F435105

General Info

Members Datasets Scaffolds Average Seq Length
402 191 804 434

Family's Representative Sequence

Representative Sequence 3300025922|Ga0207646_10078110|Ga0207646_100781103
Length 500
Sequence MLTNLSVLSVPRGGEIRGFVIVCALDGPRREEYYTHVVLRILYTVFPGRPEGRRYTGRDQRRIGAAAVTIAIGLALVGSPLAAPDPMAERFWAQWRGPYATGVSKYADPPVEWSETKNIRWKVEIPGRGSSSPVVWGDRIFLLTAVPTNVTGAAVHAPQGGVQPRHVHRYVVLAIDRKTGKTVWERVAREELPHEATHQDNGTYASSSAITDGRRVFAWFESQGMYVYDMDGKLLWSKDLGDKKMRSEFGEGSTPVLHDNRLVIVWDHQGQSFIVSLDAENGRELWRVNRDEIDTWSTPLVVEHDGRAQVIAPAMNKVRSYDLESGKVVWESPGVTMNPIPSPVFEDGMVFVMSGFRGNNLKAIRLAGAQGDLSKSDAIVWSLDRDTPYVPSPLLYNGVLYFLKTNSAILSAFDAKTGTPHYRLQRLDGLSEVFASPVGAKGRVYLPGREGVTLVIKHGATFEVLAKNKLDDGFDASPALVDNEMLLRGHEHLYSISAQR

Samples

Sample ID Description Type Environment
1 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
117 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
124 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
125 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
126 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
127 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
131 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
134 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
135 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
136 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
137 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
138 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
146 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
158 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
159 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
160 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
161 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
162 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
163 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
164 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
165 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
166 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
167 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
168 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
170 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
171 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
172 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
173 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
176 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
183 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
184 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
185 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
186 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
187 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
188 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
189 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
190 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
191 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.21
Nodule 0
Rhizoplane 1.74
Rhizosphere 91.04
Stem 0
Stem Tuber 0
Unclassified 16.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207646_10078110 3300025922 Bacteria 2958
2 Ga0065714_10111232 3300005288 Bacteria 1473
3 Ga0065704_10103668 3300005289 Bacteria 2165
4 Ga0065712_10071439 3300005290 Bacteria 5265
5 Ga0065712_10085174 3300005290 Bacteria 2714
6 Ga0065715_10027417 3300005293 Bacteria 1499
7 Ga0065715_10096292 3300005293 Unclassified 3909
8 Ga0065707_10083237 3300005295 Bacteria 9870
9 Ga0070676_10013237 3300005328 Bacteria 4518
10 Ga0070683_100246449 3300005329 Unclassified 1699
11 Ga0070690_100092823 3300005330 Bacteria 1991
12 Ga0070670_100015115 3300005331 Bacteria 6625
13 Ga0070677_10026959 3300005333 Unclassified 2159
14 Ga0068869_100013488 3300005334 Bacteria 5438
15 Ga0070666_10117696 3300005335 Unclassified 1841
16 Ga0070680_100197998 3300005336 Unclassified 1694
17 Ga0070689_100035439 3300005340 Bacteria 3813
18 Ga0070689_100061556 3300005340 Bacteria 2919
19 Ga0070687_100108690 3300005343 Bacteria 1566
20 Ga0070661_100003276 3300005344 Bacteria 11181
21 Ga0070669_100027505 3300005353 Bacteria 4092
22 Ga0070669_100070411 3300005353 Bacteria 2585
23 Ga0070669_100110008 3300005353 Bacteria 2090
24 Ga0070675_100003480 3300005354 Bacteria 11942
25 Ga0070675_100011230 3300005354 Bacteria 7012
26 Ga0070675_100060229 3300005354 Unclassified 3134
27 Ga0070675_100110414 3300005354 Bacteria 2326
28 Ga0070671_100020543 3300005355 Bacteria 5386
29 Ga0070671_100063754 3300005355 Unclassified 3069
30 Ga0070671_100112292 3300005355 Bacteria 2289
31 Ga0070671_100117290 3300005355 Bacteria 2238
32 Ga0070673_100001952 3300005364 Bacteria 12428
33 Ga0070673_100024957 3300005364 Bacteria 4392
34 Ga0070688_100005048 3300005365 Bacteria 6913
35 Ga0070688_100077355 3300005365 Bacteria 2143
36 Ga0070667_100104313 3300005367 Unclassified 2452
37 Ga0070667_100108854 3300005367 Unclassified 2401
38 Ga0070701_10029007 3300005438 Bacteria 2724
39 Ga0070700_100004477 3300005441 Bacteria 7301
40 Ga0070700_100075137 3300005441 Unclassified 2167
41 Ga0070694_100003190 3300005444 Bacteria 9782
42 Ga0070694_100033395 3300005444 Bacteria 3386
43 Ga0070694_100153642 3300005444 Unclassified 1683
44 Ga0070708_100075592 3300005445 Bacteria 3041
45 Ga0070663_100115900 3300005455 Bacteria 2019
46 Ga0070678_100085026 3300005456 Bacteria 2410
47 Ga0070662_100162256 3300005457 Bacteria 1749
48 Ga0068867_100014976 3300005459 Bacteria 5497
49 Ga0068867_100063822 3300005459 Bacteria 2738
50 Ga0070707_100083983 3300005468 Unclassified 3077
51 Ga0070707_100190073 3300005468 Bacteria 2002
52 Ga0070698_100234617 3300005471 Bacteria 1767
53 Ga0070699_100024329 3300005518 Bacteria 5219
54 Ga0070684_100002208 3300005535 Bacteria 14366
55 Ga0068853_100014004 3300005539 Bacteria 6562
56 Ga0070686_100113083 3300005544 Bacteria 1853
57 Ga0070695_100010207 3300005545 Bacteria 5603
58 Ga0070695_100010392 3300005545 Bacteria 5556
59 Ga0070695_100167343 3300005545 Bacteria 1548
60 Ga0070665_100057539 3300005548 Bacteria 3897
61 Ga0070665_100094924 3300005548 Bacteria 2987
62 Ga0070704_100002903 3300005549 Bacteria 9733
63 Ga0070704_100080360 3300005549 Bacteria 2398
64 Ga0070664_100003916 3300005564 Bacteria 12014
65 Ga0070664_100056821 3300005564 Bacteria 3325
66 Ga0070664_100115197 3300005564 Bacteria 2349
67 Ga0068854_100016961 3300005578 Bacteria 4866
68 Ga0068854_100187482 3300005578 Bacteria 1619
69 Ga0070702_100001744 3300005615 Bacteria 9042
70 Ga0068859_100043610 3300005617 Bacteria 4508
71 Ga0068859_100110470 3300005617 Bacteria 2811
72 Ga0068861_100000919 3300005719 Bacteria 17862
73 Ga0068861_100161214 3300005719 Bacteria 1850
74 Ga0068870_10066623 3300005840 Unclassified 1951
75 Ga0068863_100005265 3300005841 Bacteria 12769
76 Ga0068863_100066787 3300005841 Bacteria 3402
77 Ga0068858_100022633 3300005842 Bacteria 5861
78 Ga0068860_100024281 3300005843 Bacteria 5861
79 Ga0068862_100046899 3300005844 Bacteria 3686
80 Ga0068862_100048658 3300005844 Bacteria 3620
81 Ga0075365_10019634 3300006038 Bacteria 4176
82 Ga0075365_10059518 3300006038 Bacteria 2546
83 Ga0075365_10086427 3300006038 Bacteria 2131
84 Ga0075368_10002745 3300006042 Bacteria 5811
85 Ga0075368_10020153 3300006042 Bacteria 2522
86 Ga0075364_10000379 3300006051 Bacteria 21989
87 Ga0075364_10011842 3300006051 Bacteria 5310
88 Ga0075364_10130341 3300006051 Bacteria 1687
89 Ga0075367_10012601 3300006178 Bacteria 4517
90 Ga0075367_10130303 3300006178 Unclassified 1554
91 Ga0075366_10004010 3300006195 Bacteria 7870
92 Ga0075366_10007592 3300006195 Bacteria 6000
93 Ga0075366_10008951 3300006195 Bacteria 5581
94 Ga0075366_10073805 3300006195 Bacteria 2034
95 Ga0075366_10089036 3300006195 Bacteria 1848
96 Ga0097621_100279031 3300006237 Unclassified 1470
97 Ga0075370_10080505 3300006353 Bacteria 1871
98 Ga0075428_100002126 3300006844 Bacteria 21387
99 Ga0075428_100037187 3300006844 Bacteria 5360
100 Ga0075428_100272660 3300006844 Bacteria 1820
101 Ga0075430_100076335 3300006846 Bacteria 2809
102 Ga0075431_100001356 3300006847 Bacteria 22428
103 Ga0075431_100030000 3300006847 Bacteria 5600
104 Ga0075431_100036020 3300006847 Bacteria 5096
105 Ga0075431_100066993 3300006847 Unclassified 3707
106 Ga0075433_10035154 3300006852 Bacteria 4307
107 Ga0075433_10045466 3300006852 Bacteria 3817
108 Ga0075433_10047444 3300006852 Unclassified 3736
109 Ga0075433_10064647 3300006852 Bacteria 3207
110 Ga0075433_10156045 3300006852 Bacteria 2031
111 Ga0075434_100001425 3300006871 Bacteria 20082
112 Ga0075429_100032555 3300006880 Unclassified 4532
113 Ga0075429_100216289 3300006880 Unclassified 1679
114 Ga0068865_100077788 3300006881 Bacteria 2372
115 Ga0097620_100043610 3300006931 Bacteria 4508
116 Ga0097620_100110466 3300006931 Bacteria 2811
117 Ga0075435_100012743 3300007076 Bacteria 6231
118 Ga0075435_100022617 3300007076 Bacteria 4850
119 Ga0075435_100027798 3300007076 Unclassified 4428
120 Ga0111539_10000005 3300009094 Bacteria 467342
121 Ga0111539_10001760 3300009094 Bacteria 28745
122 Ga0111539_10004273 3300009094 Bacteria 18702
123 Ga0111539_10013132 3300009094 Bacteria 10358
124 Ga0111539_10032850 3300009094 Bacteria 6302
125 Ga0111539_10051499 3300009094 Bacteria 4903
126 Ga0111539_10068418 3300009094 Bacteria 4193
127 Ga0111539_10095643 3300009094 Bacteria 3489
128 Ga0111539_10148807 3300009094 Bacteria 2741
129 Ga0111539_10180088 3300009094 Bacteria 2469
130 Ga0111539_10212467 3300009094 Bacteria 2254
131 Ga0111539_10261360 3300009094 Bacteria 2015
132 Ga0111539_10277055 3300009094 Bacteria 1952
133 Ga0111539_10510629 3300009094 Bacteria 1400
134 Ga0105245_10094381 3300009098 Bacteria 2757
135 Ga0114129_10000986 3300009147 Bacteria 37220
136 Ga0114129_10002872 3300009147 Bacteria 24114
137 Ga0114129_10007966 3300009147 Bacteria 15084
138 Ga0114129_10017404 3300009147 Bacteria 10237
139 Ga0114129_10019655 3300009147 Bacteria 9615
140 Ga0114129_10019735 3300009147 Bacteria 9593
141 Ga0114129_10087077 3300009147 Bacteria 4332
142 Ga0114129_10181318 3300009147 Bacteria 2865
143 Ga0114129_10355304 3300009147 Bacteria 1940
144 Ga0105243_10129629 3300009148 Bacteria 2138
145 Ga0105243_10181337 3300009148 Bacteria 1831
146 Ga0105242_10024932 3300009176 Bacteria 4727
147 Ga0105242_10031647 3300009176 Bacteria 4228
148 Ga0105248_10062438 3300009177 Unclassified 4183
149 Ga0105248_10065383 3300009177 Bacteria 4084
150 Ga0105249_10053645 3300009553 Bacteria 3685
151 Ga0157374_10056955 3300013296 Bacteria 3650
152 Ga0157375_10482190 3300013308 Bacteria 1405
153 Ga0163163_10046110 3300014325 Bacteria 4280
154 Ga0157380_10006839 3300014326 Bacteria 8061
155 Ga0157380_10080296 3300014326 Bacteria 2666
156 Ga0157380_10199204 3300014326 Unclassified 1775
157 Ga0157380_10256878 3300014326 Bacteria 1585
158 Ga0157377_10008713 3300014745 Bacteria 4958
159 Ga0157377_10038974 3300014745 Unclassified 2627
160 Ga0157376_10063233 3300014969 Bacteria 3117
161 Ga0207680_10072510 3300025903 Unclassified 2138
162 Ga0207645_10006300 3300025907 Bacteria 8531
163 Ga0207684_10048114 3300025910 Bacteria 3616
164 Ga0207662_10004919 3300025918 Bacteria 7062
165 Ga0207681_10004517 3300025923 Bacteria 8571
166 Ga0207681_10012385 3300025923 Bacteria 5263
167 Ga0207681_10134069 3300025923 Bacteria 1835
168 Ga0207650_10009428 3300025925 Bacteria 6672
169 Ga0207650_10047236 3300025925 Unclassified 3172
170 Ga0207659_10008781 3300025926 Bacteria 6295
171 Ga0207659_10010092 3300025926 Bacteria 5919
172 Ga0207687_10050202 3300025927 Bacteria 2903
173 Ga0207644_10021801 3300025931 Bacteria 4368
174 Ga0207644_10049037 3300025931 Bacteria 3021
175 Ga0207644_10059119 3300025931 Unclassified 2772
176 Ga0207706_10236467 3300025933 Bacteria 1597
177 Ga0207686_10070319 3300025934 Bacteria 2248
178 Ga0207709_10026796 3300025935 Bacteria 3314
179 Ga0207670_10037200 3300025936 Bacteria 3171
180 Ga0207670_10053937 3300025936 Bacteria 2710
181 Ga0207669_10010392 3300025937 Bacteria 4479
182 Ga0207691_10008298 3300025940 Bacteria 9974
183 Ga0207691_10074898 3300025940 Bacteria 3053
184 Ga0207689_10077908 3300025942 Bacteria 2724
185 Ga0207689_10087765 3300025942 Bacteria 2555
186 Ga0207661_10035201 3300025944 Bacteria 3899
187 Ga0207679_10052518 3300025945 Bacteria 2989
188 Ga0207651_10171073 3300025960 Unclassified 1713
189 Ga0207668_10102716 3300025972 Unclassified 2127
190 Ga0207640_10155319 3300025981 Bacteria 1686
191 Ga0207658_10065414 3300025986 Unclassified 2731
192 Ga0207703_10184099 3300026035 Unclassified 1845
193 Ga0207639_10032653 3300026041 Bacteria 3834
194 Ga0207678_10204425 3300026067 Unclassified 1689
195 Ga0207708_10001623 3300026075 Bacteria 16732
196 Ga0207708_10017283 3300026075 Bacteria 5430
197 Ga0207708_10055599 3300026075 Unclassified 3017
198 Ga0207641_10000398 3300026088 Bacteria 51077
199 Ga0207648_10016658 3300026089 Bacteria 6708
200 Ga0207648_10155799 3300026089 Bacteria 2016
201 Ga0207674_10290357 3300026116 Bacteria 1584
202 Ga0207675_100001162 3300026118 Bacteria 26204
203 Ga0207675_100028191 3300026118 Bacteria 5229
204 Ga0207675_100044930 3300026118 Bacteria 4127
205 Ga0207675_100102099 3300026118 Bacteria 2702
206 Ga0207683_10036354 3300026121 Bacteria 4288
207 Ga0207428_10000039 3300027907 Bacteria 213218
208 Ga0207428_10009969 3300027907 Bacteria 8505
209 Ga0207428_10010470 3300027907 Bacteria 8278
210 Ga0207428_10064097 3300027907 Bacteria 2902
211 Ga0207428_10112224 3300027907 Bacteria 2097
212 Ga0268266_10150509 3300028379 Bacteria 2097
213 Ga0268265_10046440 3300028380 Bacteria 3246
214 Ga0268264_10007391 3300028381 Bacteria 9173
215 Ga0307408_100007222 3300031548 Bacteria 7347
216 Ga0307408_100065265 3300031548 Bacteria 2669
217 Ga0316576_10006893 3300031727 Bacteria 7104
218 Ga0316578_10021205 3300031728 Bacteria 3604
219 Ga0307405_10006691 3300031731 Bacteria 5693
220 Ga0307413_10063883 3300031824 Bacteria 2284
221 Ga0307410_10030826 3300031852 Unclassified 3432
222 Ga0307410_10080572 3300031852 Unclassified 2284
223 Ga0307409_100036626 3300031995 Bacteria 3609
224 Ga0307409_100071396 3300031995 Bacteria 2760
225 Ga0307416_100005873 3300032002 Bacteria 7616
226 Ga0307416_100007331 3300032002 Bacteria 7001
227 Ga0307416_100027382 3300032002 Bacteria 4220
228 Ga0307416_100274501 3300032002 Unclassified 1658
229 Ga0307411_10000360 3300032005 Bacteria 15443
230 Ga0307411_10055776 3300032005 Unclassified 2601
231 Ga0307411_10079152 3300032005 Bacteria 2256
232 Ga0307415_100039616 3300032126 Bacteria 3116
233 Ga0307415_100174875 3300032126 Bacteria 1678
234 Ga0373936_0042242 3300035113 Bacteria 1830
235 Ga0316574_0036970 3300035398 Bacteria 2992
236 Ga0373931_0032029 3300035691 Bacteria 2718
237 Ga0373947_0065338 3300035725 Bacteria 2219
238 Ga0373937_0026192 3300036401 Bacteria 5269
239 Ga0316582_0008625 3300036647 Bacteria 5486
240 Ga0316584_0004541 3300036712 Bacteria 9194
241 Ga0373925_0003457 3300037068 Bacteria 12215
242 Ga0439453_0003201 3300041408 Bacteria 2334
243 Ga0439433_0006951 3300041999 Unclassified 2441
244 Ga0450894_006009 3300042131 Bacteria 1570
245 Ga0439464_0007201 3300042439 Bacteria 2907
246 Ga0439460_0004556 3300042461 Unclassified 3382
247 Ga0439460_0022332 3300042461 Bacteria 1735
248 Ga0439460_0029249 3300042461 Bacteria 1559
249 Ga0495684_0161981 3300047471 Bacteria 1668
250 Ga0496104_0013219 3300048907 Bacteria 7442
251 Ga0496108_0004362 3300048911 Bacteria 11379
252 Ga0496109_0022592 3300048912 Bacteria 5572
253 Ga0496110_0000313 3300048913 Bacteria 32036
254 Ga0496111_0024641 3300048914 Bacteria 4240
255 Ga0496112_0001772 3300048915 Bacteria 16946
256 Ga0496112_0104812 3300048915 Unclassified 2798
257 Ga0501299_015422 3300049522 Archaea 1342
258 Ga0501033_0071209 3300049570 Bacteria 2554
259 Ga0501036_0010488 3300049572 Bacteria 7655
260 Ga0501036_0020875 3300049572 Bacteria 5501
261 Ga0501036_0151632 3300049572 Unclassified 1955
262 Ga0501037_0099256 3300049573 Bacteria 2103
263 Ga0501038_0080779 3300049574 Bacteria 2740
264 Ga0501039_0008715 3300049575 Bacteria 7723
265 Ga0501040_0001512 3300049576 Bacteria 14761
266 Ga0501040_0022003 3300049576 Bacteria 4263
267 Ga0501040_0054676 3300049576 Bacteria 2737
268 Ga0501040_0077211 3300049576 Unclassified 2304
269 Ga0501041_0020351 3300049577 Bacteria 3967
270 Ga0501041_0025191 3300049577 Bacteria 3576
271 Ga0501041_0045865 3300049577 Bacteria 2658
272 Ga0501041_0051720 3300049577 Bacteria 2504
273 Ga0501042_0015194 3300049578 Bacteria 5268
274 Ga0501042_0016422 3300049578 Bacteria 5080
275 Ga0501043_0043483 3300049579 Bacteria 3530
276 Ga0501046_0032319 3300049580 Bacteria 4237
277 Ga0501048_0006729 3300049582 Bacteria 8731
278 Ga0501048_0217359 3300049582 Bacteria 1355
279 Ga0501069_0082196 3300049585 Bacteria 1815
280 Ga0501071_0003090 3300049587 Bacteria 10323
281 Ga0501071_0015992 3300049587 Bacteria 5156
282 Ga0501071_0026778 3300049587 Bacteria 4050
283 Ga0501071_0027033 3300049587 Bacteria 4034
284 Ga0501071_0031910 3300049587 Bacteria 3738
285 Ga0501071_0078794 3300049587 Bacteria 2408
286 Ga0501071_0172256 3300049587 Bacteria 1620
287 Ga0501072_0030962 3300049588 Bacteria 4186
288 Ga0501072_0123038 3300049588 Bacteria 2067
289 Ga0501072_0141746 3300049588 Bacteria 1917
290 Ga0501073_0013913 3300049589 Bacteria 5848
291 Ga0501073_0104124 3300049589 Bacteria 1970
292 Ga0501073_0104792 3300049589 Bacteria 1963
293 Ga0501074_0034582 3300049590 Bacteria 3663
294 Ga0501074_0055454 3300049590 Bacteria 2856
295 Ga0501074_0160858 3300049590 Bacteria 1604
296 Ga0501074_0173617 3300049590 Bacteria 1538
297 Ga0501075_0000145 3300049591 Bacteria 35489
298 Ga0501075_0005809 3300049591 Bacteria 8443
299 Ga0501075_0027002 3300049591 Bacteria 4230
300 Ga0501075_0028690 3300049591 Unclassified 4109
301 Ga0501075_0089698 3300049591 Bacteria 2331
302 Ga0501075_0185200 3300049591 Unclassified 1588
303 Ga0501076_0002289 3300049592 Bacteria 13100
304 Ga0501076_0012747 3300049592 Bacteria 6293
305 Ga0501076_0023573 3300049592 Bacteria 4746
306 Ga0501076_0033619 3300049592 Bacteria 4004
307 Ga0501076_0044128 3300049592 Bacteria 3515
308 Ga0501076_0056554 3300049592 Unclassified 3114
309 Ga0501076_0192638 3300049592 Unclassified 1664
310 Ga0501076_0199870 3300049592 Unclassified 1632
311 Ga0501076_0258904 3300049592 Bacteria 1424
312 Ga0501077_0006074 3300049593 Bacteria 7371
313 Ga0501077_0041643 3300049593 Unclassified 2923
314 Ga0501079_0013272 3300049741 Bacteria 6281
315 Ga0501079_0021962 3300049741 Bacteria 4888
316 Ga0501079_0046889 3300049741 Bacteria 3334
317 Ga0501079_0182091 3300049741 Unclassified 1640
318 Ga0501080_0021144 3300049742 Bacteria 6022
319 Ga0501080_0060205 3300049742 Bacteria 3534
320 Ga0501080_0382814 3300049742 Unclassified 1267
321 Ga0501081_0000801 3300049743 Bacteria 18536
322 Ga0501081_0001884 3300049743 Bacteria 13029
323 Ga0501081_0054103 3300049743 Unclassified 2773
324 Ga0501081_0115165 3300049743 Bacteria 1911
325 Ga0501081_0187454 3300049743 Bacteria 1497
326 Ga0501083_0043878 3300049744 Bacteria 3028
327 Ga0501045_0002728 3300049824 Bacteria 12055
328 Ga0501045_0005626 3300049824 Bacteria 8677
329 Ga0501045_0097650 3300049824 Unclassified 2173
330 Ga0501045_0136716 3300049824 Bacteria 1822
331 Ga0501045_0186533 3300049824 Unclassified 1546
332 nmdc:mga00v17_4575_c1 3300050491 Bacteria 7212
333 nmdc:mga00v17_76479_c1 3300050491 Bacteria 2083
334 nmdc:mga0yw44_170473_c1 3300050492 Unclassified 1429
335 nmdc:mga0yw44_23037_c1 3300050492 Bacteria 3503
336 nmdc:mga0yw44_68815_c1 3300050492 Bacteria 2191
337 nmdc:mga0k408_15500_c1 3300050493 Bacteria 4216
338 nmdc:mga0k408_25063_c1 3300050493 Unclassified 1678
339 nmdc:mga0k408_36616_c2 3300050493 Unclassified 1730
340 nmdc:mga0k408_5512_c1 3300050493 Bacteria 6735
341 nmdc:mga06z11_108146_c1 3300050494 Unclassified 1536
342 nmdc:mga06z11_8451_c1 3300050494 Bacteria 4293
343 nmdc:mga05p37_12196_c1 3300050507 Bacteria 9906
344 nmdc:mga05p37_13148_c1 3300050507 Bacteria 9909
345 nmdc:mga05p37_21125_c1 3300050507 Bacteria 7880
346 nmdc:mga05p37_21172_c1 3300050507 Bacteria 7872
347 nmdc:mga05p37_4424_c1 3300050507 Bacteria 16417
348 nmdc:mga05p37_61644_c1 3300050507 Unclassified 4617
349 nmdc:mga05p37_7007_c1 3300050507 Bacteria 13286
350 nmdc:mga05p37_71388_c1 3300050507 Bacteria 4271
351 nmdc:mga05p37_75215_c1 3300050507 Bacteria 4157
352 nmdc:mga05p37_88162_c1 3300050507 Bacteria 3825
353 nmdc:mga09592_108830_c1 3300050508 Unclassified 2377
354 nmdc:mga09592_294484_c1 3300050508 Bacteria 1407
355 nmdc:mga09592_38926_c1 3300050508 Bacteria 3993
356 nmdc:mga0qj67_124388_c1 3300050509 Unclassified 2087
357 nmdc:mga0qj67_237644_c1 3300050509 Bacteria 1478
358 nmdc:mga06r32_145959_c1 3300050510 Unclassified 2343
359 nmdc:mga06r32_3019_c1 3300050510 Bacteria 15084
360 nmdc:mga06r32_66529_c1 3300050510 Bacteria 3477
361 nmdc:mga08y16_211018_c1 3300050511 Unclassified 2011
362 nmdc:mga08y16_2808_c1 3300050511 Bacteria 17878
363 nmdc:mga08y16_45352_c1 3300050511 Bacteria 4606
364 nmdc:mga08y16_49368_c1 3300050511 Bacteria 4404
365 nmdc:mga08y16_54483_c1 3300050511 Bacteria 4179
366 nmdc:mga08y16_60975_c1 3300050511 Unclassified 3939
367 nmdc:mga08y16_61618_c1 3300050511 Bacteria 3917
368 nmdc:mga08y16_68399_c1 3300050511 Bacteria 3703
369 nmdc:mga08y16_6_c1 3300050511 Bacteria 622294
370 nmdc:mga08y16_99311_c1 3300050511 Bacteria 3031
371 nmdc:mga0n895_110101_c1 3300050512 Unclassified 2770
372 nmdc:mga0n895_28059_c1 3300050512 Bacteria 5352
373 nmdc:mga0n895_5195_c1 3300050512 Bacteria 10834
374 nmdc:mga0rr50_256145_c1 3300050513 Bacteria 1455
375 nmdc:mga0rr50_97132_c1 3300050513 Bacteria 2306
376 nmdc:mga08x19_28682_c1 3300050514 Bacteria 3488
377 nmdc:mga0a205_18407_c1 3300050515 Bacteria 6567
378 nmdc:mga0a205_56287_c1 3300050515 Unclassified 3797
379 nmdc:mga0a205_82880_c1 3300050515 Bacteria 3098
380 nmdc:mga0a205_949_c1 3300050515 Bacteria 23912
381 Ga0500628_005158 3300053129 Bacteria 2175
382 Ga0500568_0008480 3300053139 Bacteria 4945
383 Ga0501084_0002829 3300054114 Bacteria 14003
384 Ga0501084_0003697 3300054114 Bacteria 12417
385 Ga0501084_0155126 3300054114 Bacteria 1931
386 Ga0501084_0264505 3300054114 Bacteria 1452
387 Ga0590071_000826 3300059421 Bacteria 8638
388 Ga0590071_002425 3300059421 Bacteria 4686
389 Ga0590071_008842 3300059421 Bacteria 2367
390 Ga0590074_004757 3300059423 Unclassified 2240
391 Ga0590075_002687 3300059424 Unclassified 4252
392 Ga0590077_000112 3300059426 Bacteria 21872
393 Ga0590077_000363 3300059426 Bacteria 12745
394 Ga0590077_002103 3300059426 Bacteria 4356
395 Ga0501082_0026239 3300060353 Bacteria 5020
396 Ga0501082_0038493 3300060353 Bacteria 4126
397 Ga0501082_0067117 3300060353 Bacteria 3089
398 Ga0501082_0083877 3300060353 Bacteria 2749
399 Ga0530510_0005468 3300061734 Bacteria 8793
400 Ga0530510_0017065 3300061734 Bacteria 5141
401 Ga0530510_0097846 3300061734 Bacteria 2145
402 Ga0530510_0117342 3300061734 Bacteria 1952
403 Ga0207646_10078110
404 Ga0065714_10111232
405 Ga0065704_10103668
406 Ga0065712_10071439
407 Ga0065712_10085174
408 Ga0065715_10027417
409 Ga0065715_10096292
410 Ga0065707_10083237
411 Ga0070676_10013237
412 Ga0070683_100246449
413 Ga0070690_100092823
414 Ga0070670_100015115
415 Ga0070677_10026959
416 Ga0068869_100013488
417 Ga0070666_10117696
418 Ga0070680_100197998
419 Ga0070689_100035439
420 Ga0070689_100061556
421 Ga0070687_100108690
422 Ga0070661_100003276
423 Ga0070669_100027505
424 Ga0070669_100070411
425 Ga0070669_100110008
426 Ga0070675_100003480
427 Ga0070675_100011230
428 Ga0070675_100060229
429 Ga0070675_100110414
430 Ga0070671_100020543
431 Ga0070671_100063754
432 Ga0070671_100112292
433 Ga0070671_100117290
434 Ga0070673_100001952
435 Ga0070673_100024957
436 Ga0070688_100005048
437 Ga0070688_100077355
438 Ga0070667_100104313
439 Ga0070667_100108854
440 Ga0070701_10029007
441 Ga0070700_100004477
442 Ga0070700_100075137
443 Ga0070694_100003190
444 Ga0070694_100033395
445 Ga0070694_100153642
446 Ga0070708_100075592
447 Ga0070663_100115900
448 Ga0070678_100085026
449 Ga0070662_100162256
450 Ga0068867_100014976
451 Ga0068867_100063822
452 Ga0070707_100083983
453 Ga0070707_100190073
454 Ga0070698_100234617
455 Ga0070699_100024329
456 Ga0070684_100002208
457 Ga0068853_100014004
458 Ga0070686_100113083
459 Ga0070695_100010207
460 Ga0070695_100010392
461 Ga0070695_100167343
462 Ga0070665_100057539
463 Ga0070665_100094924
464 Ga0070704_100002903
465 Ga0070704_100080360
466 Ga0070664_100003916
467 Ga0070664_100056821
468 Ga0070664_100115197
469 Ga0068854_100016961
470 Ga0068854_100187482
471 Ga0070702_100001744
472 Ga0068859_100043610
473 Ga0068859_100110470
474 Ga0068861_100000919
475 Ga0068861_100161214
476 Ga0068870_10066623
477 Ga0068863_100005265
478 Ga0068863_100066787
479 Ga0068858_100022633
480 Ga0068860_100024281
481 Ga0068862_100046899
482 Ga0068862_100048658
483 Ga0075365_10019634
484 Ga0075365_10059518
485 Ga0075365_10086427
486 Ga0075368_10002745
487 Ga0075368_10020153
488 Ga0075364_10000379
489 Ga0075364_10011842
490 Ga0075364_10130341
491 Ga0075367_10012601
492 Ga0075367_10130303
493 Ga0075366_10004010
494 Ga0075366_10007592
495 Ga0075366_10008951
496 Ga0075366_10073805
497 Ga0075366_10089036
498 Ga0097621_100279031
499 Ga0075370_10080505
500 Ga0075428_100002126
501 Ga0075428_100037187
502 Ga0075428_100272660
503 Ga0075430_100076335
504 Ga0075431_100001356
505 Ga0075431_100030000
506 Ga0075431_100036020
507 Ga0075431_100066993
508 Ga0075433_10035154
509 Ga0075433_10045466
510 Ga0075433_10047444
511 Ga0075433_10064647
512 Ga0075433_10156045
513 Ga0075434_100001425
514 Ga0075429_100032555
515 Ga0075429_100216289
516 Ga0068865_100077788
517 Ga0097620_100043610
518 Ga0097620_100110466
519 Ga0075435_100012743
520 Ga0075435_100022617
521 Ga0075435_100027798
522 Ga0111539_10000005
523 Ga0111539_10001760
524 Ga0111539_10004273
525 Ga0111539_10013132
526 Ga0111539_10032850
527 Ga0111539_10051499
528 Ga0111539_10068418
529 Ga0111539_10095643
530 Ga0111539_10148807
531 Ga0111539_10180088
532 Ga0111539_10212467
533 Ga0111539_10261360
534 Ga0111539_10277055
535 Ga0111539_10510629
536 Ga0105245_10094381
537 Ga0114129_10000986
538 Ga0114129_10002872
539 Ga0114129_10007966
540 Ga0114129_10017404
541 Ga0114129_10019655
542 Ga0114129_10019735
543 Ga0114129_10087077
544 Ga0114129_10181318
545 Ga0114129_10355304
546 Ga0105243_10129629
547 Ga0105243_10181337
548 Ga0105242_10024932
549 Ga0105242_10031647
550 Ga0105248_10062438
551 Ga0105248_10065383
552 Ga0105249_10053645
553 Ga0157374_10056955
554 Ga0157375_10482190
555 Ga0163163_10046110
556 Ga0157380_10006839
557 Ga0157380_10080296
558 Ga0157380_10199204
559 Ga0157380_10256878
560 Ga0157377_10008713
561 Ga0157377_10038974
562 Ga0157376_10063233
563 Ga0207680_10072510
564 Ga0207645_10006300
565 Ga0207684_10048114
566 Ga0207662_10004919
567 Ga0207681_10004517
568 Ga0207681_10012385
569 Ga0207681_10134069
570 Ga0207650_10009428
571 Ga0207650_10047236
572 Ga0207659_10008781
573 Ga0207659_10010092
574 Ga0207687_10050202
575 Ga0207644_10021801
576 Ga0207644_10049037
577 Ga0207644_10059119
578 Ga0207706_10236467
579 Ga0207686_10070319
580 Ga0207709_10026796
581 Ga0207670_10037200
582 Ga0207670_10053937
583 Ga0207669_10010392
584 Ga0207691_10008298
585 Ga0207691_10074898
586 Ga0207689_10077908
587 Ga0207689_10087765
588 Ga0207661_10035201
589 Ga0207679_10052518
590 Ga0207651_10171073
591 Ga0207668_10102716
592 Ga0207640_10155319
593 Ga0207658_10065414
594 Ga0207703_10184099
595 Ga0207639_10032653
596 Ga0207678_10204425
597 Ga0207708_10001623
598 Ga0207708_10017283
599 Ga0207708_10055599
600 Ga0207641_10000398
601 Ga0207648_10016658
602 Ga0207648_10155799
603 Ga0207674_10290357
604 Ga0207675_100001162
605 Ga0207675_100028191
606 Ga0207675_100044930
607 Ga0207675_100102099
608 Ga0207683_10036354
609 Ga0207428_10000039
610 Ga0207428_10009969
611 Ga0207428_10010470
612 Ga0207428_10064097
613 Ga0207428_10112224
614 Ga0268266_10150509
615 Ga0268265_10046440
616 Ga0268264_10007391
617 Ga0307408_100007222
618 Ga0307408_100065265
619 Ga0316576_10006893
620 Ga0316578_10021205
621 Ga0307405_10006691
622 Ga0307413_10063883
623 Ga0307410_10030826
624 Ga0307410_10080572
625 Ga0307409_100036626
626 Ga0307409_100071396
627 Ga0307416_100005873
628 Ga0307416_100007331
629 Ga0307416_100027382
630 Ga0307416_100274501
631 Ga0307411_10000360
632 Ga0307411_10055776
633 Ga0307411_10079152
634 Ga0307415_100039616
635 Ga0307415_100174875
636 Ga0373936_0042242
637 Ga0316574_0036970
638 Ga0373931_0032029
639 Ga0373947_0065338
640 Ga0373937_0026192
641 Ga0316582_0008625
642 Ga0316584_0004541
643 Ga0373925_0003457
644 Ga0439453_0003201
645 Ga0439433_0006951
646 Ga0450894_006009
647 Ga0439464_0007201
648 Ga0439460_0004556
649 Ga0439460_0022332
650 Ga0439460_0029249
651 Ga0495684_0161981
652 Ga0496104_0013219
653 Ga0496108_0004362
654 Ga0496109_0022592
655 Ga0496110_0000313
656 Ga0496111_0024641
657 Ga0496112_0001772
658 Ga0496112_0104812
659 Ga0501299_015422
660 Ga0501033_0071209
661 Ga0501036_0010488
662 Ga0501036_0020875
663 Ga0501036_0151632
664 Ga0501037_0099256
665 Ga0501038_0080779
666 Ga0501039_0008715
667 Ga0501040_0001512
668 Ga0501040_0022003
669 Ga0501040_0054676
670 Ga0501040_0077211
671 Ga0501041_0020351
672 Ga0501041_0025191
673 Ga0501041_0045865
674 Ga0501041_0051720
675 Ga0501042_0015194
676 Ga0501042_0016422
677 Ga0501043_0043483
678 Ga0501046_0032319
679 Ga0501048_0006729
680 Ga0501048_0217359
681 Ga0501069_0082196
682 Ga0501071_0003090
683 Ga0501071_0015992
684 Ga0501071_0026778
685 Ga0501071_0027033
686 Ga0501071_0031910
687 Ga0501071_0078794
688 Ga0501071_0172256
689 Ga0501072_0030962
690 Ga0501072_0123038
691 Ga0501072_0141746
692 Ga0501073_0013913
693 Ga0501073_0104124
694 Ga0501073_0104792
695 Ga0501074_0034582
696 Ga0501074_0055454
697 Ga0501074_0160858
698 Ga0501074_0173617
699 Ga0501075_0000145
700 Ga0501075_0005809
701 Ga0501075_0027002
702 Ga0501075_0028690
703 Ga0501075_0089698
704 Ga0501075_0185200
705 Ga0501076_0002289
706 Ga0501076_0012747
707 Ga0501076_0023573
708 Ga0501076_0033619
709 Ga0501076_0044128
710 Ga0501076_0056554
711 Ga0501076_0192638
712 Ga0501076_0199870
713 Ga0501076_0258904
714 Ga0501077_0006074
715 Ga0501077_0041643
716 Ga0501079_0013272
717 Ga0501079_0021962
718 Ga0501079_0046889
719 Ga0501079_0182091
720 Ga0501080_0021144
721 Ga0501080_0060205
722 Ga0501080_0382814
723 Ga0501081_0000801
724 Ga0501081_0001884
725 Ga0501081_0054103
726 Ga0501081_0115165
727 Ga0501081_0187454
728 Ga0501083_0043878
729 Ga0501045_0002728
730 Ga0501045_0005626
731 Ga0501045_0097650
732 Ga0501045_0136716
733 Ga0501045_0186533
734 nmdc:mga00v17_4575_c1
735 nmdc:mga00v17_76479_c1
736 nmdc:mga0yw44_170473_c1
737 nmdc:mga0yw44_23037_c1
738 nmdc:mga0yw44_68815_c1
739 nmdc:mga0k408_15500_c1
740 nmdc:mga0k408_25063_c1
741 nmdc:mga0k408_36616_c2
742 nmdc:mga0k408_5512_c1
743 nmdc:mga06z11_108146_c1
744 nmdc:mga06z11_8451_c1
745 nmdc:mga05p37_12196_c1
746 nmdc:mga05p37_13148_c1
747 nmdc:mga05p37_21125_c1
748 nmdc:mga05p37_21172_c1
749 nmdc:mga05p37_4424_c1
750 nmdc:mga05p37_61644_c1
751 nmdc:mga05p37_7007_c1
752 nmdc:mga05p37_71388_c1
753 nmdc:mga05p37_75215_c1
754 nmdc:mga05p37_88162_c1
755 nmdc:mga09592_108830_c1
756 nmdc:mga09592_294484_c1
757 nmdc:mga09592_38926_c1
758 nmdc:mga0qj67_124388_c1
759 nmdc:mga0qj67_237644_c1
760 nmdc:mga06r32_145959_c1
761 nmdc:mga06r32_3019_c1
762 nmdc:mga06r32_66529_c1
763 nmdc:mga08y16_211018_c1
764 nmdc:mga08y16_2808_c1
765 nmdc:mga08y16_45352_c1
766 nmdc:mga08y16_49368_c1
767 nmdc:mga08y16_54483_c1
768 nmdc:mga08y16_60975_c1
769 nmdc:mga08y16_61618_c1
770 nmdc:mga08y16_68399_c1
771 nmdc:mga08y16_6_c1
772 nmdc:mga08y16_99311_c1
773 nmdc:mga0n895_110101_c1
774 nmdc:mga0n895_28059_c1
775 nmdc:mga0n895_5195_c1
776 nmdc:mga0rr50_256145_c1
777 nmdc:mga0rr50_97132_c1
778 nmdc:mga08x19_28682_c1
779 nmdc:mga0a205_18407_c1
780 nmdc:mga0a205_56287_c1
781 nmdc:mga0a205_82880_c1
782 nmdc:mga0a205_949_c1
783 Ga0500628_005158
784 Ga0500568_0008480
785 Ga0501084_0002829
786 Ga0501084_0003697
787 Ga0501084_0155126
788 Ga0501084_0264505
789 Ga0590071_000826
790 Ga0590071_002425
791 Ga0590071_008842
792 Ga0590074_004757
793 Ga0590075_002687
794 Ga0590077_000112
795 Ga0590077_000363
796 Ga0590077_002103
797 Ga0501082_0026239
798 Ga0501082_0038493
799 Ga0501082_0067117
800 Ga0501082_0083877
801 Ga0530510_0005468
802 Ga0530510_0017065
803 Ga0530510_0097846
804 Ga0530510_0117342

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13570

PQQ_3

PQQ-like domain

118

156

0.91

PF13360

PQQ_2

PQQ-like domain

103

305

0.81

PF13360

PQQ_2

PQQ-like domain

314

461

0.76

PF13360

PQQ_2

PQQ-like domain

168

419

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
6tjg-assembly1.cif.gz_A crystal structure of the computationally designed cake8 protein 0.8176 60 435
6tjg-assembly1.cif.gz_A crystal structure of the computationally designed cake8 protein 0.8105 60 435
6tjc-assembly1.cif.gz_A crystal structure of the computationally designed cake3 protein 0.8015 335 435
6tjb-assembly1.cif.gz_D crystal structure of the computationally designed cake2 protein 0.7838 358 435
7tsz-assembly1.cif.gz_B bamabcde bound to substrate espp class 1 0.7822 48 432
ID Description Score Start End Superfamily
af_D4A5F5_897_1032_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.8439 157 290 2.40.128.630
af_Q5RG49_936_1023_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.8297 335 414 2.40.128.630
af_Q922B6_279_425_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.7989 331 425 2.40.128.630
af_Q54J98_246_425_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7766 149 326 2.130.10.10
1j1qA01 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.7689 199 232 3.40.420.10
ID Description Score Start End GO Terms
AF-A0A1Q7H068-F1-model_v4 Serine/threonine protein kinase 0.9808 29 433
AF-A0A2V8BPD7-F1-model_v4 Pyrrolo-quinoline quinone 0.9805 29 209
AF-A0A2E9V9X0-F1-model_v4 PQQ-binding-like beta-propeller repeat protein 0.9799 9 435
AF-A0A6B1DJR7-F1-model_v4 PQQ-like beta-propeller repeat protein 0.9718 115 435
AF-A0A383AUS3-F1-model_v4 Bulb-type lectin domain-containing protein 0.9702 28 197

Map