F435047

General Info

Members Datasets Scaffolds Average Seq Length
402 218 402 145

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100107725|Ga0068855_1001077252
Length 179
Sequence MPLCVAAPDTFRKETWRKMTIKRMDNMGIVVGSLDAPVAFFTELGMRLEGRAMIEGEWAGRITGLTNQRVQIAMMVTPDGHSRLELSRFLAPPVVADHRDAPVNALGYLRVMFAVENLDDTLARLQRHGAQLVGDVVQYEQSYRLCYIRGPEGILIGLAEELERGKPEQEPSRQSNPKG

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
106 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
107 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
108 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
109 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
177 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
178 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
179 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
180 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
181 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
182 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
183 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
184 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
185 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
197 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
198 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
204 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
205 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
206 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
207 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
208 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
209 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
210 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
211 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
212 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
213 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
214 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
215 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
216 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
217 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
218 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.48
Nodule 0
Rhizoplane 1.74
Rhizosphere 92.04
Stem 0
Stem Tuber 0
Unclassified 1.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1058919 3300001977 Bacteria 548
2 JGI24737J22298_10055486 3300001990 Bacteria 1198
3 JGI25152J39213_1000390 3300002773 Bacteria 26761
4 JGI25150J39212_1000462 3300002774 Bacteria 17813
5 JGI25406J46586_10059547 3300003203 Bacteria 1239
6 JGI25153J46596_10006240 3300003215 Bacteria 6098
7 Ga0055524_1000848 3300003775 Bacteria 20050
8 Ga0065704_10167983 3300005289 Bacteria 1309
9 Ga0065712_10403857 3300005290 Unclassified 718
10 Ga0065715_10109276 3300005293 Bacteria 2675
11 Ga0065715_10186648 3300005293 Bacteria 1435
12 Ga0065707_10141738 3300005295 Bacteria 1758
13 Ga0070658_10187177 3300005327 Bacteria 1744
14 Ga0070658_10276959 3300005327 Bacteria 1427
15 Ga0070658_10331917 3300005327 Bacteria 1300
16 Ga0070676_10001630 3300005328 Bacteria 11408
17 Ga0070676_10009156 3300005328 Bacteria 5357
18 Ga0070683_100026224 3300005329 Bacteria 5244
19 Ga0070683_100117443 3300005329 Bacteria 2512
20 Ga0070683_100134836 3300005329 Bacteria 2338
21 Ga0070683_100146292 3300005329 Bacteria 2239
22 Ga0070683_100438845 3300005329 Bacteria 1246
23 Ga0070683_100466333 3300005329 Bacteria 1206
24 Ga0070690_100535480 3300005330 Bacteria 881
25 Ga0070670_100059193 3300005331 Bacteria 3288
26 Ga0070670_100115776 3300005331 Bacteria 2311
27 Ga0070670_100261590 3300005331 Bacteria 1508
28 Ga0070670_100580836 3300005331 Bacteria 1001
29 Ga0070677_10014519 3300005333 Bacteria 2774
30 Ga0068869_100034705 3300005334 Bacteria 3570
31 Ga0068869_100197715 3300005334 Bacteria 1584
32 Ga0070680_100169042 3300005336 Bacteria 1839
33 Ga0070680_100548178 3300005336 Bacteria 991
34 Ga0068868_100059276 3300005338 Bacteria 3028
35 Ga0068868_101245921 3300005338 Unclassified 689
36 Ga0068868_101409758 3300005338 Bacteria 650
37 Ga0070660_100097723 3300005339 Bacteria 2323
38 Ga0070660_100786621 3300005339 Bacteria 800
39 Ga0070689_100010400 3300005340 Bacteria 6631
40 Ga0070689_100043125 3300005340 Bacteria 3466
41 Ga0070691_10112635 3300005341 Bacteria 1362
42 Ga0070687_100014273 3300005343 Bacteria 3565
43 Ga0070687_100099853 3300005343 Bacteria 1623
44 Ga0070687_100183168 3300005343 Bacteria 1256
45 Ga0070661_100096892 3300005344 Bacteria 2189
46 Ga0070661_100119822 3300005344 Bacteria 1970
47 Ga0070661_100385989 3300005344 Bacteria 1105
48 Ga0070692_10029195 3300005345 Bacteria 2747
49 Ga0070668_100004196 3300005347 Bacteria 10682
50 Ga0070669_100001729 3300005353 Bacteria 15771
51 Ga0070669_100049958 3300005353 Bacteria 3054
52 Ga0070669_100644139 3300005353 Bacteria 891
53 Ga0070675_100015954 3300005354 Bacteria 5951
54 Ga0070675_100085440 3300005354 Bacteria 2636
55 Ga0070671_100205554 3300005355 Bacteria 1670
56 Ga0070671_100356835 3300005355 Bacteria 1248
57 Ga0070674_100816638 3300005356 Bacteria 806
58 Ga0070673_100113888 3300005364 Bacteria 2246
59 Ga0070673_100193588 3300005364 Bacteria 1748
60 Ga0070673_100459341 3300005364 Bacteria 1146
61 Ga0070688_100017620 3300005365 Bacteria 4102
62 Ga0070688_100034106 3300005365 Bacteria 3080
63 Ga0070659_100044340 3300005366 Bacteria 3481
64 Ga0070659_100092226 3300005366 Bacteria 2429
65 Ga0070659_101899666 3300005366 Bacteria 534
66 Ga0070667_100096581 3300005367 Bacteria 2548
67 Ga0070667_100167938 3300005367 Bacteria 1936
68 Ga0070714_101584301 3300005435 Bacteria 640
69 Ga0070701_10074189 3300005438 Bacteria 1827
70 Ga0070700_100035546 3300005441 Bacteria 3016
71 Ga0070694_100239709 3300005444 Bacteria 1367
72 Ga0070708_100308237 3300005445 Bacteria 1491
73 Ga0070708_101160864 3300005445 Bacteria 723
74 Ga0070663_100049458 3300005455 Bacteria 2986
75 Ga0070663_100241899 3300005455 Bacteria 1425
76 Ga0070678_100031593 3300005456 Bacteria 3655
77 Ga0070678_100088568 3300005456 Bacteria 2367
78 Ga0070662_100051514 3300005457 Bacteria 2973
79 Ga0068867_100139383 3300005459 Bacteria 1894
80 Ga0068867_100265195 3300005459 Bacteria 1402
81 Ga0068867_100386043 3300005459 Bacteria 1177
82 Ga0068867_100579488 3300005459 Bacteria 976
83 Ga0070685_10039883 3300005466 Bacteria 2670
84 Ga0070685_10147084 3300005466 Bacteria 1490
85 Ga0070706_101029917 3300005467 Bacteria 759
86 Ga0070699_100259678 3300005518 Bacteria 1553
87 Ga0070679_100553000 3300005530 Bacteria 1095
88 Ga0070684_100133421 3300005535 Bacteria 2241
89 Ga0070684_100253534 3300005535 Bacteria 1608
90 Ga0070684_100274950 3300005535 Bacteria 1542
91 Ga0068853_100336088 3300005539 Bacteria 1403
92 Ga0068853_100693212 3300005539 Bacteria 971
93 Ga0070672_100031491 3300005543 Bacteria 3992
94 Ga0070672_100062112 3300005543 Bacteria 2947
95 Ga0070672_100110155 3300005543 Bacteria 2243
96 Ga0070672_100207584 3300005543 Bacteria 1640
97 Ga0070686_100848642 3300005544 Bacteria 739
98 Ga0070695_100418260 3300005545 Bacteria 1020
99 Ga0070696_100005507 3300005546 Bacteria 8447
100 Ga0070665_101562721 3300005548 Bacteria 668
101 Ga0070704_101302823 3300005549 Bacteria 665
102 Ga0068855_100101513 3300005563 Bacteria 3312
103 Ga0068855_100107725 3300005563 Bacteria 3201
104 Ga0068855_101464518 3300005563 Bacteria 702
105 Ga0070664_100026597 3300005564 Bacteria 4801
106 Ga0070664_100094575 3300005564 Bacteria 2591
107 Ga0070664_100148371 3300005564 Bacteria 2069
108 Ga0070664_100256748 3300005564 Bacteria 1572
109 Ga0070664_100460223 3300005564 Bacteria 1169
110 Ga0070664_101261834 3300005564 Bacteria 697
111 Ga0068857_100056163 3300005577 Bacteria 3494
112 Ga0068857_100220683 3300005577 Bacteria 1732
113 Ga0068857_100236753 3300005577 Bacteria 1671
114 Ga0068854_100023842 3300005578 Bacteria 4182
115 Ga0068854_100472445 3300005578 Bacteria 1051
116 Ga0070702_100591391 3300005615 Bacteria 830
117 Ga0068852_100074534 3300005616 Bacteria 2989
118 Ga0068852_100092675 3300005616 Bacteria 2706
119 Ga0068859_100013571 3300005617 Bacteria 8168
120 Ga0068859_100203763 3300005617 Bacteria 2063
121 Ga0068859_101415928 3300005617 Bacteria 767
122 Ga0068864_100027598 3300005618 Bacteria 4796
123 Ga0068864_100140808 3300005618 Bacteria 2175
124 Ga0068866_10348149 3300005718 Bacteria 940
125 Ga0068861_100037542 3300005719 Bacteria 3601
126 Ga0068851_10451968 3300005834 Bacteria 764
127 Ga0068870_10039058 3300005840 Bacteria 2454
128 Ga0068870_10079611 3300005840 Bacteria 1808
129 Ga0068863_100186693 3300005841 Bacteria 1991
130 Ga0068858_100044266 3300005842 Bacteria 4126
131 Ga0068858_100220968 3300005842 Bacteria 1794
132 Ga0068858_100222634 3300005842 Bacteria 1787
133 Ga0068858_100447563 3300005842 Bacteria 1244
134 Ga0068860_100082260 3300005843 Bacteria 3062
135 Ga0068862_100023049 3300005844 Bacteria 5214
136 Ga0068862_100039161 3300005844 Bacteria 4024
137 Ga0068862_100702132 3300005844 Bacteria 980
138 Ga0081539_10010413 3300005985 Bacteria 7557
139 Ga0075366_10589630 3300006195 Bacteria 689
140 Ga0097621_100870846 3300006237 Bacteria 838
141 Ga0075370_10535312 3300006353 Bacteria 708
142 Ga0075428_100024165 3300006844 Bacteria 6723
143 Ga0068865_100083891 3300006881 Bacteria 2294
144 Ga0068865_100130787 3300006881 Bacteria 1880
145 Ga0097620_100013571 3300006931 Bacteria 8168
146 Ga0097620_100017869 3300006931 Bacteria 7129
147 Ga0097620_100203762 3300006931 Bacteria 2063
148 Ga0097620_101415738 3300006931 Bacteria 767
149 Ga0099794_10246893 3300007265 Bacteria 920
150 Ga0105240_10042629 3300009093 Bacteria 5782
151 Ga0105240_10085793 3300009093 Bacteria 3857
152 Ga0105240_10263279 3300009093 Bacteria 1988
153 Ga0105240_10713763 3300009093 Bacteria 1093
154 Ga0105245_10323061 3300009098 Bacteria 1521
155 Ga0105247_10398092 3300009101 Bacteria 980
156 Ga0105247_11337193 3300009101 Bacteria 577
157 Ga0105243_10412338 3300009148 Bacteria 1258
158 Ga0105241_10392568 3300009174 Bacteria 1215
159 Ga0105242_10038763 3300009176 Bacteria 3833
160 Ga0105237_10207366 3300009545 Bacteria 1960
161 Ga0105238_10032017 3300009551 Bacteria 5352
162 Ga0105239_10000003 3300010375 Bacteria 606801
163 Ga0105239_10746284 3300010375 Bacteria 1120
164 Ga0105246_10443615 3300011119 Bacteria 1089
165 Ga0105246_10863429 3300011119 Bacteria 808
166 Ga0157373_10119182 3300013100 Unclassified 1855
167 Ga0157373_10131611 3300013100 Bacteria 1759
168 Ga0157373_11508422 3300013100 Bacteria 513
169 Ga0157371_10070090 3300013102 Bacteria 2482
170 Ga0157371_10646254 3300013102 Bacteria 789
171 Ga0157374_10248757 3300013296 Bacteria 1749
172 Ga0157374_10449684 3300013296 Bacteria 1289
173 Ga0163162_10057888 3300013306 Bacteria 3903
174 Ga0163162_10209775 3300013306 Bacteria 2077
175 Ga0163162_10300152 3300013306 Bacteria 1738
176 Ga0157372_10117008 3300013307 Bacteria 3057
177 Ga0157372_10187803 3300013307 Bacteria 2393
178 Ga0157372_10349098 3300013307 Bacteria 1723
179 Ga0157375_10054950 3300013308 Bacteria 3924
180 Ga0157375_10074499 3300013308 Bacteria 3416
181 Ga0157375_10699469 3300013308 Bacteria 1167
182 Ga0157375_10862609 3300013308 Bacteria 1051
183 Ga0163163_10027932 3300014325 Bacteria 5411
184 Ga0163163_10291167 3300014325 Bacteria 1685
185 Ga0182008_10084215 3300014497 Unclassified 1566
186 Ga0157377_10015635 3300014745 Bacteria 3889
187 Ga0157377_10136289 3300014745 Bacteria 1504
188 Ga0157379_10363888 3300014968 Bacteria 1326
189 Ga0157376_10903986 3300014969 Bacteria 901
190 Ga0182005_1131841 3300015265 Bacteria 717
191 Ga0163161_10021976 3300017792 Bacteria 4487
192 Ga0163161_10023659 3300017792 Bacteria 4335
193 Ga0163161_10512599 3300017792 Bacteria 978
194 Ga0213876_10008603 3300021384 Bacteria 5524
195 Ga0207425_1000006 3300025245 Bacteria 808854
196 Ga0209129_1000009 3300025258 Bacteria 633100
197 Ga0209233_1004545 3300025261 Bacteria 4702
198 Ga0209758_1001155 3300025297 Bacteria 33795
199 Ga0209256_1000191 3300025299 Bacteria 117653
200 Ga0207697_10002375 3300025315 Bacteria 9803
201 Ga0207697_10055177 3300025315 Bacteria 1647
202 Ga0207682_10135471 3300025893 Bacteria 1102
203 Ga0207642_10348096 3300025899 Bacteria 873
204 Ga0207688_10021421 3300025901 Bacteria 3532
205 Ga0207688_10322231 3300025901 Bacteria 948
206 Ga0207647_10016328 3300025904 Bacteria 5070
207 Ga0207645_10000565 3300025907 Bacteria 30624
208 Ga0207645_10007533 3300025907 Bacteria 7680
209 Ga0207643_10005894 3300025908 Bacteria 6545
210 Ga0207643_10077159 3300025908 Bacteria 1926
211 Ga0207705_10365390 3300025909 Bacteria 1113
212 Ga0207705_10432842 3300025909 Bacteria 1019
213 Ga0207705_10549103 3300025909 Bacteria 898
214 Ga0207654_10211120 3300025911 Bacteria 1283
215 Ga0207707_10140072 3300025912 Bacteria 2115
216 Ga0207695_10011600 3300025913 Bacteria 10656
217 Ga0207695_10059179 3300025913 Bacteria 3975
218 Ga0207695_10126214 3300025913 Bacteria 2520
219 Ga0207695_10881860 3300025913 Bacteria 774
220 Ga0207671_10185268 3300025914 Bacteria 1621
221 Ga0207660_10054791 3300025917 Bacteria 2847
222 Ga0207662_10023006 3300025918 Bacteria 3576
223 Ga0207662_10064167 3300025918 Bacteria 2209
224 Ga0207662_10519017 3300025918 Bacteria 822
225 Ga0207662_11027098 3300025918 Bacteria 586
226 Ga0207657_10020889 3300025919 Bacteria 6180
227 Ga0207657_10024927 3300025919 Bacteria 5526
228 Ga0207657_10418329 3300025919 Bacteria 1053
229 Ga0207649_10022877 3300025920 Bacteria 3612
230 Ga0207649_10033784 3300025920 Bacteria 3059
231 Ga0207649_10176145 3300025920 Bacteria 1494
232 Ga0207649_10415587 3300025920 Bacteria 1009
233 Ga0207649_10974084 3300025920 Bacteria 667
234 Ga0207652_10030123 3300025921 Bacteria 4542
235 Ga0207652_10030690 3300025921 Bacteria 4503
236 Ga0207652_10198636 3300025921 Bacteria 1805
237 Ga0207652_10833455 3300025921 Bacteria 817
238 Ga0207681_10030030 3300025923 Bacteria 3539
239 Ga0207650_10168575 3300025925 Bacteria 1739
240 Ga0207650_10225952 3300025925 Bacteria 1508
241 Ga0207650_10477313 3300025925 Bacteria 1040
242 Ga0207650_10835355 3300025925 Bacteria 781
243 Ga0207659_10025394 3300025926 Bacteria 3980
244 Ga0207659_10548830 3300025926 Bacteria 982
245 Ga0207659_10770141 3300025926 Bacteria 826
246 Ga0207659_11566554 3300025926 Bacteria 563
247 Ga0207687_10213660 3300025927 Bacteria 1515
248 Ga0207687_10845339 3300025927 Bacteria 782
249 Ga0207644_10157560 3300025931 Bacteria 1762
250 Ga0207644_10469080 3300025931 Unclassified 1036
251 Ga0207644_10709033 3300025931 Bacteria 839
252 Ga0207690_10360790 3300025932 Bacteria 1151
253 Ga0207690_10713243 3300025932 Bacteria 825
254 Ga0207706_10001494 3300025933 Bacteria 23235
255 Ga0207670_10117257 3300025936 Bacteria 1929
256 Ga0207670_11374752 3300025936 Bacteria 599
257 Ga0207669_10099398 3300025937 Bacteria 1919
258 Ga0207669_11001300 3300025937 Bacteria 702
259 Ga0207704_10048632 3300025938 Bacteria 2544
260 Ga0207704_10086569 3300025938 Bacteria 2044
261 Ga0207704_11162494 3300025938 Bacteria 657
262 Ga0207691_10002578 3300025940 Bacteria 17719
263 Ga0207691_10026643 3300025940 Bacteria 5423
264 Ga0207691_10131880 3300025940 Bacteria 2206
265 Ga0207691_10155578 3300025940 Bacteria 2008
266 Ga0207711_10062510 3300025941 Bacteria 3211
267 Ga0207689_10009223 3300025942 Bacteria 8533
268 Ga0207689_10700506 3300025942 Bacteria 854
269 Ga0207661_10095008 3300025944 Bacteria 2491
270 Ga0207661_10177367 3300025944 Bacteria 1859
271 Ga0207661_10217728 3300025944 Bacteria 1686
272 Ga0207661_10270736 3300025944 Bacteria 1516
273 Ga0207661_10323113 3300025944 Bacteria 1388
274 Ga0207661_11108026 3300025944 Bacteria 729
275 Ga0207661_11335257 3300025944 Bacteria 658
276 Ga0207679_10099481 3300025945 Bacteria 2271
277 Ga0207679_10586347 3300025945 Bacteria 1003
278 Ga0207679_10692681 3300025945 Bacteria 924
279 Ga0207679_10694766 3300025945 Bacteria 923
280 Ga0207667_10086571 3300025949 Bacteria 3242
281 Ga0207667_10173850 3300025949 Bacteria 2213
282 Ga0207667_10356035 3300025949 Unclassified 1492
283 Ga0207667_10405029 3300025949 Bacteria 1389
284 Ga0207667_11655227 3300025949 Bacteria 608
285 Ga0207651_10088029 3300025960 Bacteria 2262
286 Ga0207651_10091276 3300025960 Bacteria 2230
287 Ga0207651_10214440 3300025960 Bacteria 1552
288 Ga0207651_10230323 3300025960 Bacteria 1504
289 Ga0207651_11194172 3300025960 Unclassified 683
290 Ga0207712_10677002 3300025961 Bacteria 899
291 Ga0207668_10011039 3300025972 Bacteria 5477
292 Ga0207640_10498936 3300025981 Bacteria 1013
293 Ga0207640_11528964 3300025981 Bacteria 600
294 Ga0207658_11152609 3300025986 Bacteria 708
295 Ga0207677_11416858 3300026023 Unclassified 640
296 Ga0207703_10052260 3300026035 Bacteria 3317
297 Ga0207703_10241168 3300026035 Bacteria 1625
298 Ga0207703_10487537 3300026035 Bacteria 1156
299 Ga0207639_10000042 3300026041 Bacteria 141299
300 Ga0207678_10062823 3300026067 Bacteria 3191
301 Ga0207708_10010079 3300026075 Bacteria 7015
302 Ga0207702_11104624 3300026078 Bacteria 787
303 Ga0207641_10056424 3300026088 Bacteria 3338
304 Ga0207648_10172978 3300026089 Bacteria 1909
305 Ga0207648_10180495 3300026089 Bacteria 1868
306 Ga0207648_10298145 3300026089 Bacteria 1445
307 Ga0207648_10408940 3300026089 Bacteria 1230
308 Ga0207648_11447359 3300026089 Bacteria 646
309 Ga0207676_10738312 3300026095 Bacteria 957
310 Ga0207676_10829736 3300026095 Bacteria 903
311 Ga0207676_11634684 3300026095 Unclassified 642
312 Ga0207674_10011844 3300026116 Bacteria 9777
313 Ga0207674_10012411 3300026116 Bacteria 9523
314 Ga0207674_10021363 3300026116 Bacteria 6972
315 Ga0207674_11093450 3300026116 Bacteria 767
316 Ga0207675_100002701 3300026118 Bacteria 17476
317 Ga0207683_10018016 3300026121 Bacteria 6022
318 Ga0207683_10163998 3300026121 Bacteria 2010
319 Ga0207683_11785997 3300026121 Bacteria 564
320 Ga0207698_10056854 3300026142 Bacteria 3022
321 Ga0207698_10532058 3300026142 Bacteria 1149
322 Ga0207698_11306792 3300026142 Bacteria 740
323 Ga0268266_10034654 3300028379 Bacteria 4294
324 Ga0268266_10529439 3300028379 Bacteria 1127
325 Ga0268265_10013996 3300028380 Bacteria 5463
326 Ga0268265_10045557 3300028380 Bacteria 3273
327 Ga0268264_10011052 3300028381 Bacteria 7456
328 Ga0268264_10196753 3300028381 Bacteria 1841
329 Ga0307516_10425952 3300031730 Bacteria 984
330 Ga0307405_10025131 3300031731 Bacteria 3415
331 Ga0307405_10321708 3300031731 Bacteria 1182
332 Ga0307405_11809111 3300031731 Bacteria 543
333 Ga0307410_10488344 3300031852 Bacteria 1011
334 Ga0307409_100649875 3300031995 Bacteria 1048
335 Ga0307411_10188991 3300032005 Bacteria 1571
336 Ga0307415_100136012 3300032126 Bacteria 1869
337 Ga0307510_10653700 3300033180 Bacteria 509
338 Ga0395900_0018574 3300037418 Bacteria 7091
339 Ga0395898_0058157 3300037466 Unclassified 3765
340 Ga0395898_0339698 3300037466 Bacteria 1432
341 Ga0395905_0001772 3300037471 Bacteria 25065
342 Ga0395901_0152106 3300038443 Unclassified 2432
343 Ga0395901_1580879 3300038443 Bacteria 610
344 Ga0436365_1585044 3300039437 Bacteria 20064
345 Ga0436362_0493007 3300039453 Bacteria 559
346 Ga0451839_0239495 3300041496 Bacteria 801
347 Ga0451577_0000022 3300042876 Bacteria 437063
348 Ga0451577_0235515 3300042876 Bacteria 1656
349 Ga0451577_0809669 3300042876 Bacteria 846
350 Ga0466972_0009551 3300044658 Bacteria 4872
351 Ga0453683_0000311 3300044673 Bacteria 61262
352 Ga0453683_0006114 3300044673 Bacteria 8295
353 Ga0453683_0014504 3300044673 Bacteria 5112
354 Ga0453683_0050590 3300044673 Bacteria 2604
355 Ga0466965_0009461 3300044683 Bacteria 4528
356 Ga0453684_0002184 3300044712 Bacteria 48777
357 Ga0453684_0490486 3300044712 Bacteria 1362
358 Ga0453684_1234766 3300044712 Bacteria 783
359 Ga0466968_0090122 3300044735 Bacteria 1357
360 Ga0466957_0014996 3300044842 Bacteria 4522
361 Ga0466960_0013928 3300044901 Bacteria 3427
362 Ga0451576_0000044 3300045051 Bacteria 334467
363 Ga0451576_0016624 3300045051 Bacteria 8115
364 Ga0451576_0139253 3300045051 Bacteria 2531
365 Ga0451576_0197402 3300045051 Bacteria 2102
366 Ga0466967_0013566 3300045976 Bacteria 6303
367 Ga0466967_1706346 3300045976 Bacteria 627
368 Ga0495585_0027598 3300046492 Bacteria 3240
369 Ga0495668_0127531 3300046616 Bacteria 1393
370 Ga0496100_0739207 3300048903 Bacteria 769
371 Ga0496101_0301691 3300048904 Bacteria 1255
372 Ga0496106_0190234 3300048909 Bacteria 1632
373 Ga0496106_0819456 3300048909 Bacteria 738
374 Ga0496108_0804331 3300048911 Bacteria 811
375 Ga0496109_0906853 3300048912 Bacteria 819
376 Ga0496114_0434523 3300048917 Bacteria 1163
377 Ga0496123_0442792 3300048926 Bacteria 580
378 Ga0496124_0424136 3300048927 Bacteria 915
379 Ga0501039_0189227 3300049575 Bacteria 1619
380 Ga0501040_0527206 3300049576 Bacteria 852
381 Ga0501040_0542919 3300049576 Bacteria 839
382 Ga0501047_0100283 3300049581 Bacteria 2775
383 Ga0501069_0667563 3300049585 Bacteria 626
384 Ga0501070_0001315 3300049586 Bacteria 22249
385 Ga0501073_0002963 3300049589 Bacteria 12735
386 Ga0501074_0137676 3300049590 Bacteria 1747
387 Ga0501076_1242497 3300049592 Bacteria 613
388 Ga0501216_074974 3300049660 Bacteria 706
389 Ga0501253_088512 3300049683 Bacteria 709
390 Ga0501257_023663 3300049686 Bacteria 1457
391 Ga0501225_0088260 3300049705 Bacteria 896
392 Ga0501080_0019702 3300049742 Bacteria 6248
393 Ga0501080_0238615 3300049742 Bacteria 1660
394 Ga0501241_037369 3300049758 Bacteria 933
395 Ga0500578_0097334 3300053086 Bacteria 1865
396 Ga0500643_006704 3300053087 Bacteria 4764
397 Ga0500655_051208 3300053133 Bacteria 823
398 Ga0500577_0025902 3300053142 Bacteria 1990
399 Ga0500616_0000039 3300053153 Bacteria 383915
400 Ga0500616_0077143 3300053153 Unclassified 1683
401 Ga0500570_022355 3300053724 Unclassified 3512
402 Ga0587088_139152 3300059508 Bacteria 578

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005445 Ga0070708_101160864 Ga0070708_1011608641 122
2 3300014969 Ga0157376_10903986 Ga0157376_109039861 122
3 3300031730 Ga0307516_10425952 Ga0307516_104259521 122
4 3300053086 Ga0500578_0097334 Ga0500578_0097334_1294_1758 122
5 3300053153 Ga0500616_0077143 Ga0500616_0077143_428_877 125
6 3300003203 JGI25406J46586_10059547 JGI25406J46586_100595472 126
7 3300005290 Ga0065712_10403857 Ga0065712_104038571 126
8 3300005293 Ga0065715_10109276 Ga0065715_101092762 126
9 3300005327 Ga0070658_10331917 Ga0070658_103319171 126
10 3300005329 Ga0070683_100026224 Ga0070683_1000262242 126
11 3300005329 Ga0070683_100438845 Ga0070683_1004388452 126
12 3300005331 Ga0070670_100261590 Ga0070670_1002615902 126
13 3300005331 Ga0070670_100580836 Ga0070670_1005808362 126
14 3300005333 Ga0070677_10014519 Ga0070677_100145193 126
15 3300005336 Ga0070680_100548178 Ga0070680_1005481782 126
16 3300005338 Ga0068868_101245921 Ga0068868_1012459211 126
17 3300005340 Ga0070689_100043125 Ga0070689_1000431252 126
18 3300005343 Ga0070687_100099853 Ga0070687_1000998531 126
19 3300005353 Ga0070669_100001729 Ga0070669_10000172910 126
20 3300005354 Ga0070675_100015954 Ga0070675_1000159543 126
21 3300005364 Ga0070673_100113888 Ga0070673_1001138885 126
22 3300005364 Ga0070673_100459341 Ga0070673_1004593412 126
23 3300005365 Ga0070688_100017620 Ga0070688_1000176201 126
24 3300005366 Ga0070659_100092226 Ga0070659_1000922263 126
25 3300005435 Ga0070714_101584301 Ga0070714_1015843011 126
26 3300005445 Ga0070708_100308237 Ga0070708_1003082372 126
27 3300005456 Ga0070678_100088568 Ga0070678_1000885683 126
28 3300005466 Ga0070685_10039883 Ga0070685_100398835 126
29 3300005467 Ga0070706_101029917 Ga0070706_1010299172 126
30 3300005530 Ga0070679_100553000 Ga0070679_1005530002 126
31 3300005535 Ga0070684_100274950 Ga0070684_1002749502 126
32 3300005543 Ga0070672_100110155 Ga0070672_1001101553 126
33 3300005543 Ga0070672_100207584 Ga0070672_1002075841 126
34 3300005563 Ga0068855_101464518 Ga0068855_1014645181 126
35 3300005564 Ga0070664_100026597 Ga0070664_1000265972 126
36 3300005564 Ga0070664_100148371 Ga0070664_1001483712 126
37 3300005564 Ga0070664_101261834 Ga0070664_1012618342 126
38 3300005577 Ga0068857_100236753 Ga0068857_1002367532 126
39 3300005616 Ga0068852_100092675 Ga0068852_1000926753 126
40 3300005617 Ga0068859_100013571 Ga0068859_1000135715 126
41 3300005840 Ga0068870_10039058 Ga0068870_100390582 126
42 3300005842 Ga0068858_100220968 Ga0068858_1002209681 126
43 3300005842 Ga0068858_100222634 Ga0068858_1002226343 126
44 3300005844 Ga0068862_100039161 Ga0068862_1000391614 126
45 3300005844 Ga0068862_100702132 Ga0068862_1007021322 126
46 3300005985 Ga0081539_10010413 Ga0081539_100104138 126
47 3300006931 Ga0097620_100013571 Ga0097620_1000135714 126
48 3300006931 Ga0097620_100017869 Ga0097620_1000178694 126
49 3300009101 Ga0105247_11337193 Ga0105247_113371931 126
50 3300009551 Ga0105238_10032017 Ga0105238_100320174 126
51 3300013100 Ga0157373_10119182 Ga0157373_101191822 126
52 3300013100 Ga0157373_11508422 Ga0157373_115084221 126
53 3300013102 Ga0157371_10646254 Ga0157371_106462542 126
54 3300013306 Ga0163162_10209775 Ga0163162_102097752 126
55 3300013307 Ga0157372_10349098 Ga0157372_103490981 126
56 3300013308 Ga0157375_10862609 Ga0157375_108626091 126
57 3300014497 Ga0182008_10084215 Ga0182008_100842152 126
58 3300025315 Ga0207697_10055177 Ga0207697_100551772 126
59 3300025893 Ga0207682_10135471 Ga0207682_101354712 126
60 3300025901 Ga0207688_10322231 Ga0207688_103222311 126
61 3300025908 Ga0207643_10005894 Ga0207643_100058945 126
62 3300025918 Ga0207662_10519017 Ga0207662_105190171 126
63 3300025920 Ga0207649_10033784 Ga0207649_100337844 126
64 3300025921 Ga0207652_10833455 Ga0207652_108334552 126
65 3300025923 Ga0207681_10030030 Ga0207681_100300304 126
66 3300025925 Ga0207650_10225952 Ga0207650_102259522 126
67 3300025925 Ga0207650_10477313 Ga0207650_104773132 126
68 3300025926 Ga0207659_10025394 Ga0207659_100253945 126
69 3300025926 Ga0207659_10770141 Ga0207659_107701412 126
70 3300025931 Ga0207644_10469080 Ga0207644_104690801 126
71 3300025931 Ga0207644_10709033 Ga0207644_107090332 126
72 3300025932 Ga0207690_10713243 Ga0207690_107132431 126
73 3300025936 Ga0207670_11374752 Ga0207670_113747521 126
74 3300025937 Ga0207669_10099398 Ga0207669_100993983 126
75 3300025940 Ga0207691_10026643 Ga0207691_100266435 126
76 3300025940 Ga0207691_10131880 Ga0207691_101318802 126
77 3300025944 Ga0207661_10095008 Ga0207661_100950082 126
78 3300025944 Ga0207661_10323113 Ga0207661_103231132 126
79 3300025944 Ga0207661_11108026 Ga0207661_111080261 126
80 3300025949 Ga0207667_10173850 Ga0207667_101738502 126
81 3300025960 Ga0207651_10088029 Ga0207651_100880292 126
82 3300025960 Ga0207651_10091276 Ga0207651_100912762 126
83 3300025960 Ga0207651_11194172 Ga0207651_111941721 126
84 3300026023 Ga0207677_11416858 Ga0207677_114168582 126
85 3300026035 Ga0207703_10052260 Ga0207703_100522604 126
86 3300026089 Ga0207648_11447359 Ga0207648_114473591 126
87 3300026095 Ga0207676_11634684 Ga0207676_116346841 126
88 3300026116 Ga0207674_10021363 Ga0207674_100213632 126
89 3300026121 Ga0207683_10163998 Ga0207683_101639982 126
90 3300026142 Ga0207698_11306792 Ga0207698_113067922 126
91 3300031731 Ga0307405_10025131 Ga0307405_100251311 126
92 3300031731 Ga0307405_10321708 Ga0307405_103217082 126
93 3300031731 Ga0307405_11809111 Ga0307405_118091111 126
94 3300031852 Ga0307410_10488344 Ga0307410_104883442 126
95 3300031995 Ga0307409_100649875 Ga0307409_1006498752 126
96 3300032126 Ga0307415_100136012 Ga0307415_1001360122 126
97 3300037418 Ga0395900_0018574 Ga0395900_0018574_3187_3696 126
98 3300037466 Ga0395898_0058157 Ga0395898_0058157_1888_2397 126
99 3300038443 Ga0395901_0152106 Ga0395901_0152106_720_1229 126
100 3300044658 Ga0466972_0009551 Ga0466972_0009551_3862_4299 126
101 3300044683 Ga0466965_0009461 Ga0466965_0009461_3906_4343 126
102 3300044712 Ga0453684_0490486 Ga0453684_0490486_312_749 126
103 3300044735 Ga0466968_0090122 Ga0466968_0090122_774_1211 126
104 3300044901 Ga0466960_0013928 Ga0466960_0013928_1960_2397 126
105 3300045976 Ga0466967_1706346 Ga0466967_1706346_136_573 126
106 3300048926 Ga0496123_0442792 Ga0496123_0442792_40_486 126
107 3300048927 Ga0496124_0424136 Ga0496124_0424136_233_670 126
108 3300049575 Ga0501039_0189227 Ga0501039_0189227_196_633 126
109 3300049576 Ga0501040_0527206 Ga0501040_0527206_359_802 126
110 3300049576 Ga0501040_0542919 Ga0501040_0542919_373_810 126
111 3300049581 Ga0501047_0100283 Ga0501047_0100283_520_957 126
112 3300049585 Ga0501069_0667563 Ga0501069_0667563_91_528 126
113 3300049592 Ga0501076_1242497 Ga0501076_1242497_83_520 126
114 3300049660 Ga0501216_074974 Ga0501216_074974_130_567 126
115 3300049683 Ga0501253_088512 Ga0501253_088512_128_565 126
116 3300049705 Ga0501225_0088260 Ga0501225_0088260_363_800 126
117 3300049758 Ga0501241_037369 Ga0501241_037369_88_525 126
118 3300053087 Ga0500643_006704 Ga0500643_006704_1544_1996 126
119 3300053142 Ga0500577_0025902 Ga0500577_0025902_1086_1523 126
120 3300053724 Ga0500570_022355 Ga0500570_022355_1997_2449 126
121 3300059508 Ga0587088_139152 Ga0587088_139152_57_494 126
122 3300002773 JGI25152J39213_1000390 JGI25152J39213_100039023 127
123 3300002774 JGI25150J39212_1000462 JGI25150J39212_100046226 127
124 3300003215 JGI25153J46596_10006240 JGI25153J46596_100062407 127
125 3300003775 Ga0055524_1000848 Ga0055524_100084826 127
126 3300005328 Ga0070676_10009156 Ga0070676_100091561 127
127 3300005334 Ga0068869_100197715 Ga0068869_1001977152 127
128 3300005343 Ga0070687_100183168 Ga0070687_1001831681 127
129 3300005355 Ga0070671_100205554 Ga0070671_1002055541 127
130 3300005356 Ga0070674_100816638 Ga0070674_1008166381 127
131 3300005366 Ga0070659_101899666 Ga0070659_1018996661 127
132 3300005367 Ga0070667_100167938 Ga0070667_1001679381 127
133 3300005459 Ga0068867_100139383 Ga0068867_1001393832 127
134 3300005459 Ga0068867_100386043 Ga0068867_1003860432 127
135 3300005543 Ga0070672_100062112 Ga0070672_1000621121 127
136 3300005577 Ga0068857_100056163 Ga0068857_1000561633 127
137 3300005840 Ga0068870_10079611 Ga0068870_100796113 127
138 3300006195 Ga0075366_10589630 Ga0075366_105896301 127
139 3300006353 Ga0075370_10535312 Ga0075370_105353121 127
140 3300006844 Ga0075428_100024165 Ga0075428_1000241657 127
141 3300009093 Ga0105240_10085793 Ga0105240_100857931 127
142 3300009093 Ga0105240_10713763 Ga0105240_107137631 127
143 3300025245 Ga0207425_1000006 Ga0207425_1000006484 127
144 3300025258 Ga0209129_1000009 Ga0209129_1000009313 127
145 3300025297 Ga0209758_1001155 Ga0209758_100115525 127
146 3300025299 Ga0209256_1000191 Ga0209256_100019164 127
147 3300025907 Ga0207645_10007533 Ga0207645_100075331 127
148 3300025908 Ga0207643_10077159 Ga0207643_100771593 127
149 3300025913 Ga0207695_10881860 Ga0207695_108818601 127
150 3300025918 Ga0207662_11027098 Ga0207662_110270981 127
151 3300025927 Ga0207687_10845339 Ga0207687_108453391 127
152 3300025931 Ga0207644_10157560 Ga0207644_101575601 127
153 3300025937 Ga0207669_11001300 Ga0207669_110013001 127
154 3300025938 Ga0207704_10086569 Ga0207704_100865692 127
155 3300025940 Ga0207691_10155578 Ga0207691_101555781 127
156 3300025942 Ga0207689_10700506 Ga0207689_107005061 127
157 3300025960 Ga0207651_10230323 Ga0207651_102303232 127
158 3300026078 Ga0207702_11104624 Ga0207702_111046241 127
159 3300026089 Ga0207648_10172978 Ga0207648_101729782 127
160 3300026089 Ga0207648_10408940 Ga0207648_104089402 127
161 3300026116 Ga0207674_10012411 Ga0207674_1001241111 127
162 3300033180 Ga0307510_10653700 Ga0307510_106537001 127
163 3300044842 Ga0466957_0014996 Ga0466957_0014996_2431_2874 127
164 3300045976 Ga0466967_0013566 Ga0466967_0013566_5296_5739 127
165 3300049589 Ga0501073_0002963 Ga0501073_0002963_4310_4750 127
166 3300049590 Ga0501074_0137676 Ga0501074_0137676_320_760 127
167 3300049742 Ga0501080_0238615 Ga0501080_0238615_700_1140 127
168 3300053153 Ga0500616_0000039 Ga0500616_0000039_251266_251721 127
169 3300025919 Ga0207657_10418329 Ga0207657_104183292 128
170 3300025920 Ga0207649_10974084 Ga0207649_109740841 128
171 3300026089 Ga0207648_10180495 Ga0207648_101804952 128
172 3300026121 Ga0207683_11785997 Ga0207683_117859971 128
173 3300028380 Ga0268265_10013996 Ga0268265_100139967 128
174 3300028381 Ga0268264_10196753 Ga0268264_101967533 128
175 3300032005 Ga0307411_10188991 Ga0307411_101889911 128
176 3300037466 Ga0395898_0339698 Ga0395898_0339698_570_1019 128
177 3300037471 Ga0395905_0001772 Ga0395905_0001772_11482_11931 128
178 3300042876 Ga0451577_0235515 Ga0451577_0235515_561_1013 128
179 3300042876 Ga0451577_0809669 Ga0451577_0809669_349_807 128
180 3300044673 Ga0453683_0000311 Ga0453683_0000311_8038_8490 128
181 3300045051 Ga0451576_0016624 Ga0451576_0016624_2585_3037 128
182 3300049686 Ga0501257_023663 Ga0501257_023663_823_1275 128
183 3300053133 Ga0500655_051208 Ga0500655_051208_47_505 128
184 3300001977 JGI24746J21847_1058919 JGI24746J21847_10589191 129
185 3300001990 JGI24737J22298_10055486 JGI24737J22298_100554862 129
186 3300005289 Ga0065704_10167983 Ga0065704_101679832 129
187 3300005293 Ga0065715_10186648 Ga0065715_101866481 129
188 3300005295 Ga0065707_10141738 Ga0065707_101417381 129
189 3300005327 Ga0070658_10187177 Ga0070658_101871773 129
190 3300005327 Ga0070658_10276959 Ga0070658_102769591 129
191 3300005328 Ga0070676_10001630 Ga0070676_100016305 129
192 3300005329 Ga0070683_100117443 Ga0070683_1001174433 129
193 3300005329 Ga0070683_100134836 Ga0070683_1001348362 129
194 3300005329 Ga0070683_100146292 Ga0070683_1001462922 129
195 3300005329 Ga0070683_100466333 Ga0070683_1004663332 129
196 3300005330 Ga0070690_100535480 Ga0070690_1005354801 129
197 3300005331 Ga0070670_100059193 Ga0070670_1000591933 129
198 3300005331 Ga0070670_100115776 Ga0070670_1001157762 129
199 3300005334 Ga0068869_100034705 Ga0068869_1000347053 129
200 3300005336 Ga0070680_100169042 Ga0070680_1001690423 129
201 3300005338 Ga0068868_100059276 Ga0068868_1000592762 129
202 3300005338 Ga0068868_101409758 Ga0068868_1014097581 129
203 3300005339 Ga0070660_100097723 Ga0070660_1000977232 129
204 3300005339 Ga0070660_100786621 Ga0070660_1007866211 129
205 3300005340 Ga0070689_100010400 Ga0070689_1000104004 129
206 3300005341 Ga0070691_10112635 Ga0070691_101126353 129
207 3300005343 Ga0070687_100014273 Ga0070687_1000142733 129
208 3300005344 Ga0070661_100096892 Ga0070661_1000968922 129
209 3300005344 Ga0070661_100119822 Ga0070661_1001198222 129
210 3300005344 Ga0070661_100385989 Ga0070661_1003859892 129
211 3300005345 Ga0070692_10029195 Ga0070692_100291951 129
212 3300005347 Ga0070668_100004196 Ga0070668_1000041967 129
213 3300005353 Ga0070669_100049958 Ga0070669_1000499582 129
214 3300005353 Ga0070669_100644139 Ga0070669_1006441391 129
215 3300005354 Ga0070675_100085440 Ga0070675_1000854402 129
216 3300005355 Ga0070671_100356835 Ga0070671_1003568352 129
217 3300005364 Ga0070673_100193588 Ga0070673_1001935882 129
218 3300005365 Ga0070688_100034106 Ga0070688_1000341063 129
219 3300005366 Ga0070659_100044340 Ga0070659_1000443402 129
220 3300005367 Ga0070667_100096581 Ga0070667_1000965812 129
221 3300005438 Ga0070701_10074189 Ga0070701_100741892 129
222 3300005441 Ga0070700_100035546 Ga0070700_1000355461 129
223 3300005444 Ga0070694_100239709 Ga0070694_1002397092 129
224 3300005455 Ga0070663_100049458 Ga0070663_1000494582 129
225 3300005455 Ga0070663_100241899 Ga0070663_1002418991 129
226 3300005456 Ga0070678_100031593 Ga0070678_1000315932 129
227 3300005457 Ga0070662_100051514 Ga0070662_1000515142 129
228 3300005459 Ga0068867_100265195 Ga0068867_1002651952 129
229 3300005459 Ga0068867_100579488 Ga0068867_1005794882 129
230 3300005466 Ga0070685_10147084 Ga0070685_101470842 129
231 3300005518 Ga0070699_100259678 Ga0070699_1002596782 129
232 3300005535 Ga0070684_100133421 Ga0070684_1001334212 129
233 3300005535 Ga0070684_100253534 Ga0070684_1002535342 129
234 3300005539 Ga0068853_100336088 Ga0068853_1003360881 129
235 3300005539 Ga0068853_100693212 Ga0068853_1006932122 129
236 3300005543 Ga0070672_100031491 Ga0070672_1000314913 129
237 3300005544 Ga0070686_100848642 Ga0070686_1008486421 129
238 3300005545 Ga0070695_100418260 Ga0070695_1004182602 129
239 3300005546 Ga0070696_100005507 Ga0070696_1000055073 129
240 3300005548 Ga0070665_101562721 Ga0070665_1015627211 129
241 3300005549 Ga0070704_101302823 Ga0070704_1013028231 129
242 3300005563 Ga0068855_100101513 Ga0068855_1001015132 129
243 3300005563 Ga0068855_100107725 Ga0068855_1001077252 129
244 3300005564 Ga0070664_100094575 Ga0070664_1000945754 129
245 3300005564 Ga0070664_100256748 Ga0070664_1002567482 129
246 3300005564 Ga0070664_100460223 Ga0070664_1004602232 129
247 3300005577 Ga0068857_100220683 Ga0068857_1002206833 129
248 3300005578 Ga0068854_100023842 Ga0068854_1000238422 129
249 3300005578 Ga0068854_100472445 Ga0068854_1004724452 129
250 3300005615 Ga0070702_100591391 Ga0070702_1005913911 129
251 3300005616 Ga0068852_100074534 Ga0068852_1000745342 129
252 3300005617 Ga0068859_100203763 Ga0068859_1002037632 129
253 3300005617 Ga0068859_101415928 Ga0068859_1014159281 129
254 3300005618 Ga0068864_100027598 Ga0068864_1000275982 129
255 3300005618 Ga0068864_100140808 Ga0068864_1001408082 129
256 3300005718 Ga0068866_10348149 Ga0068866_103481492 129
257 3300005719 Ga0068861_100037542 Ga0068861_1000375423 129
258 3300005834 Ga0068851_10451968 Ga0068851_104519682 129
259 3300005841 Ga0068863_100186693 Ga0068863_1001866932 129
260 3300005842 Ga0068858_100044266 Ga0068858_1000442662 129
261 3300005842 Ga0068858_100447563 Ga0068858_1004475631 129
262 3300005843 Ga0068860_100082260 Ga0068860_1000822603 129
263 3300005844 Ga0068862_100023049 Ga0068862_1000230492 129
264 3300006237 Ga0097621_100870846 Ga0097621_1008708462 129
265 3300006881 Ga0068865_100083891 Ga0068865_1000838912 129
266 3300006881 Ga0068865_100130787 Ga0068865_1001307872 129
267 3300006931 Ga0097620_100203762 Ga0097620_1002037622 129
268 3300006931 Ga0097620_101415738 Ga0097620_1014157381 129
269 3300007265 Ga0099794_10246893 Ga0099794_102468932 129
270 3300009093 Ga0105240_10042629 Ga0105240_100426294 129
271 3300009093 Ga0105240_10263279 Ga0105240_102632792 129
272 3300009098 Ga0105245_10323061 Ga0105245_103230611 129
273 3300009101 Ga0105247_10398092 Ga0105247_103980923 129
274 3300009148 Ga0105243_10412338 Ga0105243_104123382 129
275 3300009174 Ga0105241_10392568 Ga0105241_103925682 129
276 3300009176 Ga0105242_10038763 Ga0105242_100387633 129
277 3300009545 Ga0105237_10207366 Ga0105237_102073662 129
278 3300010375 Ga0105239_10000003 Ga0105239_10000003556 129
279 3300010375 Ga0105239_10746284 Ga0105239_107462842 129
280 3300011119 Ga0105246_10443615 Ga0105246_104436151 129
281 3300011119 Ga0105246_10863429 Ga0105246_108634292 129
282 3300013100 Ga0157373_10131611 Ga0157373_101316111 129
283 3300013102 Ga0157371_10070090 Ga0157371_100700902 129
284 3300013296 Ga0157374_10248757 Ga0157374_102487572 129
285 3300013296 Ga0157374_10449684 Ga0157374_104496841 129
286 3300013306 Ga0163162_10057888 Ga0163162_100578882 129
287 3300013306 Ga0163162_10300152 Ga0163162_103001522 129
288 3300013307 Ga0157372_10117008 Ga0157372_101170083 129
289 3300013307 Ga0157372_10187803 Ga0157372_101878033 129
290 3300013308 Ga0157375_10054950 Ga0157375_100549501 129
291 3300013308 Ga0157375_10074499 Ga0157375_100744993 129
292 3300013308 Ga0157375_10699469 Ga0157375_106994691 129
293 3300014325 Ga0163163_10027932 Ga0163163_100279321 129
294 3300014325 Ga0163163_10291167 Ga0163163_102911672 129
295 3300014745 Ga0157377_10015635 Ga0157377_100156353 129
296 3300014745 Ga0157377_10136289 Ga0157377_101362892 129
297 3300014968 Ga0157379_10363888 Ga0157379_103638882 129
298 3300015265 Ga0182005_1131841 Ga0182005_11318411 129
299 3300017792 Ga0163161_10021976 Ga0163161_100219762 129
300 3300017792 Ga0163161_10023659 Ga0163161_100236592 129
301 3300017792 Ga0163161_10512599 Ga0163161_105125991 129
302 3300021384 Ga0213876_10008603 Ga0213876_100086036 129
303 3300025261 Ga0209233_1004545 Ga0209233_10045454 129
304 3300025315 Ga0207697_10002375 Ga0207697_100023757 129
305 3300025899 Ga0207642_10348096 Ga0207642_103480962 129
306 3300025901 Ga0207688_10021421 Ga0207688_100214213 129
307 3300025904 Ga0207647_10016328 Ga0207647_100163284 129
308 3300025907 Ga0207645_10000565 Ga0207645_1000056515 129
309 3300025909 Ga0207705_10365390 Ga0207705_103653902 129
310 3300025909 Ga0207705_10432842 Ga0207705_104328421 129
311 3300025909 Ga0207705_10549103 Ga0207705_105491032 129
312 3300025911 Ga0207654_10211120 Ga0207654_102111202 129
313 3300025912 Ga0207707_10140072 Ga0207707_101400723 129
314 3300025913 Ga0207695_10011600 Ga0207695_100116006 129
315 3300025913 Ga0207695_10059179 Ga0207695_100591794 129
316 3300025913 Ga0207695_10126214 Ga0207695_101262142 129
317 3300025914 Ga0207671_10185268 Ga0207671_101852682 129
318 3300025917 Ga0207660_10054791 Ga0207660_100547912 129
319 3300025918 Ga0207662_10023006 Ga0207662_100230063 129
320 3300025918 Ga0207662_10064167 Ga0207662_100641672 129
321 3300025919 Ga0207657_10020889 Ga0207657_100208898 129
322 3300025919 Ga0207657_10024927 Ga0207657_100249273 129
323 3300025920 Ga0207649_10022877 Ga0207649_100228773 129
324 3300025920 Ga0207649_10176145 Ga0207649_101761452 129
325 3300025920 Ga0207649_10415587 Ga0207649_104155872 129
326 3300025921 Ga0207652_10030123 Ga0207652_100301235 129
327 3300025921 Ga0207652_10030690 Ga0207652_100306905 129
328 3300025921 Ga0207652_10198636 Ga0207652_101986362 129
329 3300025925 Ga0207650_10168575 Ga0207650_101685752 129
330 3300025925 Ga0207650_10835355 Ga0207650_108353552 129
331 3300025926 Ga0207659_10548830 Ga0207659_105488302 129
332 3300025926 Ga0207659_11566554 Ga0207659_115665541 129
333 3300025927 Ga0207687_10213660 Ga0207687_102136602 129
334 3300025932 Ga0207690_10360790 Ga0207690_103607901 129
335 3300025933 Ga0207706_10001494 Ga0207706_100014944 129
336 3300025936 Ga0207670_10117257 Ga0207670_101172571 129
337 3300025938 Ga0207704_10048632 Ga0207704_100486322 129
338 3300025938 Ga0207704_11162494 Ga0207704_111624941 129
339 3300025940 Ga0207691_10002578 Ga0207691_100025784 129
340 3300025941 Ga0207711_10062510 Ga0207711_100625103 129
341 3300025942 Ga0207689_10009223 Ga0207689_100092237 129
342 3300025944 Ga0207661_10177367 Ga0207661_101773672 129
343 3300025944 Ga0207661_10217728 Ga0207661_102177282 129
344 3300025944 Ga0207661_10270736 Ga0207661_102707363 129
345 3300025944 Ga0207661_11335257 Ga0207661_113352571 129
346 3300025945 Ga0207679_10099481 Ga0207679_100994813 129
347 3300025945 Ga0207679_10586347 Ga0207679_105863472 129
348 3300025945 Ga0207679_10692681 Ga0207679_106926812 129
349 3300025945 Ga0207679_10694766 Ga0207679_106947661 129
350 3300025949 Ga0207667_10086571 Ga0207667_100865713 129
351 3300025949 Ga0207667_10356035 Ga0207667_103560352 129
352 3300025949 Ga0207667_10405029 Ga0207667_104050292 129
353 3300025949 Ga0207667_11655227 Ga0207667_116552271 129
354 3300025960 Ga0207651_10214440 Ga0207651_102144402 129
355 3300025961 Ga0207712_10677002 Ga0207712_106770022 129
356 3300025972 Ga0207668_10011039 Ga0207668_100110393 129
357 3300025981 Ga0207640_10498936 Ga0207640_104989362 129
358 3300025981 Ga0207640_11528964 Ga0207640_115289641 129
359 3300025986 Ga0207658_11152609 Ga0207658_111526092 129
360 3300026035 Ga0207703_10241168 Ga0207703_102411682 129
361 3300026035 Ga0207703_10487537 Ga0207703_104875371 129
362 3300026041 Ga0207639_10000042 Ga0207639_1000004293 129
363 3300026067 Ga0207678_10062823 Ga0207678_100628232 129
364 3300026075 Ga0207708_10010079 Ga0207708_100100791 129
365 3300026088 Ga0207641_10056424 Ga0207641_100564243 129
366 3300026089 Ga0207648_10298145 Ga0207648_102981452 129
367 3300026095 Ga0207676_10738312 Ga0207676_107383121 129
368 3300026095 Ga0207676_10829736 Ga0207676_108297362 129
369 3300026116 Ga0207674_10011844 Ga0207674_100118442 129
370 3300026116 Ga0207674_11093450 Ga0207674_110934501 129
371 3300026118 Ga0207675_100002701 Ga0207675_1000027014 129
372 3300026121 Ga0207683_10018016 Ga0207683_100180162 129
373 3300026142 Ga0207698_10056854 Ga0207698_100568543 129
374 3300026142 Ga0207698_10532058 Ga0207698_105320583 129
375 3300028379 Ga0268266_10034654 Ga0268266_100346543 129
376 3300028379 Ga0268266_10529439 Ga0268266_105294391 129
377 3300028380 Ga0268265_10045557 Ga0268265_100455572 129
378 3300028381 Ga0268264_10011052 Ga0268264_100110527 129
379 3300038443 Ga0395901_1580879 Ga0395901_1580879_75_539 129
380 3300039437 Ga0436365_1585044 Ga0436365_1585044_10296_10748 129
381 3300039453 Ga0436362_0493007 Ga0436362_0493007_40_492 129
382 3300041496 Ga0451839_0239495 Ga0451839_0239495_244_696 129
383 3300042876 Ga0451577_0000022 Ga0451577_0000022_433572_434015 129
384 3300044673 Ga0453683_0006114 Ga0453683_0006114_3679_4122 129
385 3300044673 Ga0453683_0014504 Ga0453683_0014504_4435_4878 129
386 3300044673 Ga0453683_0050590 Ga0453683_0050590_1408_1884 129
387 3300044712 Ga0453684_0002184 Ga0453684_0002184_3049_3492 129
388 3300044712 Ga0453684_1234766 Ga0453684_1234766_166_621 129
389 3300045051 Ga0451576_0000044 Ga0451576_0000044_330976_331419 129
390 3300045051 Ga0451576_0139253 Ga0451576_0139253_1405_1881 129
391 3300045051 Ga0451576_0197402 Ga0451576_0197402_838_1284 129
392 3300046492 Ga0495585_0027598 Ga0495585_0027598_1010_1462 129
393 3300046616 Ga0495668_0127531 Ga0495668_0127531_743_1195 129
394 3300048903 Ga0496100_0739207 Ga0496100_0739207_14_490 129
395 3300048904 Ga0496101_0301691 Ga0496101_0301691_728_1195 129
396 3300048909 Ga0496106_0190234 Ga0496106_0190234_978_1439 129
397 3300048909 Ga0496106_0819456 Ga0496106_0819456_214_690 129
398 3300048911 Ga0496108_0804331 Ga0496108_0804331_190_627 129
399 3300048912 Ga0496109_0906853 Ga0496109_0906853_253_699 129
400 3300048917 Ga0496114_0434523 Ga0496114_0434523_463_939 129
401 3300049586 Ga0501070_0001315 Ga0501070_0001315_13174_13620 129
402 3300049742 Ga0501080_0019702 Ga0501080_0019702_272_718 129

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

23

158

0.82

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

25

147

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ss4-assembly1.cif.gz_A crystal structure of the glyoxalase family protein apc24694 from bacillus cereus 0.7937 1 125
1yfo-assembly2.cif.gz_B receptor protein tyrosine phosphatase alpha, domain 1 from mouse 0.7835 93 126
2i5x-assembly2.cif.gz_B engineering the ptpbeta catalytic domain with improved crystallization properties 0.7705 93 124
1ss4-assembly1.cif.gz_A crystal structure of the glyoxalase family protein apc24694 from bacillus cereus 0.7643 1 125
2i4e-assembly2.cif.gz_B structural studies of protein tyrosine phosphatase beta catalytic domain in complex with inhibitors 0.7634 93 124
ID Description Score Start End Superfamily
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8102 74 129 3.30.720.110
af_A0A1D6NNB1_8_105_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7838 93 126 2.40.50.140
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7757 75 122 3.30.720.110
2i7rB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7647 74 123 3.10.180.10
4huzA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7639 77 123 3.10.180.10
ID Description Score Start End GO Terms
AF-X6FUB6-F1-model_v4 VOC domain-containing protein 0.9986 75 125
AF-A0A1C5F0C3-F1-model_v4 VOC domain-containing protein 0.9882 75 126
AF-A0A7W9V2G9-F1-model_v4 Putative enzyme related to lactoylglutathione lyase 0.9823 77 126 GO:0016829
AF-A0A1C5F0C3-F1-model_v4 VOC domain-containing protein 0.9698 75 126
AF-X6FUB6-F1-model_v4 VOC domain-containing protein 0.961 75 125

Feature Viewer

pLDDT pTM Quality
80.31 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map