681_10004802
471 Ga0070681_10004927
472 Ga0070681_10010306
473 Ga0068867_100245659
474 Ga0070685_10029050
475 Ga0070706_100000015
476 Ga0070707_100001722
477 Ga0070698_100008421
478 Ga0070699_100006181
479 Ga0070679_100001362
480 Ga0070679_100002095
481 Ga0070679_100023052
482 Ga0070679_100036868
483 Ga0070679_100049650
484 Ga0070679_100121567
485 Ga0070684_100002351
486 Ga0070684_100009007
487 Ga0070684_100016923
488 Ga0070684_100103701
489 Ga0070697_100034456
490 Ga0068853_100004345
491 Ga0068853_100132392
492 Ga0070672_100010581
493 Ga0070672_100046407
494 Ga0070686_100000048
495 Ga0070686_100012826
496 Ga0070695_100086707
497 Ga0070696_100031954
498 Ga0070696_100061782
499 Ga0070693_100000951
500 Ga0070665_100158496
501 Ga0070704_100048368
502 Ga0068855_100137573
503 Ga0068855_100169019
504 Ga0068855_100190934
505 Ga0070664_100002525
506 Ga0070664_100002580
507 Ga0070664_100019798
508 Ga0070664_100094362
509 Ga0070664_100094600
510 Ga0068857_100002670
511 Ga0068857_100014339
512 Ga0068857_100046286
513 Ga0068857_100072381
514 Ga0068854_100142893
515 Ga0068856_100005300
516 Ga0070702_100065952
517 Ga0070702_100138783
518 Ga0068859_100021382
519 Ga0068859_100036108
520 Ga0068859_100074466
521 Ga0068859_100086985
522 Ga0068864_100018626
523 Ga0068864_100025577
524 Ga0068866_10005031
525 Ga0068861_100008097
526 Ga0068861_100053839
527 Ga0068870_10074620
528 Ga0068863_100067508
529 Ga0068858_100039784
530 Ga0068858_100133958
531 Ga0068860_100027298
532 Ga0068860_100038764
533 Ga0068860_100101842
534 Ga0068860_100126324
535 Ga0068862_100018132
536 Ga0068862_100119066
537 Ga0081539_10000487
538 Ga0081539_10003495
539 Ga0070712_100143547
540 Ga0075428_100074933
541 Ga0075428_100081296
542 Ga0075428_100083970
543 Ga0075431_100048446
544 Ga0075431_100082081
545 Ga0075431_100096741
546 Ga0075431_100156989
547 Ga0075433_10008152
548 Ga0075433_10031197
549 Ga0075433_10050622
550 Ga0075433_10079658
551 Ga0075433_10124968
552 Ga0075434_100005224
553 Ga0075434_100043034
554 Ga0075434_100049269
555 Ga0075434_100158964
556 Ga0075434_100289786
557 Ga0075429_100004221
558 Ga0075429_100026319
559 Ga0075429_100121025
560 Ga0068865_100000914
561 Ga0068865_100079584
562 Ga0075436_100001583
563 Ga0097620_100021382
564 Ga0097620_100036109
565 Ga0097620_100074470
566 Ga0097620_100086983
567 Ga0105240_10134905
568 Ga0105240_10272504
569 Ga0111539_10069133
570 Ga0111539_10079327
571 Ga0111539_10156522
572 Ga0105245_10037627
573 Ga0105245_10131724
574 Ga0114129_10004897
575 Ga0114129_10007019
576 Ga0114129_10032375
577 Ga0114129_10208549
578 Ga0114129_10347846
579 Ga0105243_10001952
580 Ga0105243_10235334
581 Ga0105241_10020033
582 Ga0105241_10221376
583 Ga0105242_10004104
584 Ga0105248_10086392
585 Ga0105248_10092690
586 Ga0105248_10160575
587 Ga0105248_10164693
588 Ga0105238_10002642
589 Ga0105238_10053023
590 Ga0105249_10011040
591 Ga0105249_10044992
592 Ga0105239_10101185
593 Ga0105239_10169469
594 Ga0105246_10097449
595 Ga0157373_10006338
596 Ga0157373_10009488
597 Ga0157373_10017090
598 Ga0157373_10038074
599 Ga0157371_10155280
600 Ga0157370_10000523
601 Ga0157374_10172489
602 Ga0157378_10015544
603 Ga0157378_10025558
604 Ga0157378_10083860
605 Ga0157378_10193603
606 Ga0163162_10008612
607 Ga0163162_10105875
608 Ga0157372_10033659
609 Ga0157372_10041883
610 Ga0157372_10298166
611 Ga0157375_10027894
612 Ga0157375_10071749
613 Ga0157375_10103893
614 Ga0157375_10158174
615 Ga0163163_10000466
616 Ga0163163_10029203
617 Ga0157380_10000188
618 Ga0157377_10016406
619 Ga0157379_10010442
620 Ga0157376_10055570
621 Ga0207682_10061594
622 Ga0207642_10009682
623 Ga0207710_10000389
624 Ga0207688_10009828
625 Ga0207688_10114300
626 Ga0207645_10015612
627 Ga0207643_10001129
628 Ga0207643_10020307
629 Ga0207705_10041043
630 Ga0207684_10000083
631 Ga0207707_10000012
632 Ga0207707_10002760
633 Ga0207707_10015795
634 Ga0207707_10021170
635 Ga0207693_10039760
636 Ga0207660_10001050
637 Ga0207660_10011883
638 Ga0207660_10124727
639 Ga0207662_10031125
640 Ga0207652_10001285
641 Ga0207652_10050448
642 Ga0207652_10166778
643 Ga0207646_10006075
644 Ga0207681_10010472
645 Ga0207681_10023874
646 Ga0207681_10031671
647 Ga0207650_10000006
648 Ga0207650_10157820
649 Ga0207650_10244381
650 Ga0207644_10213179
651 Ga0207690_10004343
652 Ga0207690_10011300
653 Ga0207690_10032080
654 Ga0207706_10009165
655 Ga0207706_10016085
656 Ga0207686_10009924
657 Ga0207709_10087014
658 Ga0207670_10000236
659 Ga0207704_10011143
660 Ga0207704_10020308
661 Ga0207704_10030612
662 Ga0207704_10086330
663 Ga0207665_10022514
664 Ga0207691_10008611
665 Ga0207711_10004191
666 Ga0207711_10109806
667 Ga0207689_10002536
668 Ga0207689_10091962
669 Ga0207689_10172759
670 Ga0207689_10176400
671 Ga0207661_10000659
672 Ga0207661_10029359
673 Ga0207661_10066411
674 Ga0207661_10144480
675 Ga0207679_10005396
676 Ga0207679_10013846
677 Ga0207679_10020892
678 Ga0207679_10029348
679 Ga0207679_10066759
680 Ga0207667_10150220
681 Ga0207667_10152452
682 Ga0207651_10008666
683 Ga0207651_10195914
684 Ga0207712_10017290
685 Ga0207640_10175596
686 Ga0207658_10164583
687 Ga0207703_10184764
688 Ga0207639_10015732
689 Ga0207678_10196663
690 Ga0207708_10012864
691 Ga0207708_10038646
692 Ga0207702_10025855
693 Ga0207641_10105095
694 Ga0207648_10089521
695 Ga0207648_10091227
696 Ga0207676_10006815
697 Ga0207674_10000834
698 Ga0207674_10003778
699 Ga0207674_10007051
700 Ga0207674_10068021
701 Ga0207674_10130401
702 Ga0207674_10148528
703 Ga0207675_100003117
704 Ga0207675_100022340
705 Ga0207675_100028675
706 Ga0207675_100056048
707 Ga0207683_10012296
708 Ga0207683_10127280
709 Ga0209968_1006983
710 Ga0268266_10141588
711 Ga0268265_10033069
712 Ga0268265_10055846
713 Ga0307408_100007389
714 Ga0307408_100058290
715 Ga0307405_10007336
716 Ga0307413_10001317
717 Ga0307413_10079091
718 Ga0307406_10000571
719 Ga0307407_10046700
720 Ga0307412_10007059
721 Ga0307409_100105192
722 Ga0307409_100126277
723 Ga0307409_100185650
724 Ga0307416_100049119
725 Ga0307414_10014388
726 Ga0307414_10021049
727 Ga0307414_10098378
728 Ga0307411_10012828
729 Ga0307415_100017633
730 Ga0373944_0002300
731 Ga0373951_0003140
732 Ga0373943_0005645
733 Ga0373942_0005511
734 Ga0373927_0002599
735 Ga0373947_0000975
736 Ga0373937_0116155
737 Ga0373925_0001709
738 Ga0395898_0326292
739 Ga0466966_0056454
740 Ga0451576_0023656
741 Ga0466967_0232939
742 Ga0495603_0002024
743 Ga0495590_0035889
744 Ga0495629_0003783
745 Ga0495651_0039640
746 Ga0495580_0015645
747 Ga0495582_0003153
748 Ga0495639_0000175
749 Ga0495664_0006160
750 Ga0495630_0005659
751 Ga0495666_0001281
752 Ga0495665_0000126
753 Ga0495621_0015358
754 Ga0495645_0084122
755 Ga0495634_0001786
756 Ga0495588_0000742
757 Ga0495588_0012305
758 Ga0495599_0017205
759 Ga0495658_0000622
760 Ga0495613_0020842
761 Ga0495581_0003733
762 Ga0495674_0013264
763 Ga0495685_026034
764 Ga0495684_0002789
765 Ga0495593_0000199
766 Ga0495602_0125298
767 Ga0495614_0007404
768 Ga0496102_0010938
769 Ga0496106_0130713
770 Ga0496106_0168291
771 Ga0496109_0136869
772 Ga0496112_0000740
773 Ga0496112_0031350
774 Ga0501047_0030651
775 Ga0501076_0070900
776 Ga0501202_002390
777 Ga0501223_005881
778 Ga0501227_002240
779 Ga0501233_001572
780 Ga0501235_000854
781 Ga0501243_010681
782 Ga0501249_003904
783 Ga0501225_0003567
784 Ga0501079_0045070
785 Ga0501081_0085245
786 Ga0501266_005820
787 nmdc:mga05p37_103422_c1
788 nmdc:mga09592_116305_c1
789 nmdc:mga09592_14441_c1
790 nmdc:mga06r32_25712_c1
791 nmdc:mga06r32_73620_c1
792 nmdc:mga08y16_181568_c1
793 nmdc:mga08y16_86430_c1
794 nmdc:mga0n895_36030_c1
795 nmdc:mga0n895_41164_c1
796 nmdc:mga0n895_53683_c1
797 nmdc:mga0rr50_19621_c1
798 nmdc:mga0a205_10060_c1
799 nmdc:mga0a205_21072_c1
800 nmdc:mga0a205_31860_c1
801 nmdc:mga0a205_38389_c1
802 nmdc:mga0a205_41713_c1
803 nmdc:mga0a205_59234_c1
804 Ga0500628_000544

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07687

M20_dimer

Peptidase dimerisation domain

256

407

0.95

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

141

504

0.86

PF04389

Peptidase_M28

Peptidase family M28

126

282

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1q7l-assembly1.cif.gz_A zn-binding domain of the t347g mutant of human aminoacylase-i 0.8878 34 205
5vo3-assembly1.cif.gz_A-2 crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) 0.869 29 463
5vo3-assembly1.cif.gz_A-2 crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) 0.8626 29 463
7t1q-assembly1.cif.gz_B crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid 0.858 35 461
4h2k-assembly2.cif.gz_B crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae 0.8534 32 462
ID Description Score Start End Superfamily
af_Q55DP8_2_191_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8869 34 205 3.40.630.10
1q7lC00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8862 34 205 3.40.630.10
af_Q2FWN8_3_180_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8842 33 205 3.40.630.10
af_L7N684_5_212_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8785 22 200 3.40.630.10
af_Q4CR09_10_160_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8637 38 185 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A2V7AQC4-F1-model_v4 Peptidase M20 0.9773 26 139 GO:0005737
GO:0016787
GO:0046872
AF-A0A2V7KTL4-F1-model_v4 Peptidase M20 0.9645 24 458 GO:0016787
GO:0046872
AF-A0A800JSN1-F1-model_v4 deleted 0.9624 26 181
AF-A0A2V7AQC4-F1-model_v4 Peptidase M20 0.9607 26 139 GO:0005737
GO:0016787
GO:0046872
AF-A0A838PAF3-F1-model_v4 M20/M25/M40 family metallo-hydrolase 0.9595 17 191 GO:0016787

Map