F435051

General Info

Members Datasets Scaffolds Average Seq Length
402 178 400 101

Family's Representative Sequence

Representative Sequence 3300005840|Ga0068870_11105327|Ga0068870_111053271
Length 109
Sequence MIFLTQLIYKEGQESVFHLFEDVAIPAILKYNGRLLLRVRPTENNFMDHIDKPYEIHQVEFADEQDFENFKLDEERNKLLHLKEQSIKSVFIDKRDKNMTTKKAAATSS

Samples

Sample ID Description Type Environment
1 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
2 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
87 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
138 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
139 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
140 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
141 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
152 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
153 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
154 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
155 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
160 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
161 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
162 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
163 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
164 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
175 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
176 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0
Isolates 0.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.5
Nodule 0
Rhizoplane 2.24
Rhizosphere 95.52
Stem 0
Stem Tuber 0
Unclassified 1.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1016032 3300002741 Bacteria 918
2 rootL2_10206646 3300003322 Bacteria 2525
3 Ga0065712_10044988 3300005290 Bacteria 702
4 Ga0065715_10356388 3300005293 Bacteria 942
5 Ga0070658_10303113 3300005327 Bacteria 1362
6 Ga0070658_10361417 3300005327 Unclassified 1243
7 Ga0070658_11892404 3300005327 Unclassified 515
8 Ga0070676_10209048 3300005328 Bacteria 1283
9 Ga0070676_10404679 3300005328 Unclassified 950
10 Ga0070690_100078241 3300005330 Bacteria 2160
11 Ga0070670_100043854 3300005331 Bacteria 3845
12 Ga0070670_100437860 3300005331 Bacteria 1157
13 Ga0070670_100931274 3300005331 Bacteria 788
14 Ga0070677_10234501 3300005333 Bacteria 903
15 Ga0068869_100209194 3300005334 Unclassified 1541
16 Ga0068869_100218321 3300005334 Bacteria 1510
17 Ga0068869_100342239 3300005334 Bacteria 1217
18 Ga0068869_100507494 3300005334 Bacteria 1008
19 Ga0070666_10000041 3300005335 Bacteria 112410
20 Ga0070666_10126316 3300005335 Bacteria 1775
21 Ga0070680_101840435 3300005336 Bacteria 525
22 Ga0068868_100062479 3300005338 Bacteria 2952
23 Ga0068868_100855396 3300005338 Bacteria 824
24 Ga0068868_101282323 3300005338 Bacteria 680
25 Ga0070660_100120402 3300005339 Bacteria 2094
26 Ga0070689_100002582 3300005340 Bacteria 11866
27 Ga0070689_101827782 3300005340 Bacteria 554
28 Ga0070668_100155041 3300005347 Bacteria 1855
29 Ga0070668_100440203 3300005347 Bacteria 1119
30 Ga0070668_100859526 3300005347 Bacteria 809
31 Ga0070668_100872037 3300005347 Unclassified 803
32 Ga0070675_100048258 3300005354 Bacteria 3491
33 Ga0070675_100292260 3300005354 Bacteria 1434
34 Ga0070675_100706597 3300005354 Bacteria 918
35 Ga0070671_100036010 3300005355 Unclassified 4103
36 Ga0070671_100171667 3300005355 Bacteria 1834
37 Ga0070671_100457152 3300005355 Bacteria 1096
38 Ga0070674_100186240 3300005356 Bacteria 1593
39 Ga0070674_100699852 3300005356 Unclassified 866
40 Ga0070673_100454798 3300005364 Bacteria 1152
41 Ga0070673_100672883 3300005364 Bacteria 949
42 Ga0070673_101985946 3300005364 Bacteria 552
43 Ga0070688_100132653 3300005365 Bacteria 1683
44 Ga0070688_100143219 3300005365 Bacteria 1626
45 Ga0070659_100693394 3300005366 Bacteria 880
46 Ga0070667_100031683 3300005367 Bacteria 4408
47 Ga0070667_100104404 3300005367 Bacteria 2451
48 Ga0070667_100179380 3300005367 Unclassified 1873
49 Ga0070667_100435607 3300005367 Bacteria 1197
50 Ga0070667_100567116 3300005367 Bacteria 1044
51 Ga0070713_102171355 3300005436 Bacteria 538
52 Ga0070711_100577974 3300005439 Bacteria 935
53 Ga0070678_100411347 3300005456 Bacteria 1177
54 Ga0070662_100367145 3300005457 Bacteria 1182
55 Ga0070662_100527419 3300005457 Bacteria 987
56 Ga0070681_10292874 3300005458 Bacteria 1538
57 Ga0070681_10647783 3300005458 Bacteria 971
58 Ga0070681_11931576 3300005458 Bacteria 518
59 Ga0068867_100083727 3300005459 Bacteria 2408
60 Ga0068867_100105779 3300005459 Unclassified 2155
61 Ga0068867_100665147 3300005459 Bacteria 915
62 Ga0068867_101405368 3300005459 Bacteria 647
63 Ga0070685_10992947 3300005466 Bacteria 629
64 Ga0070679_100123240 3300005530 Bacteria 2575
65 Ga0070679_100697282 3300005530 Unclassified 958
66 Ga0070679_100776103 3300005530 Bacteria 901
67 Ga0070679_100981707 3300005530 Bacteria 788
68 Ga0070679_101484942 3300005530 Bacteria 625
69 Ga0070684_100446929 3300005535 Bacteria 1195
70 Ga0070684_100546608 3300005535 Bacteria 1075
71 Ga0070684_101248238 3300005535 Bacteria 699
72 Ga0068853_100043769 3300005539 Bacteria 3830
73 Ga0070672_100226070 3300005543 Bacteria 1571
74 Ga0070672_100253117 3300005543 Bacteria 1484
75 Ga0070672_101095102 3300005543 Bacteria 708
76 Ga0070672_102070887 3300005543 Bacteria 513
77 Ga0070693_100469085 3300005547 Bacteria 887
78 Ga0070665_100106699 3300005548 Unclassified 2803
79 Ga0070665_101092664 3300005548 Bacteria 809
80 Ga0068855_100113331 3300005563 Bacteria 3111
81 Ga0068855_100332593 3300005563 Bacteria 1677
82 Ga0068855_100382834 3300005563 Bacteria 1544
83 Ga0068855_100635425 3300005563 Bacteria 1148
84 Ga0070664_100400702 3300005564 Bacteria 1255
85 Ga0070664_101324427 3300005564 Bacteria 680
86 Ga0070664_101595516 3300005564 Unclassified 618
87 Ga0068857_100118040 3300005577 Bacteria 2388
88 Ga0068857_100838469 3300005577 Bacteria 879
89 Ga0068856_100017480 3300005614 Bacteria 6949
90 Ga0068856_100817318 3300005614 Bacteria 951
91 Ga0068856_101426770 3300005614 Bacteria 707
92 Ga0068852_100055301 3300005616 Bacteria 3425
93 Ga0068852_100131197 3300005616 Bacteria 2308
94 Ga0068852_101288220 3300005616 Bacteria 752
95 Ga0068852_102832741 3300005616 Bacteria 503
96 Ga0068859_100000083 3300005617 Bacteria 87079
97 Ga0068859_100001069 3300005617 Bacteria 28045
98 Ga0068859_100072147 3300005617 Bacteria 3489
99 Ga0068859_100276986 3300005617 Bacteria 1770
100 Ga0068859_100298723 3300005617 Bacteria 1704
101 Ga0068859_100869292 3300005617 Bacteria 987
102 Ga0068864_100089637 3300005618 Bacteria 2710
103 Ga0068864_100208555 3300005618 Bacteria 1798
104 Ga0068864_101417238 3300005618 Bacteria 697
105 Ga0068861_102669755 3300005719 Unclassified 504
106 Ga0068851_10034061 3300005834 Bacteria 2541
107 Ga0068870_11105327 3300005840 Bacteria 570
108 Ga0068863_100002508 3300005841 Bacteria 18243
109 Ga0068863_100095723 3300005841 Bacteria 2818
110 Ga0068863_100460316 3300005841 Bacteria 1249
111 Ga0068858_100017208 3300005842 Bacteria 6784
112 Ga0068858_100019688 3300005842 Bacteria 6310
113 Ga0068858_100636847 3300005842 Bacteria 1036
114 Ga0068858_101386485 3300005842 Bacteria 692
115 Ga0068860_100000827 3300005843 Bacteria 34623
116 Ga0068860_100002451 3300005843 Bacteria 19478
117 Ga0068860_100372596 3300005843 Bacteria 1408
118 Ga0068860_101370730 3300005843 Bacteria 728
119 Ga0068860_102618980 3300005843 Bacteria 523
120 Ga0070715_10291058 3300006163 Bacteria 870
121 Ga0097621_100001392 3300006237 Bacteria 16647
122 Ga0097621_100094136 3300006237 Unclassified 2511
123 Ga0097621_100636880 3300006237 Bacteria 977
124 Ga0097621_100644449 3300006237 Bacteria 972
125 Ga0068871_100006722 3300006358 Bacteria 8163
126 Ga0068871_100008886 3300006358 Bacteria 7246
127 Ga0068871_100373197 3300006358 Bacteria 1266
128 Ga0068871_100514929 3300006358 Bacteria 1080
129 Ga0075434_100332758 3300006871 Bacteria 1539
130 Ga0068865_100042712 3300006881 Bacteria 3093
131 Ga0068865_100479085 3300006881 Bacteria 1034
132 Ga0097620_100000083 3300006931 Bacteria 87079
133 Ga0097620_100001069 3300006931 Bacteria 28045
134 Ga0097620_100072146 3300006931 Bacteria 3489
135 Ga0097620_100277014 3300006931 Bacteria 1770
136 Ga0097620_100298740 3300006931 Bacteria 1704
137 Ga0097620_100869260 3300006931 Bacteria 987
138 Ga0105251_10087581 3300009011 Bacteria 1433
139 Ga0105240_10302390 3300009093 Bacteria 1830
140 Ga0105240_10325776 3300009093 Bacteria 1750
141 Ga0111539_12585481 3300009094 Unclassified 589
142 Ga0105245_10159145 3300009098 Bacteria 2142
143 Ga0105247_10009535 3300009101 Bacteria 5891
144 Ga0105247_10694521 3300009101 Bacteria 765
145 Ga0105247_10732115 3300009101 Bacteria 748
146 Ga0105243_12198963 3300009148 Bacteria 588
147 Ga0105241_10006143 3300009174 Bacteria 8854
148 Ga0105241_10471256 3300009174 Bacteria 1114
149 Ga0105242_10081442 3300009176 Unclassified 2707
150 Ga0105242_10354222 3300009176 Bacteria 1356
151 Ga0105242_11982210 3300009176 Bacteria 624
152 Ga0105248_10086808 3300009177 Bacteria 3521
153 Ga0105248_10487910 3300009177 Bacteria 1389
154 Ga0105237_10009157 3300009545 Bacteria 10637
155 Ga0105237_10011122 3300009545 Bacteria 9541
156 Ga0105237_10320345 3300009545 Bacteria 1554
157 Ga0105237_10415155 3300009545 Bacteria 1351
158 Ga0105237_10467211 3300009545 Bacteria 1268
159 Ga0105238_10053158 3300009551 Bacteria 4070
160 Ga0105249_10117982 3300009553 Unclassified 2518
161 Ga0105249_12274071 3300009553 Bacteria 615
162 Ga0105239_10000010 3300010375 Bacteria 341545
163 Ga0105239_10049235 3300010375 Bacteria 4621
164 Ga0105239_10232247 3300010375 Bacteria 2069
165 Ga0105246_10002179 3300011119 Bacteria 11813
166 Ga0105246_10387799 3300011119 Unclassified 1156
167 Ga0105246_12047040 3300011119 Unclassified 553
168 Ga0157373_10419367 3300013100 Bacteria 961
169 Ga0157373_10784676 3300013100 Unclassified 702
170 Ga0157373_11273663 3300013100 Unclassified 556
171 Ga0157373_11476015 3300013100 Unclassified 518
172 Ga0157371_10148785 3300013102 Bacteria 1670
173 Ga0157371_10453549 3300013102 Unclassified 943
174 Ga0157371_10466211 3300013102 Bacteria 930
175 Ga0157371_10947452 3300013102 Bacteria 655
176 Ga0157371_10981312 3300013102 Unclassified 644
177 Ga0157371_11369367 3300013102 Bacteria 549
178 Ga0157371_11491788 3300013102 Bacteria 527
179 Ga0157371_11529070 3300013102 Bacteria 521
180 Ga0157370_10001951 3300013104 Bacteria 25406
181 Ga0157370_10739867 3300013104 Bacteria 896
182 Ga0157369_10211342 3300013105 Bacteria 2033
183 Ga0157369_10523299 3300013105 Bacteria 1227
184 Ga0157369_10722772 3300013105 Unclassified 1025
185 Ga0157374_12372640 3300013296 Bacteria 558
186 Ga0157374_12395242 3300013296 Unclassified 555
187 Ga0157378_10009049 3300013297 Bacteria 8667
188 Ga0157378_10017523 3300013297 Bacteria 6287
189 Ga0157378_10130941 3300013297 Unclassified 2322
190 Ga0163162_10053973 3300013306 Bacteria 4041
191 Ga0163162_10147820 3300013306 Bacteria 2467
192 Ga0163162_10155790 3300013306 Unclassified 2404
193 Ga0163162_10285247 3300013306 Bacteria 1783
194 Ga0163162_10324093 3300013306 Bacteria 1673
195 Ga0163162_10463910 3300013306 Bacteria 1398
196 Ga0163162_10529673 3300013306 Bacteria 1307
197 Ga0163162_10546039 3300013306 Bacteria 1287
198 Ga0163162_10638162 3300013306 Bacteria 1189
199 Ga0163162_10953712 3300013306 Bacteria 969
200 Ga0163162_11921862 3300013306 Bacteria 677
201 Ga0163162_12052786 3300013306 Unclassified 655
202 Ga0157372_10675175 3300013307 Bacteria 1203
203 Ga0157372_10687250 3300013307 Unclassified 1191
204 Ga0157372_11440649 3300013307 Bacteria 794
205 Ga0157372_11953266 3300013307 Bacteria 674
206 Ga0157372_12492688 3300013307 Bacteria 594
207 Ga0157372_12690748 3300013307 Bacteria 571
208 Ga0157372_13202973 3300013307 Unclassified 522
209 Ga0157375_10000870 3300013308 Bacteria 26284
210 Ga0157375_10097261 3300013308 Bacteria 3018
211 Ga0157375_10130418 3300013308 Bacteria 2632
212 Ga0157375_10521543 3300013308 Bacteria 1351
213 Ga0157375_10665779 3300013308 Bacteria 1196
214 Ga0157375_10940928 3300013308 Bacteria 1006
215 Ga0157375_10990833 3300013308 Bacteria 980
216 Ga0157375_11052151 3300013308 Unclassified 951
217 Ga0157375_11267758 3300013308 Bacteria 866
218 Ga0157375_11270790 3300013308 Unclassified 865
219 Ga0163163_10001885 3300014325 Bacteria 17734
220 Ga0163163_10053680 3300014325 Bacteria 3979
221 Ga0163163_10390212 3300014325 Bacteria 1450
222 Ga0163163_10656445 3300014325 Bacteria 1112
223 Ga0163163_12858805 3300014325 Bacteria 539
224 Ga0163163_12921857 3300014325 Unclassified 533
225 Ga0157380_10270572 3300014326 Bacteria 1549
226 Ga0157379_10035924 3300014968 Bacteria 4419
227 Ga0157379_10207345 3300014968 Bacteria 1773
228 Ga0157379_10490929 3300014968 Bacteria 1137
229 Ga0157379_11123644 3300014968 Bacteria 753
230 Ga0157376_10001836 3300014969 Bacteria 14150
231 Ga0157376_10143098 3300014969 Unclassified 2148
232 Ga0157376_10149499 3300014969 Bacteria 2105
233 Ga0157376_10430240 3300014969 Bacteria 1283
234 Ga0163161_10006687 3300017792 Bacteria 7979
235 Ga0163161_10362078 3300017792 Unclassified 1155
236 Ga0163161_11290675 3300017792 Bacteria 634
237 Ga0163161_11545529 3300017792 Bacteria 584
238 Ga0209026_1000388 3300025250 Bacteria 39840
239 Ga0209050_1008683 3300025298 Bacteria 5363
240 Ga0207656_10148995 3300025321 Bacteria 1107
241 Ga0207682_10031503 3300025893 Bacteria 2128
242 Ga0207682_10281085 3300025893 Bacteria 778
243 Ga0207710_10060049 3300025900 Bacteria 1722
244 Ga0207680_10000077 3300025903 Bacteria 43842
245 Ga0207647_10242674 3300025904 Bacteria 1034
246 Ga0207647_10686044 3300025904 Unclassified 559
247 Ga0207685_10492335 3300025905 Bacteria 644
248 Ga0207645_10558804 3300025907 Bacteria 776
249 Ga0207645_11226754 3300025907 Unclassified 503
250 Ga0207705_10902397 3300025909 Bacteria 684
251 Ga0207654_10004997 3300025911 Bacteria 6704
252 Ga0207654_10817058 3300025911 Bacteria 674
253 Ga0207707_10542112 3300025912 Bacteria 989
254 Ga0207707_10592193 3300025912 Bacteria 939
255 Ga0207695_10302102 3300025913 Bacteria 1492
256 Ga0207695_10306803 3300025913 Bacteria 1478
257 Ga0207695_10447138 3300025913 Unclassified 1175
258 Ga0207671_10001576 3300025914 Bacteria 25992
259 Ga0207671_10006719 3300025914 Bacteria 10188
260 Ga0207671_10222721 3300025914 Bacteria 1478
261 Ga0207671_11007015 3300025914 Bacteria 656
262 Ga0207663_10849647 3300025916 Bacteria 728
263 Ga0207657_10027597 3300025919 Bacteria 5198
264 Ga0207652_10091936 3300025921 Bacteria 2668
265 Ga0207652_10810156 3300025921 Bacteria 831
266 Ga0207694_10122179 3300025924 Bacteria 2080
267 Ga0207650_10178367 3300025925 Unclassified 1692
268 Ga0207650_10499065 3300025925 Bacteria 1017
269 Ga0207650_10662176 3300025925 Unclassified 880
270 Ga0207650_10873224 3300025925 Bacteria 763
271 Ga0207650_11133579 3300025925 Bacteria 666
272 Ga0207659_10162372 3300025926 Bacteria 1755
273 Ga0207659_11776777 3300025926 Bacteria 524
274 Ga0207700_10406333 3300025928 Bacteria 1194
275 Ga0207644_10026047 3300025931 Unclassified 4026
276 Ga0207644_10088701 3300025931 Unclassified 2301
277 Ga0207644_10419340 3300025931 Bacteria 1096
278 Ga0207706_10499044 3300025933 Bacteria 1051
279 Ga0207706_10736687 3300025933 Unclassified 840
280 Ga0207686_10290186 3300025934 Unclassified 1211
281 Ga0207709_10122292 3300025935 Bacteria 1759
282 Ga0207670_10251639 3300025936 Bacteria 1366
283 Ga0207670_10645676 3300025936 Bacteria 872
284 Ga0207669_10174710 3300025937 Bacteria 1533
285 Ga0207669_10412985 3300025937 Unclassified 1060
286 Ga0207704_11280913 3300025938 Unclassified 626
287 Ga0207704_11469939 3300025938 Bacteria 584
288 Ga0207691_10011633 3300025940 Bacteria 8447
289 Ga0207691_10326710 3300025940 Bacteria 1315
290 Ga0207691_11447554 3300025940 Bacteria 563
291 Ga0207711_10475029 3300025941 Bacteria 1164
292 Ga0207689_10002044 3300025942 Bacteria 19050
293 Ga0207689_10020626 3300025942 Bacteria 5542
294 Ga0207689_11529007 3300025942 Bacteria 557
295 Ga0207661_10068778 3300025944 Bacteria 2885
296 Ga0207679_10300110 3300025945 Bacteria 1384
297 Ga0207679_12109026 3300025945 Unclassified 512
298 Ga0207667_10232385 3300025949 Bacteria 1888
299 Ga0207667_10539587 3300025949 Bacteria 1180
300 Ga0207651_10046382 3300025960 Bacteria 2922
301 Ga0207651_10584530 3300025960 Bacteria 975
302 Ga0207651_11098943 3300025960 Unclassified 713
303 Ga0207651_11288650 3300025960 Bacteria 657
304 Ga0207712_10256438 3300025961 Unclassified 1416
305 Ga0207712_11435057 3300025961 Bacteria 618
306 Ga0207712_11668127 3300025961 Bacteria 571
307 Ga0207668_10088528 3300025972 Unclassified 2268
308 Ga0207668_10337863 3300025972 Bacteria 1255
309 Ga0207668_10348360 3300025972 Bacteria 1238
310 Ga0207640_10946912 3300025981 Bacteria 755
311 Ga0207640_12194056 3300025981 Bacteria 501
312 Ga0207658_10017506 3300025986 Bacteria 4940
313 Ga0207658_10204625 3300025986 Bacteria 1650
314 Ga0207658_10322081 3300025986 Bacteria 1338
315 Ga0207658_10501661 3300025986 Bacteria 1081
316 Ga0207658_11171128 3300025986 Bacteria 703
317 Ga0207677_10047403 3300026023 Bacteria 2885
318 Ga0207677_10095901 3300026023 Bacteria 2169
319 Ga0207703_10003481 3300026035 Bacteria 13177
320 Ga0207703_11044598 3300026035 Bacteria 784
321 Ga0207639_10687483 3300026041 Bacteria 948
322 Ga0207702_10010674 3300026078 Bacteria 7674
323 Ga0207702_10048897 3300026078 Bacteria 3567
324 Ga0207641_10000975 3300026088 Bacteria 29289
325 Ga0207641_10080009 3300026088 Bacteria 2834
326 Ga0207648_10072849 3300026089 Bacteria 2994
327 Ga0207648_10084057 3300026089 Bacteria 2776
328 Ga0207648_10178685 3300026089 Unclassified 1878
329 Ga0207648_10221581 3300026089 Bacteria 1681
330 Ga0207648_10398268 3300026089 Bacteria 1247
331 Ga0207676_10120405 3300026095 Bacteria 2212
332 Ga0207676_10188837 3300026095 Bacteria 1811
333 Ga0207674_10073693 3300026116 Bacteria 3427
334 Ga0207674_10230816 3300026116 Bacteria 1798
335 Ga0207675_100006202 3300026118 Bacteria 11353
336 Ga0207675_101674116 3300026118 Bacteria 656
337 Ga0207683_10081979 3300026121 Bacteria 2864
338 Ga0207683_10134848 3300026121 Bacteria 2222
339 Ga0207698_10057947 3300026142 Bacteria 2999
340 Ga0268264_10010764 3300028381 Bacteria 7557
341 Ga0268264_10026441 3300028381 Bacteria 4743
342 Ga0268264_10339494 3300028381 Bacteria 1426
343 Ga0265327_10000506 3300031251 Bacteria 67655
344 Ga0265316_10798027 3300031344 Bacteria 662
345 Ga0307513_11076257 3300031456 Bacteria 515
346 Ga0307514_10127832 3300031649 Bacteria 1757
347 Ga0307516_10001621 3300031730 Bacteria 30969
348 Ga0307413_11067261 3300031824 Unclassified 696
349 Ga0307412_10855358 3300031911 Unclassified 794
350 Ga0307414_10082260 3300032004 Unclassified 2360
351 Ga0307414_10136291 3300032004 Bacteria 1914
352 Ga0307414_10168093 3300032004 Unclassified 1750
353 Ga0307414_10562289 3300032004 Bacteria 1018
354 Ga0307414_10614200 3300032004 Unclassified 976
355 Ga0307414_10948464 3300032004 Unclassified 790
356 Ga0373937_0562529 3300036401 Bacteria 1083
357 Ga0395899_0025534 3300037312 Bacteria 4459
358 Ga0395900_0174676 3300037418 Bacteria 2185
359 Ga0395900_0251982 3300037418 Bacteria 1766
360 Ga0395898_0176737 3300037466 Unclassified 2040
361 Ga0395898_0330125 3300037466 Bacteria 1454
362 Ga0395898_0724086 3300037466 Bacteria 936
363 Ga0395905_0103714 3300037471 Bacteria 2670
364 Ga0395905_0130133 3300037471 Bacteria 2367
365 Ga0395905_0318252 3300037471 Unclassified 1445
366 Ga0395901_0077620 3300038443 Bacteria 3466
367 Ga0395901_0268886 3300038443 Unclassified 1773
368 Ga0395901_0367489 3300038443 Bacteria 1482
369 Ga0451798_0298876 3300041458 Unclassified 640
370 Ga0451804_0405734 3300041463 Bacteria 857
371 Ga0451837_0070755 3300041494 Unclassified 1762
372 Ga0451577_0044232 3300042876 Bacteria 3987
373 Ga0451577_1588547 3300042876 Unclassified 577
374 Ga0453683_0803560 3300044673 Unclassified 619
375 Ga0453684_0003193 3300044712 Bacteria 37556
376 Ga0453684_0170461 3300044712 Bacteria 2565
377 Ga0453684_0920193 3300044712 Unclassified 935
378 Ga0451576_0001733 3300045051 Bacteria 35888
379 Ga0495580_0102863 3300046472 Bacteria 1986
380 Ga0495582_0510575 3300046473 Bacteria 695
381 Ga0495656_0199155 3300046615 Bacteria 993
382 Ga0495657_0848456 3300046675 Bacteria 521
383 Ga0495581_0214005 3300047315 Bacteria 1127
384 Ga0495636_0000077 3300047318 Bacteria 40716
385 Ga0495672_0006059 3300047320 Bacteria 9445
386 Ga0496101_0185094 3300048904 Bacteria 1605
387 Ga0496109_1610856 3300048912 Bacteria 583
388 Ga0496110_0089987 3300048913 Bacteria 2744
389 Ga0496110_1363213 3300048913 Bacteria 619
390 Ga0496111_0559539 3300048914 Bacteria 839
391 Ga0496112_0974775 3300048915 Bacteria 768
392 Ga0496115_0558816 3300048918 Bacteria 914
393 Ga0501034_0586400 3300049571 Bacteria 1021
394 Ga0501036_0592403 3300049572 Bacteria 920
395 Ga0501047_0175999 3300049581 Bacteria 2007
396 Ga0501233_240856 3300049668 Bacteria 541
397 Ga0501221_042572 3300049704 Bacteria 996
398 Ga0501229_035197 3300049706 Unclassified 699
399 nmdc:mga0n895_229983_c1 3300050512 Bacteria 1882
400 Ga0500616_0000007 3300053153 Bacteria 836875

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005843 Ga0068860_102618980 Ga0068860_1026189801 92
2 3300005563 Ga0068855_100113331 Ga0068855_1001133312 93
3 3300009093 Ga0105240_10302390 Ga0105240_103023903 93
4 3300025913 Ga0207695_10302102 Ga0207695_103021021 93
5 iso_pu_bacteria 2852623160 2852625329 96
6 iso_pu_bacteria 2884933994 2884934342 96
7 3300005840 Ga0068870_11105327 Ga0068870_111053271 98
8 3300002741 JGI25157J39369_1016032 JGI25157J39369_10160322 100
9 3300003322 rootL2_10206646 rootL2_102066462 100
10 3300005290 Ga0065712_10044988 Ga0065712_100449881 100
11 3300005293 Ga0065715_10356388 Ga0065715_103563882 100
12 3300005327 Ga0070658_10303113 Ga0070658_103031131 100
13 3300005327 Ga0070658_10361417 Ga0070658_103614172 100
14 3300005327 Ga0070658_11892404 Ga0070658_118924041 100
15 3300005328 Ga0070676_10209048 Ga0070676_102090482 100
16 3300005328 Ga0070676_10404679 Ga0070676_104046791 100
17 3300005330 Ga0070690_100078241 Ga0070690_1000782413 100
18 3300005331 Ga0070670_100043854 Ga0070670_1000438544 100
19 3300005331 Ga0070670_100437860 Ga0070670_1004378602 100
20 3300005331 Ga0070670_100931274 Ga0070670_1009312742 100
21 3300005333 Ga0070677_10234501 Ga0070677_102345012 100
22 3300005334 Ga0068869_100209194 Ga0068869_1002091943 100
23 3300005334 Ga0068869_100218321 Ga0068869_1002183212 100
24 3300005334 Ga0068869_100342239 Ga0068869_1003422393 100
25 3300005334 Ga0068869_100507494 Ga0068869_1005074941 100
26 3300005335 Ga0070666_10000041 Ga0070666_1000004135 100
27 3300005335 Ga0070666_10126316 Ga0070666_101263162 100
28 3300005336 Ga0070680_101840435 Ga0070680_1018404351 100
29 3300005338 Ga0068868_100062479 Ga0068868_1000624794 100
30 3300005338 Ga0068868_100855396 Ga0068868_1008553962 100
31 3300005338 Ga0068868_101282323 Ga0068868_1012823231 100
32 3300005339 Ga0070660_100120402 Ga0070660_1001204022 100
33 3300005340 Ga0070689_100002582 Ga0070689_1000025823 100
34 3300005340 Ga0070689_101827782 Ga0070689_1018277821 100
35 3300005347 Ga0070668_100155041 Ga0070668_1001550412 100
36 3300005347 Ga0070668_100440203 Ga0070668_1004402031 100
37 3300005347 Ga0070668_100859526 Ga0070668_1008595262 100
38 3300005347 Ga0070668_100872037 Ga0070668_1008720372 100
39 3300005354 Ga0070675_100048258 Ga0070675_1000482584 100
40 3300005354 Ga0070675_100292260 Ga0070675_1002922602 100
41 3300005354 Ga0070675_100706597 Ga0070675_1007065972 100
42 3300005355 Ga0070671_100036010 Ga0070671_1000360104 100
43 3300005355 Ga0070671_100171667 Ga0070671_1001716672 100
44 3300005355 Ga0070671_100457152 Ga0070671_1004571522 100
45 3300005356 Ga0070674_100186240 Ga0070674_1001862402 100
46 3300005356 Ga0070674_100699852 Ga0070674_1006998522 100
47 3300005364 Ga0070673_100454798 Ga0070673_1004547982 100
48 3300005364 Ga0070673_100672883 Ga0070673_1006728831 100
49 3300005364 Ga0070673_101985946 Ga0070673_1019859461 100
50 3300005365 Ga0070688_100132653 Ga0070688_1001326532 100
51 3300005365 Ga0070688_100143219 Ga0070688_1001432192 100
52 3300005366 Ga0070659_100693394 Ga0070659_1006933941 100
53 3300005367 Ga0070667_100031683 Ga0070667_1000316836 100
54 3300005367 Ga0070667_100104404 Ga0070667_1001044041 100
55 3300005367 Ga0070667_100179380 Ga0070667_1001793803 100
56 3300005367 Ga0070667_100435607 Ga0070667_1004356071 100
57 3300005367 Ga0070667_100567116 Ga0070667_1005671162 100
58 3300005436 Ga0070713_102171355 Ga0070713_1021713552 100
59 3300005439 Ga0070711_100577974 Ga0070711_1005779741 100
60 3300005456 Ga0070678_100411347 Ga0070678_1004113472 100
61 3300005457 Ga0070662_100367145 Ga0070662_1003671451 100
62 3300005457 Ga0070662_100527419 Ga0070662_1005274192 100
63 3300005458 Ga0070681_10292874 Ga0070681_102928742 100
64 3300005458 Ga0070681_10647783 Ga0070681_106477831 100
65 3300005458 Ga0070681_11931576 Ga0070681_119315761 100
66 3300005459 Ga0068867_100083727 Ga0068867_1000837272 100
67 3300005459 Ga0068867_100105779 Ga0068867_1001057793 100
68 3300005459 Ga0068867_100665147 Ga0068867_1006651472 100
69 3300005459 Ga0068867_101405368 Ga0068867_1014053682 100
70 3300005466 Ga0070685_10992947 Ga0070685_109929471 100
71 3300005530 Ga0070679_100123240 Ga0070679_1001232401 100
72 3300005530 Ga0070679_100697282 Ga0070679_1006972822 100
73 3300005530 Ga0070679_100776103 Ga0070679_1007761031 100
74 3300005530 Ga0070679_100981707 Ga0070679_1009817072 100
75 3300005530 Ga0070679_101484942 Ga0070679_1014849421 100
76 3300005535 Ga0070684_100446929 Ga0070684_1004469291 100
77 3300005535 Ga0070684_100546608 Ga0070684_1005466082 100
78 3300005535 Ga0070684_101248238 Ga0070684_1012482381 100
79 3300005539 Ga0068853_100043769 Ga0068853_1000437695 100
80 3300005543 Ga0070672_100226070 Ga0070672_1002260703 100
81 3300005543 Ga0070672_100253117 Ga0070672_1002531172 100
82 3300005543 Ga0070672_101095102 Ga0070672_1010951021 100
83 3300005543 Ga0070672_102070887 Ga0070672_1020708871 100
84 3300005547 Ga0070693_100469085 Ga0070693_1004690851 100
85 3300005548 Ga0070665_100106699 Ga0070665_1001066992 100
86 3300005548 Ga0070665_101092664 Ga0070665_1010926642 100
87 3300005563 Ga0068855_100332593 Ga0068855_1003325933 100
88 3300005563 Ga0068855_100382834 Ga0068855_1003828343 100
89 3300005563 Ga0068855_100635425 Ga0068855_1006354252 100
90 3300005564 Ga0070664_100400702 Ga0070664_1004007022 100
91 3300005564 Ga0070664_101324427 Ga0070664_1013244272 100
92 3300005564 Ga0070664_101595516 Ga0070664_1015955162 100
93 3300005577 Ga0068857_100118040 Ga0068857_1001180404 100
94 3300005577 Ga0068857_100838469 Ga0068857_1008384692 100
95 3300005614 Ga0068856_100017480 Ga0068856_1000174805 100
96 3300005614 Ga0068856_100817318 Ga0068856_1008173181 100
97 3300005614 Ga0068856_101426770 Ga0068856_1014267702 100
98 3300005616 Ga0068852_100055301 Ga0068852_1000553013 100
99 3300005616 Ga0068852_100131197 Ga0068852_1001311973 100
100 3300005616 Ga0068852_101288220 Ga0068852_1012882202 100
101 3300005616 Ga0068852_102832741 Ga0068852_1028327411 100
102 3300005617 Ga0068859_100000083 Ga0068859_10000008335 100
103 3300005617 Ga0068859_100001069 Ga0068859_10000106917 100
104 3300005617 Ga0068859_100072147 Ga0068859_1000721472 100
105 3300005617 Ga0068859_100276986 Ga0068859_1002769862 100
106 3300005617 Ga0068859_100298723 Ga0068859_1002987232 100
107 3300005617 Ga0068859_100869292 Ga0068859_1008692922 100
108 3300005618 Ga0068864_100089637 Ga0068864_1000896374 100
109 3300005618 Ga0068864_100208555 Ga0068864_1002085552 100
110 3300005618 Ga0068864_101417238 Ga0068864_1014172381 100
111 3300005719 Ga0068861_102669755 Ga0068861_1026697551 100
112 3300005834 Ga0068851_10034061 Ga0068851_100340612 100
113 3300005841 Ga0068863_100002508 Ga0068863_1000025085 100
114 3300005841 Ga0068863_100095723 Ga0068863_1000957235 100
115 3300005841 Ga0068863_100460316 Ga0068863_1004603162 100
116 3300005842 Ga0068858_100017208 Ga0068858_1000172089 100
117 3300005842 Ga0068858_100019688 Ga0068858_1000196882 100
118 3300005842 Ga0068858_100636847 Ga0068858_1006368472 100
119 3300005842 Ga0068858_101386485 Ga0068858_1013864852 100
120 3300005843 Ga0068860_100000827 Ga0068860_1000008274 100
121 3300005843 Ga0068860_100002451 Ga0068860_1000024516 100
122 3300005843 Ga0068860_100372596 Ga0068860_1003725962 100
123 3300005843 Ga0068860_101370730 Ga0068860_1013707302 100
124 3300006163 Ga0070715_10291058 Ga0070715_102910582 100
125 3300006237 Ga0097621_100001392 Ga0097621_10000139215 100
126 3300006237 Ga0097621_100094136 Ga0097621_1000941364 100
127 3300006237 Ga0097621_100636880 Ga0097621_1006368802 100
128 3300006237 Ga0097621_100644449 Ga0097621_1006444492 100
129 3300006358 Ga0068871_100006722 Ga0068871_10000672210 100
130 3300006358 Ga0068871_100008886 Ga0068871_1000088867 100
131 3300006358 Ga0068871_100373197 Ga0068871_1003731973 100
132 3300006358 Ga0068871_100514929 Ga0068871_1005149292 100
133 3300006871 Ga0075434_100332758 Ga0075434_1003327582 100
134 3300006881 Ga0068865_100042712 Ga0068865_1000427121 100
135 3300006881 Ga0068865_100479085 Ga0068865_1004790852 100
136 3300006931 Ga0097620_100000083 Ga0097620_10000008335 100
137 3300006931 Ga0097620_100001069 Ga0097620_10000106913 100
138 3300006931 Ga0097620_100072146 Ga0097620_1000721462 100
139 3300006931 Ga0097620_100277014 Ga0097620_1002770142 100
140 3300006931 Ga0097620_100298740 Ga0097620_1002987402 100
141 3300006931 Ga0097620_100869260 Ga0097620_1008692602 100
142 3300009011 Ga0105251_10087581 Ga0105251_100875812 100
143 3300009093 Ga0105240_10325776 Ga0105240_103257762 100
144 3300009094 Ga0111539_12585481 Ga0111539_125854811 100
145 3300009098 Ga0105245_10159145 Ga0105245_101591452 100
146 3300009101 Ga0105247_10009535 Ga0105247_100095355 100
147 3300009101 Ga0105247_10694521 Ga0105247_106945212 100
148 3300009101 Ga0105247_10732115 Ga0105247_107321151 100
149 3300009148 Ga0105243_12198963 Ga0105243_121989631 100
150 3300009174 Ga0105241_10006143 Ga0105241_100061432 100
151 3300009174 Ga0105241_10471256 Ga0105241_104712561 100
152 3300009176 Ga0105242_10081442 Ga0105242_100814422 100
153 3300009176 Ga0105242_10354222 Ga0105242_103542223 100
154 3300009176 Ga0105242_11982210 Ga0105242_119822102 100
155 3300009177 Ga0105248_10086808 Ga0105248_100868085 100
156 3300009177 Ga0105248_10487910 Ga0105248_104879101 100
157 3300009545 Ga0105237_10009157 Ga0105237_1000915713 100
158 3300009545 Ga0105237_10011122 Ga0105237_100111224 100
159 3300009545 Ga0105237_10320345 Ga0105237_103203451 100
160 3300009545 Ga0105237_10415155 Ga0105237_104151552 100
161 3300009545 Ga0105237_10467211 Ga0105237_104672112 100
162 3300009551 Ga0105238_10053158 Ga0105238_100531584 100
163 3300009553 Ga0105249_10117982 Ga0105249_101179822 100
164 3300009553 Ga0105249_12274071 Ga0105249_122740712 100
165 3300010375 Ga0105239_10000010 Ga0105239_1000001080 100
166 3300010375 Ga0105239_10049235 Ga0105239_100492355 100
167 3300010375 Ga0105239_10232247 Ga0105239_102322473 100
168 3300011119 Ga0105246_10002179 Ga0105246_100021795 100
169 3300011119 Ga0105246_10387799 Ga0105246_103877992 100
170 3300011119 Ga0105246_12047040 Ga0105246_120470402 100
171 3300013100 Ga0157373_10419367 Ga0157373_104193672 100
172 3300013100 Ga0157373_10784676 Ga0157373_107846762 100
173 3300013100 Ga0157373_11273663 Ga0157373_112736632 100
174 3300013100 Ga0157373_11476015 Ga0157373_114760151 100
175 3300013102 Ga0157371_10148785 Ga0157371_101487852 100
176 3300013102 Ga0157371_10453549 Ga0157371_104535491 100
177 3300013102 Ga0157371_10466211 Ga0157371_104662111 100
178 3300013102 Ga0157371_10947452 Ga0157371_109474521 100
179 3300013102 Ga0157371_10981312 Ga0157371_109813121 100
180 3300013102 Ga0157371_11369367 Ga0157371_113693671 100
181 3300013102 Ga0157371_11491788 Ga0157371_114917881 100
182 3300013102 Ga0157371_11529070 Ga0157371_115290701 100
183 3300013104 Ga0157370_10001951 Ga0157370_1000195121 100
184 3300013104 Ga0157370_10739867 Ga0157370_107398672 100
185 3300013105 Ga0157369_10211342 Ga0157369_102113422 100
186 3300013105 Ga0157369_10523299 Ga0157369_105232991 100
187 3300013105 Ga0157369_10722772 Ga0157369_107227722 100
188 3300013296 Ga0157374_12372640 Ga0157374_123726402 100
189 3300013296 Ga0157374_12395242 Ga0157374_123952422 100
190 3300013297 Ga0157378_10009049 Ga0157378_100090497 100
191 3300013297 Ga0157378_10017523 Ga0157378_100175234 100
192 3300013297 Ga0157378_10130941 Ga0157378_101309414 100
193 3300013306 Ga0163162_10053973 Ga0163162_100539735 100
194 3300013306 Ga0163162_10147820 Ga0163162_101478202 100
195 3300013306 Ga0163162_10155790 Ga0163162_101557904 100
196 3300013306 Ga0163162_10285247 Ga0163162_102852472 100
197 3300013306 Ga0163162_10324093 Ga0163162_103240932 100
198 3300013306 Ga0163162_10463910 Ga0163162_104639103 100
199 3300013306 Ga0163162_10529673 Ga0163162_105296731 100
200 3300013306 Ga0163162_10546039 Ga0163162_105460391 100
201 3300013306 Ga0163162_10638162 Ga0163162_106381622 100
202 3300013306 Ga0163162_10953712 Ga0163162_109537122 100
203 3300013306 Ga0163162_11921862 Ga0163162_119218621 100
204 3300013306 Ga0163162_12052786 Ga0163162_120527861 100
205 3300013307 Ga0157372_10675175 Ga0157372_106751752 100
206 3300013307 Ga0157372_10687250 Ga0157372_106872502 100
207 3300013307 Ga0157372_11440649 Ga0157372_114406492 100
208 3300013307 Ga0157372_11953266 Ga0157372_119532661 100
209 3300013307 Ga0157372_12492688 Ga0157372_124926882 100
210 3300013307 Ga0157372_12690748 Ga0157372_126907481 100
211 3300013307 Ga0157372_13202973 Ga0157372_132029731 100
212 3300013308 Ga0157375_10000870 Ga0157375_1000087027 100
213 3300013308 Ga0157375_10097261 Ga0157375_100972613 100
214 3300013308 Ga0157375_10130418 Ga0157375_101304183 100
215 3300013308 Ga0157375_10521543 Ga0157375_105215432 100
216 3300013308 Ga0157375_10665779 Ga0157375_106657792 100
217 3300013308 Ga0157375_10940928 Ga0157375_109409281 100
218 3300013308 Ga0157375_10990833 Ga0157375_109908331 100
219 3300013308 Ga0157375_11052151 Ga0157375_110521511 100
220 3300013308 Ga0157375_11267758 Ga0157375_112677582 100
221 3300013308 Ga0157375_11270790 Ga0157375_112707902 100
222 3300014325 Ga0163163_10001885 Ga0163163_1000188513 100
223 3300014325 Ga0163163_10053680 Ga0163163_100536802 100
224 3300014325 Ga0163163_10390212 Ga0163163_103902122 100
225 3300014325 Ga0163163_10656445 Ga0163163_106564452 100
226 3300014325 Ga0163163_12858805 Ga0163163_128588052 100
227 3300014325 Ga0163163_12921857 Ga0163163_129218571 100
228 3300014326 Ga0157380_10270572 Ga0157380_102705722 100
229 3300014968 Ga0157379_10035924 Ga0157379_100359242 100
230 3300014968 Ga0157379_10207345 Ga0157379_102073452 100
231 3300014968 Ga0157379_10490929 Ga0157379_104909291 100
232 3300014968 Ga0157379_11123644 Ga0157379_111236441 100
233 3300014969 Ga0157376_10001836 Ga0157376_100018368 100
234 3300014969 Ga0157376_10143098 Ga0157376_101430982 100
235 3300014969 Ga0157376_10149499 Ga0157376_101494993 100
236 3300014969 Ga0157376_10430240 Ga0157376_104302403 100
237 3300017792 Ga0163161_10006687 Ga0163161_100066875 100
238 3300017792 Ga0163161_10362078 Ga0163161_103620782 100
239 3300017792 Ga0163161_11290675 Ga0163161_112906751 100
240 3300017792 Ga0163161_11545529 Ga0163161_115455291 100
241 3300025250 Ga0209026_1000388 Ga0209026_100038823 100
242 3300025298 Ga0209050_1008683 Ga0209050_10086839 100
243 3300025321 Ga0207656_10148995 Ga0207656_101489951 100
244 3300025893 Ga0207682_10031503 Ga0207682_100315032 100
245 3300025893 Ga0207682_10281085 Ga0207682_102810852 100
246 3300025900 Ga0207710_10060049 Ga0207710_100600493 100
247 3300025903 Ga0207680_10000077 Ga0207680_1000007722 100
248 3300025904 Ga0207647_10242674 Ga0207647_102426742 100
249 3300025904 Ga0207647_10686044 Ga0207647_106860441 100
250 3300025905 Ga0207685_10492335 Ga0207685_104923351 100
251 3300025907 Ga0207645_10558804 Ga0207645_105588041 100
252 3300025907 Ga0207645_11226754 Ga0207645_112267541 100
253 3300025909 Ga0207705_10902397 Ga0207705_109023972 100
254 3300025911 Ga0207654_10004997 Ga0207654_100049979 100
255 3300025911 Ga0207654_10817058 Ga0207654_108170581 100
256 3300025912 Ga0207707_10542112 Ga0207707_105421121 100
257 3300025912 Ga0207707_10592193 Ga0207707_105921931 100
258 3300025913 Ga0207695_10306803 Ga0207695_103068032 100
259 3300025913 Ga0207695_10447138 Ga0207695_104471382 100
260 3300025914 Ga0207671_10001576 Ga0207671_1000157627 100
261 3300025914 Ga0207671_10006719 Ga0207671_100067198 100
262 3300025914 Ga0207671_10222721 Ga0207671_102227213 100
263 3300025914 Ga0207671_11007015 Ga0207671_110070151 100
264 3300025916 Ga0207663_10849647 Ga0207663_108496472 100
265 3300025919 Ga0207657_10027597 Ga0207657_100275972 100
266 3300025921 Ga0207652_10091936 Ga0207652_100919364 100
267 3300025921 Ga0207652_10810156 Ga0207652_108101562 100
268 3300025924 Ga0207694_10122179 Ga0207694_101221792 100
269 3300025925 Ga0207650_10178367 Ga0207650_101783672 100
270 3300025925 Ga0207650_10499065 Ga0207650_104990652 100
271 3300025925 Ga0207650_10662176 Ga0207650_106621762 100
272 3300025925 Ga0207650_10873224 Ga0207650_108732242 100
273 3300025925 Ga0207650_11133579 Ga0207650_111335791 100
274 3300025926 Ga0207659_10162372 Ga0207659_101623722 100
275 3300025926 Ga0207659_11776777 Ga0207659_117767772 100
276 3300025928 Ga0207700_10406333 Ga0207700_104063331 100
277 3300025931 Ga0207644_10026047 Ga0207644_100260473 100
278 3300025931 Ga0207644_10088701 Ga0207644_100887012 100
279 3300025931 Ga0207644_10419340 Ga0207644_104193402 100
280 3300025933 Ga0207706_10499044 Ga0207706_104990442 100
281 3300025933 Ga0207706_10736687 Ga0207706_107366871 100
282 3300025934 Ga0207686_10290186 Ga0207686_102901863 100
283 3300025935 Ga0207709_10122292 Ga0207709_101222924 100
284 3300025936 Ga0207670_10251639 Ga0207670_102516392 100
285 3300025936 Ga0207670_10645676 Ga0207670_106456761 100
286 3300025937 Ga0207669_10174710 Ga0207669_101747102 100
287 3300025937 Ga0207669_10412985 Ga0207669_104129852 100
288 3300025938 Ga0207704_11280913 Ga0207704_112809131 100
289 3300025938 Ga0207704_11469939 Ga0207704_114699391 100
290 3300025940 Ga0207691_10011633 Ga0207691_100116338 100
291 3300025940 Ga0207691_10326710 Ga0207691_103267102 100
292 3300025940 Ga0207691_11447554 Ga0207691_114475542 100
293 3300025941 Ga0207711_10475029 Ga0207711_104750292 100
294 3300025942 Ga0207689_10002044 Ga0207689_1000204417 100
295 3300025942 Ga0207689_10020626 Ga0207689_100206264 100
296 3300025942 Ga0207689_11529007 Ga0207689_115290072 100
297 3300025944 Ga0207661_10068778 Ga0207661_100687782 100
298 3300025945 Ga0207679_10300110 Ga0207679_103001102 100
299 3300025945 Ga0207679_12109026 Ga0207679_121090261 100
300 3300025949 Ga0207667_10232385 Ga0207667_102323853 100
301 3300025949 Ga0207667_10539587 Ga0207667_105395871 100
302 3300025960 Ga0207651_10046382 Ga0207651_100463823 100
303 3300025960 Ga0207651_10584530 Ga0207651_105845302 100
304 3300025960 Ga0207651_11098943 Ga0207651_110989431 100
305 3300025960 Ga0207651_11288650 Ga0207651_112886502 100
306 3300025961 Ga0207712_10256438 Ga0207712_102564382 100
307 3300025961 Ga0207712_11435057 Ga0207712_114350572 100
308 3300025961 Ga0207712_11668127 Ga0207712_116681272 100
309 3300025972 Ga0207668_10088528 Ga0207668_100885283 100
310 3300025972 Ga0207668_10337863 Ga0207668_103378632 100
311 3300025972 Ga0207668_10348360 Ga0207668_103483601 100
312 3300025981 Ga0207640_10946912 Ga0207640_109469122 100
313 3300025981 Ga0207640_12194056 Ga0207640_121940561 100
314 3300025986 Ga0207658_10017506 Ga0207658_100175063 100
315 3300025986 Ga0207658_10204625 Ga0207658_102046252 100
316 3300025986 Ga0207658_10322081 Ga0207658_103220812 100
317 3300025986 Ga0207658_10501661 Ga0207658_105016611 100
318 3300025986 Ga0207658_11171128 Ga0207658_111711282 100
319 3300026023 Ga0207677_10047403 Ga0207677_100474032 100
320 3300026023 Ga0207677_10095901 Ga0207677_100959013 100
321 3300026035 Ga0207703_10003481 Ga0207703_100034813 100
322 3300026035 Ga0207703_11044598 Ga0207703_110445981 100
323 3300026041 Ga0207639_10687483 Ga0207639_106874832 100
324 3300026078 Ga0207702_10010674 Ga0207702_100106746 100
325 3300026078 Ga0207702_10048897 Ga0207702_100488974 100
326 3300026088 Ga0207641_10000975 Ga0207641_100009753 100
327 3300026088 Ga0207641_10080009 Ga0207641_100800092 100
328 3300026089 Ga0207648_10072849 Ga0207648_100728494 100
329 3300026089 Ga0207648_10084057 Ga0207648_100840573 100
330 3300026089 Ga0207648_10178685 Ga0207648_101786851 100
331 3300026089 Ga0207648_10221581 Ga0207648_102215812 100
332 3300026089 Ga0207648_10398268 Ga0207648_103982683 100
333 3300026095 Ga0207676_10120405 Ga0207676_101204052 100
334 3300026095 Ga0207676_10188837 Ga0207676_101888372 100
335 3300026116 Ga0207674_10073693 Ga0207674_100736932 100
336 3300026116 Ga0207674_10230816 Ga0207674_102308163 100
337 3300026118 Ga0207675_100006202 Ga0207675_1000062022 100
338 3300026118 Ga0207675_101674116 Ga0207675_1016741162 100
339 3300026121 Ga0207683_10081979 Ga0207683_100819792 100
340 3300026121 Ga0207683_10134848 Ga0207683_101348483 100
341 3300026142 Ga0207698_10057947 Ga0207698_100579471 100
342 3300028381 Ga0268264_10010764 Ga0268264_100107645 100
343 3300028381 Ga0268264_10026441 Ga0268264_100264414 100
344 3300028381 Ga0268264_10339494 Ga0268264_103394942 100
345 3300031251 Ga0265327_10000506 Ga0265327_1000050640 100
346 3300031344 Ga0265316_10798027 Ga0265316_107980271 100
347 3300031456 Ga0307513_11076257 Ga0307513_110762571 100
348 3300031649 Ga0307514_10127832 Ga0307514_101278322 100
349 3300031730 Ga0307516_10001621 Ga0307516_1000162128 100
350 3300031824 Ga0307413_11067261 Ga0307413_110672611 100
351 3300031911 Ga0307412_10855358 Ga0307412_108553582 100
352 3300032004 Ga0307414_10082260 Ga0307414_100822602 100
353 3300032004 Ga0307414_10136291 Ga0307414_101362914 100
354 3300032004 Ga0307414_10168093 Ga0307414_101680932 100
355 3300032004 Ga0307414_10562289 Ga0307414_105622892 100
356 3300032004 Ga0307414_10614200 Ga0307414_106142002 100
357 3300032004 Ga0307414_10948464 Ga0307414_109484642 100
358 3300036401 Ga0373937_0562529 Ga0373937_0562529_715_1017 100
359 3300037312 Ga0395899_0025534 Ga0395899_0025534_3821_4123 100
360 3300037418 Ga0395900_0174676 Ga0395900_0174676_337_639 100
361 3300037418 Ga0395900_0251982 Ga0395900_0251982_1129_1431 100
362 3300037466 Ga0395898_0176737 Ga0395898_0176737_970_1272 100
363 3300037466 Ga0395898_0330125 Ga0395898_0330125_95_397 100
364 3300037466 Ga0395898_0724086 Ga0395898_0724086_327_629 100
365 3300037471 Ga0395905_0103714 Ga0395905_0103714_2334_2636 100
366 3300037471 Ga0395905_0130133 Ga0395905_0130133_1690_1992 100
367 3300037471 Ga0395905_0318252 Ga0395905_0318252_926_1228 100
368 3300038443 Ga0395901_0077620 Ga0395901_0077620_308_610 100
369 3300038443 Ga0395901_0268886 Ga0395901_0268886_594_896 100
370 3300038443 Ga0395901_0367489 Ga0395901_0367489_1086_1388 100
371 3300041458 Ga0451798_0298876 Ga0451798_0298876_42_344 100
372 3300041463 Ga0451804_0405734 Ga0451804_0405734_258_563 100
373 3300041494 Ga0451837_0070755 Ga0451837_0070755_1026_1328 100
374 3300042876 Ga0451577_0044232 Ga0451577_0044232_1050_1358 100
375 3300042876 Ga0451577_1588547 Ga0451577_1588547_38_340 100
376 3300044673 Ga0453683_0803560 Ga0453683_0803560_160_462 100
377 3300044712 Ga0453684_0003193 Ga0453684_0003193_23604_23912 100
378 3300044712 Ga0453684_0170461 Ga0453684_0170461_1291_1593 100
379 3300044712 Ga0453684_0920193 Ga0453684_0920193_399_701 100
380 3300045051 Ga0451576_0001733 Ga0451576_0001733_12410_12718 100
381 3300046472 Ga0495580_0102863 Ga0495580_0102863_1060_1362 100
382 3300046473 Ga0495582_0510575 Ga0495582_0510575_373_675 100
383 3300046615 Ga0495656_0199155 Ga0495656_0199155_647_949 100
384 3300046675 Ga0495657_0848456 Ga0495657_0848456_148_450 100
385 3300047315 Ga0495581_0214005 Ga0495581_0214005_23_325 100
386 3300047318 Ga0495636_0000077 Ga0495636_0000077_1398_1700 100
387 3300047320 Ga0495672_0006059 Ga0495672_0006059_3549_3851 100
388 3300048904 Ga0496101_0185094 Ga0496101_0185094_279_581 100
389 3300048912 Ga0496109_1610856 Ga0496109_1610856_142_444 100
390 3300048913 Ga0496110_0089987 Ga0496110_0089987_1758_2060 100
391 3300048913 Ga0496110_1363213 Ga0496110_1363213_297_599 100
392 3300048914 Ga0496111_0559539 Ga0496111_0559539_130_432 100
393 3300048915 Ga0496112_0974775 Ga0496112_0974775_132_434 100
394 3300048918 Ga0496115_0558816 Ga0496115_0558816_541_843 100
395 3300049571 Ga0501034_0586400 Ga0501034_0586400_480_782 100
396 3300049572 Ga0501036_0592403 Ga0501036_0592403_393_695 100
397 3300049581 Ga0501047_0175999 Ga0501047_0175999_976_1278 100
398 3300049668 Ga0501233_240856 Ga0501233_240856_83_385 100
399 3300049704 Ga0501221_042572 Ga0501221_042572_561_863 100
400 3300049706 Ga0501229_035197 Ga0501229_035197_294_599 100
401 3300050512 nmdc:mga0n895_229983_c1 nmdc:mga0n895_229983_c1_851_1153 100
402 3300053153 Ga0500616_0000007 Ga0500616_0000007_110034_110336 100

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dca-assembly2.cif.gz_D crystal structure of the rpa0582- protein of unknown function from rhodopseudomonas palustris- a structural genomics target 0.7955 2 100
3hhl-assembly2.cif.gz_C crystal structure of methylated rpa0582 protein 0.788 2 100
3dca-assembly2.cif.gz_D crystal structure of the rpa0582- protein of unknown function from rhodopseudomonas palustris- a structural genomics target 0.7812 2 100
2gff-assembly1.cif.gz_A crystal structure of yersinia pestis lsrg 0.7808 1 100
1x7v-assembly3.cif.gz_C crystal structure of pa3566 from pseudomonas aeruginosa 0.7807 2 100
ID Description Score Start End Superfamily
af_P34492_299_417_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7918 2 98 3.30.70.100
3bm7A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7835 2 100 3.30.70.100
af_O75323_65_182_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7819 2 100 3.30.70.100
af_F6NVH9_176_279_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7795 2 100 3.30.70.100
5ixuA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7779 1 100 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A4R8DV95-F1-model_v4 Uncharacterized protein DUF1330 0.9274 1 100
AF-A0A4R8DV95-F1-model_v4 Uncharacterized protein DUF1330 0.9182 1 100
AF-A0A4S8HT29-F1-model_v4 DUF1330 domain-containing protein 0.9123 1 100
AF-A0A838YZT8-F1-model_v4 DUF1330 domain-containing protein 0.9113 1 100
AF-A0A6M5Y244-F1-model_v4 DUF1330 domain-containing protein 0.911 1 98

Feature Viewer

pLDDT pTM Quality
92.87 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map