F435094

General Info

Members Datasets Scaffolds Average Seq Length
402 194 402 301

Family's Representative Sequence

Representative Sequence 3300021377|Ga0213874_10071651|Ga0213874_100716511
Length 309
Sequence MQAVNPAIRTSGLGKRYGETVALDGLDLEIRPGEVYGYLGPNGAGKTTTIRLLLGLHRPSAGRAELFGVDAWGDPVRAHRNVAYVAGEPFLWPSLTAGETLELLSRLRASDDERSSASDIAYRERLVQRFELDVRKKVRALSKGNRQKVQLIAALATRAELLLLDEPTSGLDPLMEMVFRECVNEAKDRGQTVFLSSHILSEVEALCDRVGILRDGRLIEQGTLAELRHLSAQTVEVTFAGQAPAPPPLPGITVVATAPNTLRFQVPGELTPLIDALQGHHVLTLRSREPSLEEIFLHHYDGAHDRAGR

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
59 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
60 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
61 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
86 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
87 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
88 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
89 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
90 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
93 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
94 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
95 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
96 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
99 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
100 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
101 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
102 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
103 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
104 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
105 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
106 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
107 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
116 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
117 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
118 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
119 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
120 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
123 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
124 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
125 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
126 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
127 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
128 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
129 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
130 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
131 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
132 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
133 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
136 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
137 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
138 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
139 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
140 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
141 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
142 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
143 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
144 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
145 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
146 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
147 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
148 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
151 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
152 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
153 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
154 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
155 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
176 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
181 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
182 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
188 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
189 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
190 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
191 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
192 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
193 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
194 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99
Metatranscriptomes 1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1
Nodule 0
Rhizoplane 16.92
Rhizosphere 81.09
Stem 0
Stem Tuber 0
Unclassified 1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100096083 3300005329 Bacteria 2787
2 Ga0070683_100149471 3300005329 Bacteria 2214
3 Ga0070682_100160113 3300005337 Bacteria 1554
4 Ga0068868_100079077 3300005338 Bacteria 2634
5 Ga0070660_100005747 3300005339 Bacteria 8595
6 Ga0070669_100067376 3300005353 Bacteria 2641
7 Ga0070669_100271017 3300005353 Bacteria 1357
8 Ga0070659_100029441 3300005366 Bacteria 4244
9 Ga0070659_100386130 3300005366 Bacteria 1180
10 Ga0070709_10001994 3300005434 Bacteria 11110
11 Ga0070709_10004629 3300005434 Bacteria 7428
12 Ga0070709_10013726 3300005434 Bacteria 4562
13 Ga0070709_10102006 3300005434 Bacteria 1913
14 Ga0070714_100000254 3300005435 Bacteria 41510
15 Ga0070714_100000565 3300005435 Bacteria 26689
16 Ga0070714_100004743 3300005435 Bacteria 10291
17 Ga0070714_100005839 3300005435 Bacteria 9444
18 Ga0070714_100086523 3300005435 Bacteria 2739
19 Ga0070714_100109656 3300005435 Bacteria 2442
20 Ga0070713_100065725 3300005436 Bacteria 3048
21 Ga0070713_100090893 3300005436 Bacteria 2625
22 Ga0070713_100118195 3300005436 Bacteria 2321
23 Ga0070713_100170178 3300005436 Bacteria 1951
24 Ga0070710_10000023 3300005437 Bacteria 76831
25 Ga0070710_10002345 3300005437 Bacteria 8958
26 Ga0070710_10008354 3300005437 Bacteria 5039
27 Ga0070710_10012814 3300005437 Bacteria 4176
28 Ga0070710_10071466 3300005437 Bacteria 2001
29 Ga0070710_10127845 3300005437 Bacteria 1546
30 Ga0070711_100002926 3300005439 Bacteria 9840
31 Ga0070711_100017193 3300005439 Bacteria 4603
32 Ga0070705_100014028 3300005440 Bacteria 4112
33 Ga0070708_100039590 3300005445 Bacteria 4125
34 Ga0070706_100003067 3300005467 Bacteria 16546
35 Ga0070707_100000115 3300005468 Bacteria 74517
36 Ga0070707_100004358 3300005468 Bacteria 13265
37 Ga0070707_100006181 3300005468 Bacteria 11154
38 Ga0070707_100096355 3300005468 Bacteria 2866
39 Ga0070698_100000403 3300005471 Bacteria 45821
40 Ga0070698_100443690 3300005471 Bacteria 1233
41 Ga0070679_100048819 3300005530 Bacteria 4216
42 Ga0070684_100105918 3300005535 Bacteria 2517
43 Ga0070684_100246806 3300005535 Bacteria 1631
44 Ga0070684_100291956 3300005535 Bacteria 1495
45 Ga0070684_100421748 3300005535 Bacteria 1232
46 Ga0070693_100184739 3300005547 Bacteria 1345
47 Ga0068855_100092470 3300005563 Bacteria 3489
48 Ga0068855_100242101 3300005563 Bacteria 2015
49 Ga0070664_100096627 3300005564 Bacteria 2564
50 Ga0068857_100196554 3300005577 Bacteria 1838
51 Ga0068856_100086725 3300005614 Bacteria 3111
52 Ga0068856_100119566 3300005614 Bacteria 2636
53 Ga0068852_100425416 3300005616 Bacteria 1310
54 Ga0068864_100186746 3300005618 Bacteria 1898
55 Ga0068860_100247560 3300005843 Bacteria 1735
56 Ga0081455_10018241 3300005937 Bacteria 6695
57 Ga0081455_10042123 3300005937 Bacteria 4008
58 Ga0081455_10087991 3300005937 Bacteria 2526
59 Ga0081538_10074496 3300005981 Bacteria 1847
60 Ga0081539_10003240 3300005985 Bacteria 20475
61 Ga0081539_10024495 3300005985 Bacteria 3912
62 Ga0070717_10000017 3300006028 Bacteria 205340
63 Ga0070717_10013621 3300006028 Bacteria 6239
64 Ga0070717_10024367 3300006028 Bacteria 4804
65 Ga0070717_10032907 3300006028 Bacteria 4180
66 Ga0070717_10250139 3300006028 Bacteria 1566
67 Ga0070717_10624836 3300006028 Bacteria 977
68 Ga0075365_10036019 3300006038 Bacteria 3205
69 Ga0075364_10018695 3300006051 Bacteria 4343
70 Ga0070715_10016679 3300006163 Bacteria 2765
71 Ga0070715_10073759 3300006163 Bacteria 1531
72 Ga0070716_100011124 3300006173 Bacteria 4528
73 Ga0070712_100000286 3300006175 Bacteria 28494
74 Ga0070712_100015662 3300006175 Bacteria 4888
75 Ga0070712_100043564 3300006175 Bacteria 3090
76 Ga0070712_100062439 3300006175 Bacteria 2634
77 Ga0070712_100251376 3300006175 Bacteria 1413
78 Ga0068871_100083894 3300006358 Bacteria 2643
79 Ga0075434_100029858 3300006871 Bacteria 5366
80 Ga0075434_100045548 3300006871 Bacteria 4351
81 Ga0075434_100091419 3300006871 Bacteria 3045
82 Ga0075429_100094209 3300006880 Bacteria 2612
83 Ga0075436_100009227 3300006914 Bacteria 6750
84 Ga0075435_100000484 3300007076 Bacteria 24170
85 Ga0075435_100006705 3300007076 Bacteria 8166
86 Ga0105240_10050353 3300009093 Bacteria 5252
87 Ga0105240_10281526 3300009093 Bacteria 1910
88 Ga0111539_10112314 3300009094 Bacteria 3197
89 Ga0105245_10032760 3300009098 Bacteria 4601
90 Ga0105237_10229519 3300009545 Bacteria 1857
91 Ga0105237_10314473 3300009545 Bacteria 1569
92 Ga0105238_10118339 3300009551 Bacteria 2629
93 Ga0105249_10231243 3300009553 Bacteria 1823
94 Ga0105239_10255897 3300010375 Bacteria 1967
95 Ga0105246_10078478 3300011119 Bacteria 2345
96 Ga0157370_10030236 3300013104 Bacteria 5308
97 Ga0157370_10095734 3300013104 Bacteria 2785
98 Ga0157374_10747156 3300013296 Bacteria 993
99 Ga0163162_10220666 3300013306 Bacteria 2026
100 Ga0157372_10019761 3300013307 Bacteria 7259
101 Ga0157372_10057795 3300013307 Bacteria 4336
102 Ga0157372_10211137 3300013307 Bacteria 2250
103 Ga0163163_10039545 3300014325 Bacteria 4603
104 Ga0163163_10184160 3300014325 Bacteria 2136
105 Ga0157379_10072099 3300014968 Bacteria 3090
106 Ga0157379_10460298 3300014968 Bacteria 1175
107 Ga0157376_10003602 3300014969 Bacteria 10688
108 Ga0197907_11435335 3300020069 Bacteria 1808
109 Ga0206356_10077594 3300020070 Bacteria 1717
110 Ga0213873_10046134 3300021358 Bacteria 1139
111 Ga0213874_10071651 3300021377 Bacteria 1106
112 Ga0213871_10034336 3300021441 Bacteria 1337
113 Ga0224712_10014516 3300022467 Bacteria 2539
114 Ga0224712_10065862 3300022467 Bacteria 1457
115 Ga0207692_10000017 3300025898 Bacteria 76831
116 Ga0207692_10003168 3300025898 Bacteria 6384
117 Ga0207692_10003875 3300025898 Bacteria 5879
118 Ga0207692_10024210 3300025898 Bacteria 2819
119 Ga0207692_10085594 3300025898 Bacteria 1696
120 Ga0207692_10131538 3300025898 Bacteria 1414
121 Ga0207699_10002626 3300025906 Bacteria 8490
122 Ga0207699_10003882 3300025906 Bacteria 7138
123 Ga0207699_10159317 3300025906 Bacteria 1501
124 Ga0207707_10016397 3300025912 Bacteria 6463
125 Ga0207707_10141570 3300025912 Bacteria 2103
126 Ga0207695_10043099 3300025913 Bacteria 4812
127 Ga0207695_10087644 3300025913 Bacteria 3135
128 Ga0207693_10000287 3300025915 Bacteria 46766
129 Ga0207693_10014890 3300025915 Bacteria 6247
130 Ga0207693_10055696 3300025915 Bacteria 3102
131 Ga0207693_10131170 3300025915 Bacteria 1970
132 Ga0207693_10186331 3300025915 Bacteria 1633
133 Ga0207693_10274291 3300025915 Bacteria 1321
134 Ga0207663_10000349 3300025916 Bacteria 20080
135 Ga0207663_10002732 3300025916 Bacteria 8508
136 Ga0207663_10011295 3300025916 Bacteria 4792
137 Ga0207663_10023673 3300025916 Bacteria 3528
138 Ga0207663_10027603 3300025916 Bacteria 3311
139 Ga0207663_10091327 3300025916 Bacteria 2021
140 Ga0207646_10000133 3300025922 Bacteria 101402
141 Ga0207646_10014620 3300025922 Bacteria 7441
142 Ga0207646_10050677 3300025922 Bacteria 3715
143 Ga0207681_10001416 3300025923 Bacteria 15479
144 Ga0207694_10057435 3300025924 Bacteria 3025
145 Ga0207687_10014388 3300025927 Bacteria 5176
146 Ga0207700_10005311 3300025928 Bacteria 7686
147 Ga0207700_10038086 3300025928 Bacteria 3488
148 Ga0207700_10052725 3300025928 Bacteria 3043
149 Ga0207700_10060362 3300025928 Bacteria 2872
150 Ga0207700_10160836 3300025928 Bacteria 1865
151 Ga0207700_10307310 3300025928 Bacteria 1371
152 Ga0207664_10000020 3300025929 Bacteria 218362
153 Ga0207664_10002617 3300025929 Bacteria 11910
154 Ga0207664_10015935 3300025929 Bacteria 5474
155 Ga0207664_10083556 3300025929 Bacteria 2603
156 Ga0207664_10086427 3300025929 Bacteria 2562
157 Ga0207664_10107969 3300025929 Bacteria 2310
158 Ga0207664_10129014 3300025929 Bacteria 2126
159 Ga0207690_10007133 3300025932 Bacteria 6638
160 Ga0207690_10202345 3300025932 Bacteria 1509
161 Ga0207665_10010623 3300025939 Bacteria 6048
162 Ga0207665_10025735 3300025939 Bacteria 3882
163 Ga0207679_10042270 3300025945 Bacteria 3274
164 Ga0207667_10638114 3300025949 Bacteria 1071
165 Ga0207677_10262882 3300026023 Bacteria 1407
166 Ga0207702_10098236 3300026078 Bacteria 2579
167 Ga0207702_10099472 3300026078 Bacteria 2564
168 Ga0207702_10202929 3300026078 Bacteria 1839
169 Ga0207702_10255245 3300026078 Bacteria 1648
170 Ga0207676_10054568 3300026095 Bacteria 3133
171 Ga0207674_10150973 3300026116 Bacteria 2281
172 Ga0207674_10483582 3300026116 Bacteria 1197
173 Ga0207675_100035738 3300026118 Bacteria 4634
174 Ga0207428_10040479 3300027907 Bacteria 3780
175 Ga0268264_10159219 3300028381 Bacteria 2032
176 Ga0265337_1001823 3300028556 Bacteria 10220
177 Ga0265326_10000087 3300028558 Bacteria 49222
178 Ga0265326_10004784 3300028558 Bacteria 4300
179 Ga0265319_1001148 3300028563 Bacteria 16438
180 Ga0265319_1004096 3300028563 Bacteria 7336
181 Ga0265319_1012050 3300028563 Bacteria 3511
182 Ga0265319_1013707 3300028563 Bacteria 3209
183 Ga0265334_10000460 3300028573 Bacteria 21146
184 Ga0265318_10001598 3300028577 Bacteria 13110
185 Ga0265336_10000002 3300028666 Bacteria 830172
186 Ga0265336_10006468 3300028666 Bacteria 4222
187 Ga0265338_10000001 3300028800 Bacteria 1177449
188 Ga0265338_10008807 3300028800 Bacteria 12180
189 Ga0265324_10002223 3300029957 Bacteria 10133
190 Ga0265320_10100048 3300031240 Bacteria 1336
191 Ga0265340_10000001 3300031247 Bacteria 1647668
192 Ga0265316_10034317 3300031344 Bacteria 4122
193 Ga0265316_10199280 3300031344 Bacteria 1485
194 Ga0265314_10144145 3300031711 Bacteria 1469
195 Ga0307416_100034867 3300032002 Bacteria 3836
196 Ga0307416_100363276 3300032002 Bacteria 1471
197 Ga0373945_0095224 3300035116 Bacteria 1158
198 Ga0373954_0069946 3300035118 Bacteria 1667
199 Ga0373956_0136258 3300035119 Bacteria 1151
200 Ga0373957_0035950 3300035120 Bacteria 1843
201 Ga0373946_0014745 3300035171 Bacteria 2952
202 Ga0373955_0091567 3300035172 Bacteria 1733
203 Ga0373955_0228572 3300035172 Bacteria 1112
204 Ga0373924_0026962 3300035410 Bacteria 2282
205 Ga0373927_0165890 3300035695 Bacteria 1447
206 Ga0373933_0102183 3300035724 Bacteria 1780
207 Ga0373947_0130746 3300035725 Bacteria 1602
208 Ga0373937_0023503 3300036401 Bacteria 5551
209 Ga0373937_0057351 3300036401 Bacteria 3577
210 Ga0373925_0126755 3300037068 Bacteria 1987
211 Ga0395900_0144996 3300037418 Bacteria 2428
212 Ga0395900_0229864 3300037418 Bacteria 1866
213 Ga0395898_0033321 3300037466 Bacteria 5142
214 Ga0395905_0038293 3300037471 Bacteria 4499
215 Ga0395905_0206325 3300037471 Bacteria 1842
216 Ga0395901_0353649 3300038443 Bacteria 1516
217 Ga0436365_0312703 3300039437 Bacteria 10809
218 Ga0436360_1071676 3300039438 Bacteria 5311
219 Ga0436363_0871321 3300039450 Bacteria 1410
220 Ga0436363_1038620 3300039450 Bacteria 17774
221 Ga0436362_0507333 3300039453 Bacteria 3140
222 Ga0439448_0103675 3300042005 Bacteria 968
223 Ga0466959_0263380 3300045049 Bacteria 1186
224 Ga0451576_0093624 3300045051 Bacteria 3124
225 Ga0466967_0019420 3300045976 Bacteria 5463
226 Ga0466967_0056155 3300045976 Bacteria 3471
227 Ga0466967_0114849 3300045976 Bacteria 2478
228 Ga0466967_0136431 3300045976 Bacteria 2282
229 Ga0495592_0141670 3300046454 Bacteria 1671
230 Ga0495603_0070536 3300046455 Bacteria 2054
231 Ga0495629_0164926 3300046459 Bacteria 1538
232 Ga0495641_0016654 3300046461 Bacteria 3863
233 Ga0495651_0000731 3300046462 Bacteria 25358
234 Ga0495651_0001874 3300046462 Bacteria 16265
235 Ga0495651_0065056 3300046462 Bacteria 2785
236 Ga0495651_0125088 3300046462 Bacteria 1884
237 Ga0495653_0018771 3300046463 Bacteria 5611
238 Ga0495653_0021894 3300046463 Bacteria 5175
239 Ga0495653_0045890 3300046463 Bacteria 3385
240 Ga0495582_0099644 3300046473 Bacteria 1626
241 Ga0495639_0158794 3300046475 Bacteria 1093
242 Ga0495664_0076859 3300046477 Bacteria 1998
243 Ga0495608_0016512 3300046511 Bacteria 5108
244 Ga0495608_0050428 3300046511 Bacteria 2761
245 Ga0495608_0107042 3300046511 Bacteria 1800
246 Ga0495608_0252868 3300046511 Bacteria 1098
247 Ga0495618_0000137 3300046514 Bacteria 52421
248 Ga0495618_0099818 3300046514 Bacteria 1858
249 Ga0495618_0111878 3300046514 Bacteria 1748
250 Ga0495628_0000093 3300046516 Bacteria 71181
251 Ga0495628_0011815 3300046516 Bacteria 7369
252 Ga0495628_0019291 3300046516 Bacteria 5640
253 Ga0495628_0178019 3300046516 Bacteria 1610
254 Ga0495630_0168290 3300046517 Bacteria 1669
255 Ga0495652_0003440 3300046529 Bacteria 15614
256 Ga0495652_0093569 3300046529 Bacteria 2453
257 Ga0495652_0194024 3300046529 Bacteria 1547
258 Ga0495665_0061047 3300046531 Bacteria 1990
259 Ga0495640_0016797 3300046533 Bacteria 5471
260 Ga0495640_0016838 3300046533 Bacteria 5463
261 Ga0495587_0015654 3300046536 Bacteria 4731
262 Ga0495587_0024426 3300046536 Bacteria 3703
263 Ga0495667_0006516 3300046559 Bacteria 7926
264 Ga0495667_0008336 3300046559 Bacteria 7030
265 Ga0495667_0055466 3300046559 Bacteria 2606
266 Ga0495635_0001965 3300046663 Bacteria 13979
267 Ga0495635_0010409 3300046663 Bacteria 6505
268 Ga0495635_0247155 3300046663 Bacteria 1203
269 Ga0495588_0086161 3300046674 Bacteria 1643
270 Ga0495657_0086739 3300046675 Bacteria 2015
271 Ga0495599_0044600 3300046678 Bacteria 2781
272 Ga0495599_0102075 3300046678 Bacteria 1787
273 Ga0495646_0025847 3300046680 Bacteria 3690
274 Ga0495646_0114923 3300046680 Bacteria 1529
275 Ga0495647_0025741 3300046681 Bacteria 2152
276 Ga0495624_0129560 3300046690 Bacteria 1547
277 Ga0495624_0218001 3300046690 Bacteria 1157
278 Ga0495600_0019913 3300046809 Bacteria 4289
279 Ga0495600_0019996 3300046809 Bacteria 4280
280 Ga0495604_0001056 3300047317 Bacteria 22882
281 Ga0495604_0147654 3300047317 Bacteria 1674
282 Ga0495604_0282976 3300047317 Bacteria 1120
283 Ga0495604_0323232 3300047317 Bacteria 1031
284 Ga0495674_0017059 3300047319 Bacteria 6764
285 Ga0495674_0112381 3300047319 Bacteria 2308
286 Ga0495676_0120091 3300047321 Bacteria 1913
287 Ga0495680_0005828 3300047322 Bacteria 11531
288 Ga0495680_0009477 3300047322 Bacteria 8751
289 Ga0495680_0009567 3300047322 Bacteria 8709
290 Ga0495680_0016943 3300047322 Bacteria 6239
291 Ga0495680_0176700 3300047322 Bacteria 1543
292 Ga0495680_0277131 3300047322 Bacteria 1183
293 Ga0495675_0023782 3300047444 Bacteria 3904
294 Ga0495684_0056064 3300047471 Bacteria 3005
295 Ga0495684_0057268 3300047471 Bacteria 2970
296 Ga0495684_0087723 3300047471 Bacteria 2358
297 Ga0495593_0029796 3300047673 Bacteria 2990
298 Ga0495602_0004677 3300048088 Bacteria 14297
299 Ga0495602_0022560 3300048088 Bacteria 6158
300 Ga0495602_0142857 3300048088 Bacteria 1892
301 Ga0495602_0148666 3300048088 Bacteria 1844
302 Ga0495602_0213639 3300048088 Bacteria 1462
303 Ga0496100_0004895 3300048903 Bacteria 7157
304 Ga0496100_0036985 3300048903 Bacteria 3083
305 Ga0496100_0064368 3300048903 Bacteria 2426
306 Ga0496100_0093237 3300048903 Bacteria 2060
307 Ga0496101_0000652 3300048904 Bacteria 20936
308 Ga0496101_0020263 3300048904 Bacteria 4549
309 Ga0496101_0024798 3300048904 Bacteria 4156
310 Ga0496101_0182380 3300048904 Bacteria 1617
311 Ga0496101_0206591 3300048904 Bacteria 1520
312 Ga0496102_0120780 3300048905 Bacteria 2447
313 Ga0496102_0165579 3300048905 Bacteria 2080
314 Ga0496102_0258118 3300048905 Bacteria 1643
315 Ga0496102_0335993 3300048905 Bacteria 1423
316 Ga0496102_0390377 3300048905 Bacteria 1309
317 Ga0496102_0563540 3300048905 Bacteria 1062
318 Ga0496103_0056892 3300048906 Bacteria 2428
319 Ga0496104_0010746 3300048907 Bacteria 8187
320 Ga0496104_0013725 3300048907 Bacteria 7307
321 Ga0496104_0199481 3300048907 Bacteria 1913
322 Ga0496105_0000642 3300048908 Bacteria 23393
323 Ga0496105_0018385 3300048908 Bacteria 5616
324 Ga0496105_0155867 3300048908 Bacteria 1876
325 Ga0496105_0194283 3300048908 Bacteria 1658
326 Ga0496105_0282804 3300048908 Bacteria 1337
327 Ga0496105_0287576 3300048908 Bacteria 1324
328 Ga0496106_0009548 3300048909 Bacteria 7166
329 Ga0496106_0017325 3300048909 Bacteria 5332
330 Ga0496106_0198499 3300048909 Bacteria 1596
331 Ga0496107_0006107 3300048910 Bacteria 8276
332 Ga0496107_0034232 3300048910 Bacteria 3638
333 Ga0496108_0003234 3300048911 Bacteria 13100
334 Ga0496108_0038534 3300048911 Bacteria 3982
335 Ga0496108_0057722 3300048911 Bacteria 3261
336 Ga0496108_0076587 3300048911 Bacteria 2828
337 Ga0496108_0281392 3300048911 Bacteria 1448
338 Ga0496108_0351851 3300048911 Bacteria 1285
339 Ga0496109_0004096 3300048912 Bacteria 12180
340 Ga0496109_0016172 3300048912 Bacteria 6520
341 Ga0496109_0144554 3300048912 Bacteria 2224
342 Ga0496110_0005806 3300048913 Bacteria 9700
343 Ga0496110_0010362 3300048913 Bacteria 7579
344 Ga0496110_0041923 3300048913 Bacteria 3995
345 Ga0496110_0055719 3300048913 Bacteria 3479
346 Ga0496110_0058912 3300048913 Bacteria 3383
347 Ga0496111_0044041 3300048914 Bacteria 3208
348 Ga0496111_0083142 3300048914 Bacteria 2339
349 Ga0496111_0116455 3300048914 Bacteria 1971
350 Ga0496111_0124124 3300048914 Bacteria 1908
351 Ga0496111_0138788 3300048914 Bacteria 1801
352 Ga0496111_0252098 3300048914 Bacteria 1310
353 Ga0496112_0000160 3300048915 Bacteria 42530
354 Ga0496112_0020936 3300048915 Bacteria 6210
355 Ga0496112_0104582 3300048915 Bacteria 2801
356 Ga0496112_0143188 3300048915 Bacteria 2359
357 Ga0496113_0009217 3300048916 Bacteria 6474
358 Ga0496113_0034670 3300048916 Bacteria 3684
359 Ga0496113_0074024 3300048916 Bacteria 2596
360 Ga0496113_0136988 3300048916 Bacteria 1924
361 Ga0496113_0139883 3300048916 Bacteria 1904
362 Ga0496113_0141784 3300048916 Bacteria 1891
363 Ga0496113_0169390 3300048916 Bacteria 1729
364 Ga0496113_0298423 3300048916 Bacteria 1290
365 Ga0496114_0002803 3300048917 Bacteria 13357
366 Ga0496114_0069834 3300048917 Bacteria 2950
367 Ga0496114_0113511 3300048917 Bacteria 2323
368 Ga0496115_0000787 3300048918 Bacteria 23278
369 Ga0496115_0003468 3300048918 Bacteria 11335
370 Ga0496115_0351456 3300048918 Bacteria 1202
371 Ga0501038_0369123 3300049574 Bacteria 1115
372 Ga0501040_0103224 3300049576 Bacteria 1990
373 Ga0501042_0121293 3300049578 Bacteria 1882
374 Ga0501067_0006322 3300049583 Bacteria 6569
375 Ga0501069_0039336 3300049585 Bacteria 2612
376 Ga0501074_0236536 3300049590 Bacteria 1300
377 Ga0501077_0007928 3300049593 Bacteria 6560
378 Ga0501077_0141675 3300049593 Bacteria 1525
379 Ga0501079_0129183 3300049741 Bacteria 1966
380 Ga0501081_0058679 3300049743 Bacteria 2663
381 nmdc:mga00v17_28787_c2 3300050491 Bacteria 2202
382 nmdc:mga0yw44_68217_c1 3300050492 Bacteria 2200
383 nmdc:mga09592_71552_c1 3300050508 Bacteria 2943
384 nmdc:mga06r32_218363_c1 3300050510 Bacteria 1894
385 nmdc:mga08y16_52404_c1 3300050511 Bacteria 4269
386 nmdc:mga0n895_398383_c1 3300050512 Bacteria 1392
387 nmdc:mga0n895_94932_c1 3300050512 Bacteria 2987
388 nmdc:mga0rr50_139395_c1 3300050513 Bacteria 1950
389 nmdc:mga0rr50_20635_c1 3300050513 Bacteria 4481
390 nmdc:mga0rr50_5555_c1 3300050513 Bacteria 7539
391 nmdc:mga08x19_61701_c1 3300050514 Bacteria 2430
392 nmdc:mga0a205_109755_c1 3300050515 Bacteria 2657
393 nmdc:mga0a205_18893_c1 3300050515 Bacteria 6492
394 Ga0495601_0047167 3300053077 Bacteria 2712
395 Ga0495612_0073785 3300053078 Bacteria 1426
396 Ga0495595_0018603 3300053084 Bacteria 3004
397 Ga0495595_0045272 3300053084 Bacteria 2024
398 Ga0495595_0093685 3300053084 Bacteria 1443
399 Ga0495595_0122068 3300053084 Bacteria 1269
400 Ga0495619_0064049 3300053085 Bacteria 2450
401 Ga0495619_0130378 3300053085 Bacteria 1727
402 Ga0501082_0036301 3300060353 Bacteria 4246

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025915 Ga0207693_10274291 Ga0207693_102742912 257
2 3300046455 Ga0495603_0070536 Ga0495603_0070536_1134_2021 279
3 3300046461 Ga0495641_0016654 Ga0495641_0016654_1592_2479 279
4 3300005366 Ga0070659_100386130 Ga0070659_1003861301 285
5 3300005985 Ga0081539_10003240 Ga0081539_100032409 285
6 3300025932 Ga0207690_10202345 Ga0207690_102023452 285
7 3300039437 Ga0436365_0312703 Ga0436365_0312703_9577_10473 285
8 3300046459 Ga0495629_0164926 Ga0495629_0164926_311_1198 285
9 3300046514 Ga0495618_0099818 Ga0495618_0099818_150_1037 285
10 3300046690 Ga0495624_0129560 Ga0495624_0129560_225_1112 285
11 3300047322 Ga0495680_0009567 Ga0495680_0009567_1108_1995 285
12 3300050510 nmdc:mga06r32_218363_c1 nmdc:mga06r32_218363_c1_734_1618 285
13 3300045976 Ga0466967_0019420 Ga0466967_0019420_3960_4841 286
14 3300045976 Ga0466967_0056155 Ga0466967_0056155_382_1263 286
15 3300005436 Ga0070713_100118195 Ga0070713_1001181953 287
16 3300025915 Ga0207693_10186331 Ga0207693_101863312 287
17 3300026078 Ga0207702_10255245 Ga0207702_102552452 287
18 3300035118 Ga0373954_0069946 Ga0373954_0069946_320_1207 287
19 3300035172 Ga0373955_0228572 Ga0373955_0228572_138_1025 287
20 3300036401 Ga0373937_0057351 Ga0373937_0057351_1127_2014 287
21 3300046462 Ga0495651_0065056 Ga0495651_0065056_486_1373 287
22 3300046511 Ga0495608_0252868 Ga0495608_0252868_34_921 287
23 3300046517 Ga0495630_0168290 Ga0495630_0168290_584_1471 287
24 3300046529 Ga0495652_0194024 Ga0495652_0194024_298_1185 287
25 3300046536 Ga0495587_0024426 Ga0495587_0024426_2301_3188 287
26 3300046559 Ga0495667_0055466 Ga0495667_0055466_1607_2494 287
27 3300046663 Ga0495635_0247155 Ga0495635_0247155_150_1037 287
28 3300046678 Ga0495599_0044600 Ga0495599_0044600_432_1319 287
29 3300047471 Ga0495684_0087723 Ga0495684_0087723_240_1127 287
30 3300048088 Ga0495602_0148666 Ga0495602_0148666_191_1078 287
31 3300048903 Ga0496100_0064368 Ga0496100_0064368_607_1500 287
32 3300048904 Ga0496101_0020263 Ga0496101_0020263_1318_2211 287
33 3300048908 Ga0496105_0155867 Ga0496105_0155867_931_1824 287
34 3300048913 Ga0496110_0041923 Ga0496110_0041923_2295_3188 287
35 3300048914 Ga0496111_0138788 Ga0496111_0138788_844_1737 287
36 3300053084 Ga0495595_0122068 Ga0495595_0122068_41_928 287
37 3300053085 Ga0495619_0064049 Ga0495619_0064049_21_893 287
38 3300026118 Ga0207675_100035738 Ga0207675_1000357383 288
39 3300032002 Ga0307416_100034867 Ga0307416_1000348673 288
40 3300045051 Ga0451576_0093624 Ga0451576_0093624_178_1068 288
41 3300048904 Ga0496101_0206591 Ga0496101_0206591_18_953 288
42 3300048908 Ga0496105_0287576 Ga0496105_0287576_297_1232 288
43 3300048911 Ga0496108_0038534 Ga0496108_0038534_1486_2421 288
44 3300048913 Ga0496110_0010362 Ga0496110_0010362_5749_6684 288
45 3300048914 Ga0496111_0252098 Ga0496111_0252098_160_1095 288
46 3300048916 Ga0496113_0298423 Ga0496113_0298423_158_1093 288
47 3300005337 Ga0070682_100160113 Ga0070682_1001601131 289
48 3300005339 Ga0070660_100005747 Ga0070660_1000057473 289
49 3300005366 Ga0070659_100029441 Ga0070659_1000294413 289
50 3300005530 Ga0070679_100048819 Ga0070679_1000488192 289
51 3300005577 Ga0068857_100196554 Ga0068857_1001965542 289
52 3300005616 Ga0068852_100425416 Ga0068852_1004254161 289
53 3300013104 Ga0157370_10030236 Ga0157370_100302362 289
54 3300013307 Ga0157372_10019761 Ga0157372_100197616 289
55 3300025932 Ga0207690_10007133 Ga0207690_100071333 289
56 3300028563 Ga0265319_1001148 Ga0265319_10011485 289
57 3300046516 Ga0495628_0000093 Ga0495628_0000093_50485_51381 289
58 3300048911 Ga0496108_0076587 Ga0496108_0076587_1217_2113 289
59 3300048912 Ga0496109_0144554 Ga0496109_0144554_95_991 289
60 3300005437 Ga0070710_10000023 Ga0070710_1000002369 290
61 3300005535 Ga0070684_100246806 Ga0070684_1002468062 290
62 3300005535 Ga0070684_100421748 Ga0070684_1004217482 290
63 3300006028 Ga0070717_10032907 Ga0070717_100329073 290
64 3300021358 Ga0213873_10046134 Ga0213873_100461342 290
65 3300021441 Ga0213871_10034336 Ga0213871_100343362 290
66 3300025898 Ga0207692_10000017 Ga0207692_1000001768 290
67 3300025928 Ga0207700_10307310 Ga0207700_103073102 290
68 3300031344 Ga0265316_10199280 Ga0265316_101992801 290
69 3300035695 Ga0373927_0165890 Ga0373927_0165890_286_1173 290
70 3300039438 Ga0436360_1071676 Ga0436360_1071676_2384_3274 290
71 3300039453 Ga0436362_0507333 Ga0436362_0507333_2102_2992 290
72 3300045976 Ga0466967_0114849 Ga0466967_0114849_571_1482 290
73 3300046473 Ga0495582_0099644 Ga0495582_0099644_465_1364 290
74 3300048088 Ga0495602_0004677 Ga0495602_0004677_12691_13587 290
75 3300048903 Ga0496100_0036985 Ga0496100_0036985_349_1245 290
76 3300048904 Ga0496101_0182380 Ga0496101_0182380_377_1273 290
77 3300048905 Ga0496102_0120780 Ga0496102_0120780_1514_2410 290
78 3300048905 Ga0496102_0563540 Ga0496102_0563540_135_1028 290
79 3300048909 Ga0496106_0017325 Ga0496106_0017325_3308_4204 290
80 3300048910 Ga0496107_0006107 Ga0496107_0006107_5239_6135 290
81 3300048911 Ga0496108_0351851 Ga0496108_0351851_280_1173 290
82 3300048914 Ga0496111_0116455 Ga0496111_0116455_383_1276 290
83 3300048915 Ga0496112_0020936 Ga0496112_0020936_5166_6083 290
84 3300048916 Ga0496113_0009217 Ga0496113_0009217_3010_3903 290
85 3300048916 Ga0496113_0034670 Ga0496113_0034670_1513_2406 290
86 3300050512 nmdc:mga0n895_398383_c1 nmdc:mga0n895_398383_c1_174_1061 290
87 3300005353 Ga0070669_100067376 Ga0070669_1000673762 291
88 3300005353 Ga0070669_100271017 Ga0070669_1002710171 291
89 3300005434 Ga0070709_10001994 Ga0070709_100019947 291
90 3300005434 Ga0070709_10004629 Ga0070709_100046295 291
91 3300005435 Ga0070714_100000254 Ga0070714_1000002547 291
92 3300005435 Ga0070714_100000565 Ga0070714_1000005658 291
93 3300005435 Ga0070714_100004743 Ga0070714_1000047438 291
94 3300005435 Ga0070714_100086523 Ga0070714_1000865232 291
95 3300005435 Ga0070714_100109656 Ga0070714_1001096562 291
96 3300005436 Ga0070713_100065725 Ga0070713_1000657253 291
97 3300005436 Ga0070713_100090893 Ga0070713_1000908932 291
98 3300005437 Ga0070710_10002345 Ga0070710_100023457 291
99 3300005437 Ga0070710_10008354 Ga0070710_100083542 291
100 3300005437 Ga0070710_10071466 Ga0070710_100714662 291
101 3300005439 Ga0070711_100002926 Ga0070711_1000029263 291
102 3300005445 Ga0070708_100039590 Ga0070708_1000395904 291
103 3300005468 Ga0070707_100000115 Ga0070707_10000011542 291
104 3300005468 Ga0070707_100004358 Ga0070707_10000435810 291
105 3300005468 Ga0070707_100006181 Ga0070707_1000061812 291
106 3300005471 Ga0070698_100000403 Ga0070698_10000040323 291
107 3300005535 Ga0070684_100105918 Ga0070684_1001059182 291
108 3300005535 Ga0070684_100291956 Ga0070684_1002919562 291
109 3300005614 Ga0068856_100119566 Ga0068856_1001195662 291
110 3300005937 Ga0081455_10018241 Ga0081455_100182412 291
111 3300005937 Ga0081455_10042123 Ga0081455_100421233 291
112 3300005937 Ga0081455_10087991 Ga0081455_100879912 291
113 3300005981 Ga0081538_10074496 Ga0081538_100744962 291
114 3300005985 Ga0081539_10024495 Ga0081539_100244953 291
115 3300006028 Ga0070717_10000017 Ga0070717_10000017177 291
116 3300006028 Ga0070717_10013621 Ga0070717_100136216 291
117 3300006028 Ga0070717_10024367 Ga0070717_100243673 291
118 3300006038 Ga0075365_10036019 Ga0075365_100360193 291
119 3300006051 Ga0075364_10018695 Ga0075364_100186952 291
120 3300006163 Ga0070715_10073759 Ga0070715_100737592 291
121 3300006173 Ga0070716_100011124 Ga0070716_1000111243 291
122 3300006175 Ga0070712_100000286 Ga0070712_10000028628 291
123 3300006175 Ga0070712_100015662 Ga0070712_1000156624 291
124 3300006175 Ga0070712_100043564 Ga0070712_1000435642 291
125 3300006871 Ga0075434_100045548 Ga0075434_1000455483 291
126 3300006880 Ga0075429_100094209 Ga0075429_1000942094 291
127 3300007076 Ga0075435_100006705 Ga0075435_1000067052 291
128 3300009093 Ga0105240_10281526 Ga0105240_102815262 291
129 3300009094 Ga0111539_10112314 Ga0111539_101123142 291
130 3300009553 Ga0105249_10231243 Ga0105249_102312432 291
131 3300011119 Ga0105246_10078478 Ga0105246_100784782 291
132 3300014325 Ga0163163_10184160 Ga0163163_101841602 291
133 3300021377 Ga0213874_10071651 Ga0213874_100716511 291
134 3300025898 Ga0207692_10003168 Ga0207692_100031686 291
135 3300025898 Ga0207692_10003875 Ga0207692_100038752 291
136 3300025898 Ga0207692_10085594 Ga0207692_100855942 291
137 3300025906 Ga0207699_10002626 Ga0207699_100026263 291
138 3300025906 Ga0207699_10003882 Ga0207699_100038822 291
139 3300025912 Ga0207707_10141570 Ga0207707_101415702 291
140 3300025913 Ga0207695_10087644 Ga0207695_100876442 291
141 3300025915 Ga0207693_10000287 Ga0207693_100002872 291
142 3300025915 Ga0207693_10014890 Ga0207693_100148906 291
143 3300025915 Ga0207693_10055696 Ga0207693_100556963 291
144 3300025916 Ga0207663_10002732 Ga0207663_100027323 291
145 3300025916 Ga0207663_10023673 Ga0207663_100236732 291
146 3300025916 Ga0207663_10027603 Ga0207663_100276032 291
147 3300025922 Ga0207646_10000133 Ga0207646_1000013364 291
148 3300025922 Ga0207646_10014620 Ga0207646_100146208 291
149 3300025922 Ga0207646_10050677 Ga0207646_100506772 291
150 3300025923 Ga0207681_10001416 Ga0207681_1000141614 291
151 3300025928 Ga0207700_10005311 Ga0207700_100053114 291
152 3300025928 Ga0207700_10038086 Ga0207700_100380863 291
153 3300025928 Ga0207700_10060362 Ga0207700_100603623 291
154 3300025928 Ga0207700_10160836 Ga0207700_101608362 291
155 3300025929 Ga0207664_10000020 Ga0207664_1000002093 291
156 3300025929 Ga0207664_10002617 Ga0207664_100026178 291
157 3300025929 Ga0207664_10015935 Ga0207664_100159353 291
158 3300025929 Ga0207664_10083556 Ga0207664_100835562 291
159 3300025939 Ga0207665_10010623 Ga0207665_100106234 291
160 3300026078 Ga0207702_10098236 Ga0207702_100982362 291
161 3300026116 Ga0207674_10483582 Ga0207674_104835822 291
162 3300027907 Ga0207428_10040479 Ga0207428_100404794 291
163 3300028556 Ga0265337_1001823 Ga0265337_10018232 291
164 3300028558 Ga0265326_10000087 Ga0265326_1000008730 291
165 3300028558 Ga0265326_10004784 Ga0265326_100047842 291
166 3300028563 Ga0265319_1004096 Ga0265319_10040962 291
167 3300028563 Ga0265319_1012050 Ga0265319_10120503 291
168 3300028563 Ga0265319_1013707 Ga0265319_10137072 291
169 3300028573 Ga0265334_10000460 Ga0265334_1000046020 291
170 3300028577 Ga0265318_10001598 Ga0265318_1000159814 291
171 3300028666 Ga0265336_10000002 Ga0265336_10000002767 291
172 3300028666 Ga0265336_10006468 Ga0265336_100064683 291
173 3300028800 Ga0265338_10000001 Ga0265338_1000000145 291
174 3300028800 Ga0265338_10008807 Ga0265338_100088072 291
175 3300029957 Ga0265324_10002223 Ga0265324_100022237 291
176 3300031240 Ga0265320_10100048 Ga0265320_101000481 291
177 3300031247 Ga0265340_10000001 Ga0265340_1000000145 291
178 3300031344 Ga0265316_10034317 Ga0265316_100343175 291
179 3300031711 Ga0265314_10144145 Ga0265314_101441452 291
180 3300032002 Ga0307416_100363276 Ga0307416_1003632762 291
181 3300035119 Ga0373956_0136258 Ga0373956_0136258_133_1065 291
182 3300035120 Ga0373957_0035950 Ga0373957_0035950_274_1206 291
183 3300035172 Ga0373955_0091567 Ga0373955_0091567_275_1207 291
184 3300035410 Ga0373924_0026962 Ga0373924_0026962_813_1745 291
185 3300035725 Ga0373947_0130746 Ga0373947_0130746_96_1028 291
186 3300037068 Ga0373925_0126755 Ga0373925_0126755_674_1573 291
187 3300037418 Ga0395900_0144996 Ga0395900_0144996_630_1523 291
188 3300037418 Ga0395900_0229864 Ga0395900_0229864_48_944 291
189 3300037466 Ga0395898_0033321 Ga0395898_0033321_2228_3121 291
190 3300037471 Ga0395905_0038293 Ga0395905_0038293_3323_4216 291
191 3300037471 Ga0395905_0206325 Ga0395905_0206325_913_1806 291
192 3300038443 Ga0395901_0353649 Ga0395901_0353649_76_972 291
193 3300039450 Ga0436363_0871321 Ga0436363_0871321_306_1199 291
194 3300039450 Ga0436363_1038620 Ga0436363_1038620_10056_10976 291
195 3300042005 Ga0439448_0103675 Ga0439448_0103675_13_927 291
196 3300045049 Ga0466959_0263380 Ga0466959_0263380_140_1039 291
197 3300045976 Ga0466967_0136431 Ga0466967_0136431_674_1573 291
198 3300046454 Ga0495592_0141670 Ga0495592_0141670_460_1392 291
199 3300046462 Ga0495651_0000731 Ga0495651_0000731_3102_4034 291
200 3300046462 Ga0495651_0001874 Ga0495651_0001874_10658_11554 291
201 3300046463 Ga0495653_0021894 Ga0495653_0021894_3404_4300 291
202 3300046477 Ga0495664_0076859 Ga0495664_0076859_190_1122 291
203 3300046511 Ga0495608_0016512 Ga0495608_0016512_1461_2357 291
204 3300046516 Ga0495628_0011815 Ga0495628_0011815_6301_7233 291
205 3300046516 Ga0495628_0019291 Ga0495628_0019291_1366_2262 291
206 3300046529 Ga0495652_0003440 Ga0495652_0003440_674_1570 291
207 3300046529 Ga0495652_0093569 Ga0495652_0093569_1405_2337 291
208 3300046531 Ga0495665_0061047 Ga0495665_0061047_790_1722 291
209 3300046533 Ga0495640_0016797 Ga0495640_0016797_1492_2388 291
210 3300046533 Ga0495640_0016838 Ga0495640_0016838_1955_2887 291
211 3300046536 Ga0495587_0015654 Ga0495587_0015654_1164_2096 291
212 3300046559 Ga0495667_0006516 Ga0495667_0006516_2250_3146 291
213 3300046663 Ga0495635_0001965 Ga0495635_0001965_3549_4445 291
214 3300046663 Ga0495635_0010409 Ga0495635_0010409_4795_5727 291
215 3300046674 Ga0495588_0086161 Ga0495588_0086161_162_1082 291
216 3300046675 Ga0495657_0086739 Ga0495657_0086739_259_1191 291
217 3300046678 Ga0495599_0102075 Ga0495599_0102075_703_1635 291
218 3300046680 Ga0495646_0025847 Ga0495646_0025847_506_1402 291
219 3300046681 Ga0495647_0025741 Ga0495647_0025741_207_1127 291
220 3300046690 Ga0495624_0218001 Ga0495624_0218001_185_1084 291
221 3300046809 Ga0495600_0019913 Ga0495600_0019913_674_1570 291
222 3300046809 Ga0495600_0019996 Ga0495600_0019996_2624_3556 291
223 3300047317 Ga0495604_0147654 Ga0495604_0147654_486_1418 291
224 3300047317 Ga0495604_0323232 Ga0495604_0323232_33_929 291
225 3300047319 Ga0495674_0017059 Ga0495674_0017059_2651_3547 291
226 3300047322 Ga0495680_0009477 Ga0495680_0009477_5453_6349 291
227 3300047322 Ga0495680_0016943 Ga0495680_0016943_5157_6089 291
228 3300047322 Ga0495680_0176700 Ga0495680_0176700_245_1159 291
229 3300047444 Ga0495675_0023782 Ga0495675_0023782_856_1788 291
230 3300047471 Ga0495684_0056064 Ga0495684_0056064_15_911 291
231 3300047471 Ga0495684_0057268 Ga0495684_0057268_452_1384 291
232 3300047673 Ga0495593_0029796 Ga0495593_0029796_892_1788 291
233 3300048088 Ga0495602_0022560 Ga0495602_0022560_2489_3385 291
234 3300048088 Ga0495602_0142857 Ga0495602_0142857_555_1487 291
235 3300048903 Ga0496100_0004895 Ga0496100_0004895_392_1285 291
236 3300048904 Ga0496101_0000652 Ga0496101_0000652_9056_9949 291
237 3300048904 Ga0496101_0024798 Ga0496101_0024798_2039_2935 291
238 3300048905 Ga0496102_0258118 Ga0496102_0258118_303_1199 291
239 3300048906 Ga0496103_0056892 Ga0496103_0056892_1348_2241 291
240 3300048907 Ga0496104_0010746 Ga0496104_0010746_4352_5248 291
241 3300048908 Ga0496105_0000642 Ga0496105_0000642_13367_14260 291
242 3300048908 Ga0496105_0018385 Ga0496105_0018385_1674_2570 291
243 3300048909 Ga0496106_0009548 Ga0496106_0009548_4822_5715 291
244 3300048909 Ga0496106_0198499 Ga0496106_0198499_593_1489 291
245 3300048910 Ga0496107_0034232 Ga0496107_0034232_1064_1957 291
246 3300048911 Ga0496108_0003234 Ga0496108_0003234_8845_9738 291
247 3300048911 Ga0496108_0281392 Ga0496108_0281392_200_1096 291
248 3300048912 Ga0496109_0004096 Ga0496109_0004096_6393_7286 291
249 3300048913 Ga0496110_0005806 Ga0496110_0005806_7534_8427 291
250 3300048914 Ga0496111_0083142 Ga0496111_0083142_1089_1982 291
251 3300048915 Ga0496112_0000160 Ga0496112_0000160_24655_25551 291
252 3300048915 Ga0496112_0143188 Ga0496112_0143188_323_1216 291
253 3300048916 Ga0496113_0074024 Ga0496113_0074024_1168_2064 291
254 3300048916 Ga0496113_0136988 Ga0496113_0136988_245_1138 291
255 3300048916 Ga0496113_0139883 Ga0496113_0139883_309_1205 291
256 3300048917 Ga0496114_0002803 Ga0496114_0002803_5721_6614 291
257 3300048917 Ga0496114_0069834 Ga0496114_0069834_282_1202 291
258 3300048918 Ga0496115_0000787 Ga0496115_0000787_4734_5627 291
259 3300048918 Ga0496115_0351456 Ga0496115_0351456_234_1121 291
260 3300049574 Ga0501038_0369123 Ga0501038_0369123_115_1020 291
261 3300049576 Ga0501040_0103224 Ga0501040_0103224_345_1250 291
262 3300049578 Ga0501042_0121293 Ga0501042_0121293_429_1334 291
263 3300049590 Ga0501074_0236536 Ga0501074_0236536_159_1064 291
264 3300049593 Ga0501077_0007928 Ga0501077_0007928_1543_2439 291
265 3300049593 Ga0501077_0141675 Ga0501077_0141675_573_1478 291
266 3300049741 Ga0501079_0129183 Ga0501079_0129183_670_1575 291
267 3300049743 Ga0501081_0058679 Ga0501081_0058679_1712_2617 291
268 3300050491 nmdc:mga00v17_28787_c2 nmdc:mga00v17_28787_c2_895_1794 291
269 3300050492 nmdc:mga0yw44_68217_c1 nmdc:mga0yw44_68217_c1_1060_1959 291
270 3300050508 nmdc:mga09592_71552_c1 nmdc:mga09592_71552_c1_204_1100 291
271 3300050511 nmdc:mga08y16_52404_c1 nmdc:mga08y16_52404_c1_554_1450 291
272 3300050513 nmdc:mga0rr50_5555_c1 nmdc:mga0rr50_5555_c1_752_1648 291
273 3300050515 nmdc:mga0a205_18893_c1 nmdc:mga0a205_18893_c1_1028_2023 291
274 3300053084 Ga0495595_0018603 Ga0495595_0018603_71_1003 291
275 3300053084 Ga0495595_0093685 Ga0495595_0093685_364_1278 291
276 3300053085 Ga0495619_0130378 Ga0495619_0130378_92_1024 291
277 3300060353 Ga0501082_0036301 Ga0501082_0036301_3157_4062 291
278 3300005434 Ga0070709_10013726 Ga0070709_100137263 292
279 3300005435 Ga0070714_100005839 Ga0070714_1000058395 292
280 3300005437 Ga0070710_10127845 Ga0070710_101278452 292
281 3300005439 Ga0070711_100017193 Ga0070711_1000171933 292
282 3300006175 Ga0070712_100062439 Ga0070712_1000624391 292
283 3300014968 Ga0157379_10460298 Ga0157379_104602982 292
284 3300025898 Ga0207692_10131538 Ga0207692_101315382 292
285 3300025915 Ga0207693_10131170 Ga0207693_101311701 292
286 3300025916 Ga0207663_10011295 Ga0207663_100112954 292
287 3300025929 Ga0207664_10086427 Ga0207664_100864272 292
288 3300036401 Ga0373937_0023503 Ga0373937_0023503_2708_3610 292
289 3300046463 Ga0495653_0045890 Ga0495653_0045890_1114_2016 292
290 3300046511 Ga0495608_0050428 Ga0495608_0050428_1392_2294 292
291 3300046514 Ga0495618_0000137 Ga0495618_0000137_20762_21661 292
292 3300046516 Ga0495628_0178019 Ga0495628_0178019_663_1568 292
293 3300046559 Ga0495667_0008336 Ga0495667_0008336_3381_4283 292
294 3300047317 Ga0495604_0001056 Ga0495604_0001056_16265_17209 292
295 3300047322 Ga0495680_0005828 Ga0495680_0005828_2180_3082 292
296 3300048088 Ga0495602_0213639 Ga0495602_0213639_425_1327 292
297 3300048903 Ga0496100_0093237 Ga0496100_0093237_792_1703 292
298 3300048905 Ga0496102_0335993 Ga0496102_0335993_73_984 292
299 3300048918 Ga0496115_0003468 Ga0496115_0003468_8113_9024 292
300 3300053077 Ga0495601_0047167 Ga0495601_0047167_667_1620 292
301 3300005329 Ga0070683_100149471 Ga0070683_1001494712 293
302 3300005338 Ga0068868_100079077 Ga0068868_1000790772 293
303 3300005437 Ga0070710_10012814 Ga0070710_100128144 293
304 3300005467 Ga0070706_100003067 Ga0070706_10000306711 293
305 3300005471 Ga0070698_100443690 Ga0070698_1004436902 293
306 3300005547 Ga0070693_100184739 Ga0070693_1001847392 293
307 3300005563 Ga0068855_100242101 Ga0068855_1002421012 293
308 3300005564 Ga0070664_100096627 Ga0070664_1000966272 293
309 3300006028 Ga0070717_10250139 Ga0070717_102501392 293
310 3300006175 Ga0070712_100251376 Ga0070712_1002513762 293
311 3300006871 Ga0075434_100029858 Ga0075434_1000298584 293
312 3300006871 Ga0075434_100091419 Ga0075434_1000914192 293
313 3300006914 Ga0075436_100009227 Ga0075436_1000092275 293
314 3300007076 Ga0075435_100000484 Ga0075435_10000048420 293
315 3300009093 Ga0105240_10050353 Ga0105240_100503535 293
316 3300009545 Ga0105237_10314473 Ga0105237_103144731 293
317 3300009551 Ga0105238_10118339 Ga0105238_101183392 293
318 3300010375 Ga0105239_10255897 Ga0105239_102558972 293
319 3300013104 Ga0157370_10095734 Ga0157370_100957343 293
320 3300013296 Ga0157374_10747156 Ga0157374_107471561 293
321 3300013307 Ga0157372_10057795 Ga0157372_100577953 293
322 3300020069 Ga0197907_11435335 Ga0197907_114353352 293
323 3300020070 Ga0206356_10077594 Ga0206356_100775942 293
324 3300022467 Ga0224712_10014516 Ga0224712_100145161 293
325 3300025898 Ga0207692_10024210 Ga0207692_100242102 293
326 3300025912 Ga0207707_10016397 Ga0207707_100163973 293
327 3300025913 Ga0207695_10043099 Ga0207695_100430996 293
328 3300025929 Ga0207664_10107969 Ga0207664_101079691 293
329 3300025945 Ga0207679_10042270 Ga0207679_100422702 293
330 3300026116 Ga0207674_10150973 Ga0207674_101509733 293
331 3300048905 Ga0496102_0165579 Ga0496102_0165579_845_1774 293
332 3300048907 Ga0496104_0199481 Ga0496104_0199481_744_1673 293
333 3300048908 Ga0496105_0282804 Ga0496105_0282804_282_1211 293
334 3300048912 Ga0496109_0016172 Ga0496109_0016172_4366_5295 293
335 3300048913 Ga0496110_0055719 Ga0496110_0055719_72_1001 293
336 3300048914 Ga0496111_0124124 Ga0496111_0124124_689_1618 293
337 3300048915 Ga0496112_0104582 Ga0496112_0104582_758_1687 293
338 3300048916 Ga0496113_0169390 Ga0496113_0169390_437_1366 293
339 3300049583 Ga0501067_0006322 Ga0501067_0006322_1829_2758 293
340 3300049585 Ga0501069_0039336 Ga0501069_0039336_502_1431 293
341 3300050512 nmdc:mga0n895_94932_c1 nmdc:mga0n895_94932_c1_1731_2660 293
342 3300050513 nmdc:mga0rr50_139395_c1 nmdc:mga0rr50_139395_c1_328_1257 293
343 3300050513 nmdc:mga0rr50_20635_c1 nmdc:mga0rr50_20635_c1_44_967 293
344 3300050514 nmdc:mga08x19_61701_c1 nmdc:mga08x19_61701_c1_1174_2103 293
345 3300050515 nmdc:mga0a205_109755_c1 nmdc:mga0a205_109755_c1_1499_2428 293
346 3300006163 Ga0070715_10016679 Ga0070715_100166793 294
347 3300035724 Ga0373933_0102183 Ga0373933_0102183_433_1395 294
348 3300046511 Ga0495608_0107042 Ga0495608_0107042_64_993 294
349 3300047317 Ga0495604_0282976 Ga0495604_0282976_118_1080 294
350 3300047322 Ga0495680_0277131 Ga0495680_0277131_168_1130 294
351 3300053084 Ga0495595_0045272 Ga0495595_0045272_809_1771 294
352 3300005329 Ga0070683_100096083 Ga0070683_1000960832 295
353 3300005434 Ga0070709_10102006 Ga0070709_101020062 295
354 3300005436 Ga0070713_100170178 Ga0070713_1001701782 295
355 3300005440 Ga0070705_100014028 Ga0070705_1000140282 295
356 3300005468 Ga0070707_100096355 Ga0070707_1000963552 295
357 3300005563 Ga0068855_100092470 Ga0068855_1000924703 295
358 3300005614 Ga0068856_100086725 Ga0068856_1000867252 295
359 3300005618 Ga0068864_100186746 Ga0068864_1001867462 295
360 3300005843 Ga0068860_100247560 Ga0068860_1002475602 295
361 3300006028 Ga0070717_10624836 Ga0070717_106248361 295
362 3300006358 Ga0068871_100083894 Ga0068871_1000838942 295
363 3300009098 Ga0105245_10032760 Ga0105245_100327603 295
364 3300009545 Ga0105237_10229519 Ga0105237_102295192 295
365 3300013306 Ga0163162_10220666 Ga0163162_102206662 295
366 3300013307 Ga0157372_10211137 Ga0157372_102111372 295
367 3300014325 Ga0163163_10039545 Ga0163163_100395453 295
368 3300014968 Ga0157379_10072099 Ga0157379_100720993 295
369 3300014969 Ga0157376_10003602 Ga0157376_100036022 295
370 3300022467 Ga0224712_10065862 Ga0224712_100658622 295
371 3300025906 Ga0207699_10159317 Ga0207699_101593172 295
372 3300025916 Ga0207663_10000349 Ga0207663_1000034915 295
373 3300025916 Ga0207663_10091327 Ga0207663_100913272 295
374 3300025924 Ga0207694_10057435 Ga0207694_100574352 295
375 3300025927 Ga0207687_10014388 Ga0207687_100143882 295
376 3300025928 Ga0207700_10052725 Ga0207700_100527253 295
377 3300025929 Ga0207664_10129014 Ga0207664_101290142 295
378 3300025939 Ga0207665_10025735 Ga0207665_100257353 295
379 3300025949 Ga0207667_10638114 Ga0207667_106381142 295
380 3300026023 Ga0207677_10262882 Ga0207677_102628822 295
381 3300026078 Ga0207702_10099472 Ga0207702_100994724 295
382 3300026078 Ga0207702_10202929 Ga0207702_102029292 295
383 3300026095 Ga0207676_10054568 Ga0207676_100545682 295
384 3300028381 Ga0268264_10159219 Ga0268264_101592192 295
385 3300035116 Ga0373945_0095224 Ga0373945_0095224_193_1110 295
386 3300035171 Ga0373946_0014745 Ga0373946_0014745_1220_2137 295
387 3300046462 Ga0495651_0125088 Ga0495651_0125088_414_1382 295
388 3300046463 Ga0495653_0018771 Ga0495653_0018771_2764_3681 295
389 3300046475 Ga0495639_0158794 Ga0495639_0158794_154_1071 295
390 3300046514 Ga0495618_0111878 Ga0495618_0111878_785_1687 295
391 3300046680 Ga0495646_0114923 Ga0495646_0114923_25_993 295
392 3300047319 Ga0495674_0112381 Ga0495674_0112381_1287_2255 295
393 3300047321 Ga0495676_0120091 Ga0495676_0120091_269_1186 295
394 3300048905 Ga0496102_0390377 Ga0496102_0390377_53_985 295
395 3300048907 Ga0496104_0013725 Ga0496104_0013725_3617_4549 295
396 3300048908 Ga0496105_0194283 Ga0496105_0194283_348_1280 295
397 3300048911 Ga0496108_0057722 Ga0496108_0057722_912_1844 295
398 3300048913 Ga0496110_0058912 Ga0496110_0058912_382_1314 295
399 3300048914 Ga0496111_0044041 Ga0496111_0044041_721_1653 295
400 3300048916 Ga0496113_0141784 Ga0496113_0141784_497_1429 295
401 3300048917 Ga0496114_0113511 Ga0496114_0113511_761_1693 295
402 3300053078 Ga0495612_0073785 Ga0495612_0073785_21_938 295

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13732

DUF4162

Domain of unknown function (DUF4162)

222

300

0.91

PF00005

ABC_tran

ABC transporter

23

169

0.88

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

79

204

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rvc-assembly1.cif.gz_A structure of atp binding subunit of abc transporter 0.9302 2 217
8eop-assembly1.cif.gz_A cryo-em structure of nanodisc reconstituted human abca7 eq mutant in atp bound closed state 0.9291 2 217
7ahd-assembly1.cif.gz_D opua (e190q) occluded 0.9264 3 216
5lj7-assembly1.cif.gz_B structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) 0.9242 1 212
5lil-assembly1.cif.gz_B structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) 0.923 1 213
ID Description Score Start End Superfamily
af_O86311_2_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.984 2 220 3.40.50.300
af_O53149_2_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9602 1 216 3.40.50.300
af_E7F3Y5_15_267_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9497 2 216 3.40.50.300
af_P78363_1926_2175_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9455 2 217 3.40.50.300
af_P9WQL7_7_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9426 2 217 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A258H969-F1-model_v4 ABC transporter ATP-binding protein 0.988 4 217 GO:0005524
GO:0016887
AF-A0A1G6INW8-F1-model_v4 ABC-2 type transport system ATP-binding protein 0.9678 4 217 GO:0005524
GO:0016887
AF-A0A800BAR4-F1-model_v4 deleted 0.9639 1 217
AF-A0A7X7K1P0-F1-model_v4 ABC transporter ATP-binding protein 0.96 2 217 GO:0005524
GO:0016887
AF-A0A2G6KM48-F1-model_v4 ABC transporter ATP-binding protein 0.9593 4 216 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
88.87 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map