F435014

General Info

Members Datasets Scaffolds Average Seq Length
402 154 804 132

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10895407|Ga0070658_108954072
Length 135
Sequence MAKRPVFEMTFTAAPGDIDELGHVNNAVWVQWIQQVAVANWDSIAQPAHRDRYFWVVVRHEIDYLRAAHEGDEIVARTWVGDAPQGARFDRFVEFSGADGKTCVRARTVWAMLDRSSGRPLRVPPEVVAPFLGAR

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
120 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
121 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
122 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
131 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
132 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
133 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
136 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
137 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
138 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
139 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
140 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
145 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
146 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
147 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
148 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
149 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
154 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1
Rhizosphere 98.76
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10895407 3300005327 Bacteria 771
2 JGI24741J21665_1005647 3300001915 Bacteria 2590
3 JGI24740J21852_10002142 3300001979 Bacteria 9023
4 JGI24740J21852_10002345 3300001979 Bacteria 8622
5 JGI24735J21928_10025041 3300002067 Bacteria 1802
6 JGI24034J26672_10106847 3300002239 Bacteria 532
7 Ga0070658_10009386 3300005327 Bacteria 7858
8 Ga0070658_10023900 3300005327 Bacteria 4902
9 Ga0070658_10545300 3300005327 Bacteria 1003
10 Ga0070658_10653253 3300005327 Bacteria 912
11 Ga0070658_10777514 3300005327 Bacteria 832
12 Ga0070658_10954989 3300005327 Bacteria 745
13 Ga0070676_11358028 3300005328 Bacteria 544
14 Ga0070683_100039236 3300005329 Bacteria 4346
15 Ga0070683_100084862 3300005329 Bacteria 2968
16 Ga0070683_100141589 3300005329 Bacteria 2278
17 Ga0070683_100205955 3300005329 Bacteria 1868
18 Ga0070683_100337643 3300005329 Bacteria 1434
19 Ga0070690_100028987 3300005330 Bacteria 3431
20 Ga0070666_10000175 3300005335 Bacteria 43927
21 Ga0070680_100000406 3300005336 Bacteria 29408
22 Ga0070680_100002838 3300005336 Bacteria 12874
23 Ga0070680_100005002 3300005336 Bacteria 9989
24 Ga0070680_100087457 3300005336 Bacteria 2577
25 Ga0070680_100281712 3300005336 Bacteria 1408
26 Ga0070682_100120292 3300005337 Bacteria 1762
27 Ga0068868_100000365 3300005338 Bacteria 30746
28 Ga0070660_100009510 3300005339 Bacteria 6840
29 Ga0070660_100090774 3300005339 Bacteria 2409
30 Ga0070660_100114506 3300005339 Bacteria 2148
31 Ga0070660_100459749 3300005339 Bacteria 1057
32 Ga0070660_100534206 3300005339 Bacteria 977
33 Ga0070660_101310371 3300005339 Bacteria 615
34 Ga0070689_100493213 3300005340 Bacteria 1048
35 Ga0070691_10006466 3300005341 Bacteria 5357
36 Ga0070687_100260335 3300005343 Bacteria 1082
37 Ga0070661_100102287 3300005344 Bacteria 2132
38 Ga0070661_100119411 3300005344 Bacteria 1974
39 Ga0070661_100164252 3300005344 Bacteria 1683
40 Ga0070661_100645726 3300005344 Bacteria 859
41 Ga0070661_100826319 3300005344 Bacteria 761
42 Ga0070692_10127859 3300005345 Bacteria 1425
43 Ga0070675_100367379 3300005354 Bacteria 1279
44 Ga0070674_100005852 3300005356 Bacteria 7149
45 Ga0070673_100002439 3300005364 Bacteria 11337
46 Ga0070659_100030599 3300005366 Bacteria 4166
47 Ga0070659_100112642 3300005366 Bacteria 2197
48 Ga0070659_100620159 3300005366 Bacteria 931
49 Ga0070659_100727184 3300005366 Bacteria 860
50 Ga0070659_101023201 3300005366 Bacteria 726
51 Ga0070659_101389286 3300005366 Bacteria 624
52 Ga0070667_100023594 3300005367 Bacteria 5106
53 Ga0070714_100029406 3300005435 Bacteria 4568
54 Ga0070714_100235073 3300005435 Bacteria 1690
55 Ga0070713_100075140 3300005436 Bacteria 2865
56 Ga0070713_100079326 3300005436 Bacteria 2796
57 Ga0070710_10300234 3300005437 Bacteria 1048
58 Ga0070663_100221258 3300005455 Bacteria 1486
59 Ga0070663_100389304 3300005455 Bacteria 1137
60 Ga0070678_100028660 3300005456 Bacteria 3801
61 Ga0070662_100001943 3300005457 Bacteria 12698
62 Ga0070662_100071616 3300005457 Bacteria 2556
63 Ga0070662_100160885 3300005457 Bacteria 1756
64 Ga0070662_100256889 3300005457 Bacteria 1406
65 Ga0070662_100621296 3300005457 Bacteria 910
66 Ga0070662_100848763 3300005457 Bacteria 778
67 Ga0070662_101292128 3300005457 Bacteria 628
68 Ga0070681_10218273 3300005458 Bacteria 1823
69 Ga0070681_10455594 3300005458 Bacteria 1191
70 Ga0070679_100040091 3300005530 Bacteria 4658
71 Ga0070679_100064966 3300005530 Bacteria 3637
72 Ga0070679_100275242 3300005530 Bacteria 1637
73 Ga0070679_100451700 3300005530 Bacteria 1230
74 Ga0070679_100594367 3300005530 Bacteria 1050
75 Ga0070684_100001026 3300005535 Bacteria 19914
76 Ga0070684_100004556 3300005535 Bacteria 10560
77 Ga0070684_100495339 3300005535 Bacteria 1131
78 Ga0068853_100016746 3300005539 Bacteria 6038
79 Ga0068853_100121918 3300005539 Bacteria 2326
80 Ga0068853_100140057 3300005539 Bacteria 2171
81 Ga0068853_100495767 3300005539 Bacteria 1153
82 Ga0070672_100392250 3300005543 Bacteria 1189
83 Ga0070672_100537143 3300005543 Bacteria 1014
84 Ga0070686_100081821 3300005544 Bacteria 2140
85 Ga0070665_100388557 3300005548 Bacteria 1403
86 Ga0070665_100500748 3300005548 Bacteria 1226
87 Ga0068855_100006137 3300005563 Bacteria 14646
88 Ga0068855_100192793 3300005563 Bacteria 2297
89 Ga0068855_100356097 3300005563 Bacteria 1611
90 Ga0068855_100780478 3300005563 Bacteria 1017
91 Ga0068855_100858458 3300005563 Bacteria 961
92 Ga0068855_101041860 3300005563 Bacteria 858
93 Ga0070664_100075187 3300005564 Bacteria 2900
94 Ga0070664_100200806 3300005564 Bacteria 1779
95 Ga0070664_100527053 3300005564 Bacteria 1091
96 Ga0068857_100017625 3300005577 Bacteria 6261
97 Ga0068857_100268201 3300005577 Bacteria 1568
98 Ga0068857_100377074 3300005577 Bacteria 1316
99 Ga0068857_100582962 3300005577 Bacteria 1056
100 Ga0068854_100006147 3300005578 Bacteria 7621
101 Ga0068854_100018383 3300005578 Bacteria 4691
102 Ga0068854_100251747 3300005578 Bacteria 1411
103 Ga0068856_100044902 3300005614 Bacteria 4349
104 Ga0068856_100079193 3300005614 Bacteria 3258
105 Ga0068856_100205148 3300005614 Bacteria 1986
106 Ga0068856_100360981 3300005614 Bacteria 1471
107 Ga0068852_100010589 3300005616 Bacteria 6900
108 Ga0068852_100101667 3300005616 Bacteria 2596
109 Ga0068852_100154406 3300005616 Bacteria 2137
110 Ga0068852_100197211 3300005616 Bacteria 1903
111 Ga0068852_100503155 3300005616 Bacteria 1207
112 Ga0068852_100704174 3300005616 Bacteria 1020
113 Ga0068852_101041756 3300005616 Bacteria 837
114 Ga0068859_100118175 3300005617 Bacteria 2717
115 Ga0068866_10139666 3300005718 Bacteria 1389
116 Ga0068858_100001465 3300005842 Bacteria 24278
117 Ga0068860_100214188 3300005843 Bacteria 1869
118 Ga0070717_10022282 3300006028 Bacteria 5003
119 Ga0070716_100132832 3300006173 Bacteria 1576
120 Ga0070712_100035292 3300006175 Bacteria 3395
121 Ga0075427_10106350 3300006194 Bacteria 526
122 Ga0097621_101306959 3300006237 Bacteria 685
123 Ga0068865_100009838 3300006881 Bacteria 5939
124 Ga0097620_100118176 3300006931 Bacteria 2717
125 Ga0105240_10086436 3300009093 Bacteria 3840
126 Ga0105240_10789738 3300009093 Bacteria 1029
127 Ga0105240_11020034 3300009093 Bacteria 884
128 Ga0105240_11870215 3300009093 Bacteria 625
129 Ga0105245_10955768 3300009098 Bacteria 900
130 Ga0114129_10436973 3300009147 Bacteria 1719
131 Ga0105241_11030101 3300009174 Bacteria 772
132 Ga0105248_10000818 3300009177 Bacteria 34897
133 Ga0105238_10058464 3300009551 Bacteria 3865
134 Ga0105238_10131150 3300009551 Bacteria 2484
135 Ga0105238_10256933 3300009551 Bacteria 1726
136 Ga0105239_12580148 3300010375 Bacteria 593
137 Ga0157373_10043793 3300013100 Bacteria 3196
138 Ga0157373_10047425 3300013100 Bacteria 3064
139 Ga0157373_10075751 3300013100 Bacteria 2374
140 Ga0157373_10216322 3300013100 Bacteria 1351
141 Ga0157373_10264227 3300013100 Bacteria 1218
142 Ga0157373_10312534 3300013100 Bacteria 1117
143 Ga0157373_10348121 3300013100 Bacteria 1057
144 Ga0157371_10030425 3300013102 Bacteria 3895
145 Ga0157371_10065575 3300013102 Bacteria 2572
146 Ga0157371_10088804 3300013102 Bacteria 2189
147 Ga0157371_10156795 3300013102 Bacteria 1625
148 Ga0157371_10247937 3300013102 Bacteria 1282
149 Ga0157371_10943866 3300013102 Bacteria 656
150 Ga0157370_10010844 3300013104 Bacteria 9571
151 Ga0157370_10017662 3300013104 Bacteria 7191
152 Ga0157370_10105784 3300013104 Bacteria 2633
153 Ga0157370_10189950 3300013104 Bacteria 1907
154 Ga0157370_10283137 3300013104 Bacteria 1532
155 Ga0157369_10005258 3300013105 Bacteria 15094
156 Ga0157369_10014928 3300013105 Bacteria 8767
157 Ga0157369_10168045 3300013105 Bacteria 2312
158 Ga0157369_10322585 3300013105 Bacteria 1605
159 Ga0157369_10810361 3300013105 Bacteria 962
160 Ga0157369_11217801 3300013105 Bacteria 768
161 Ga0157374_11051104 3300013296 Bacteria 834
162 Ga0157378_10078577 3300013297 Bacteria 2977
163 Ga0157372_10102817 3300013307 Bacteria 3264
164 Ga0157372_10935954 3300013307 Bacteria 1005
165 Ga0157372_11979213 3300013307 Bacteria 670
166 Ga0182008_10153079 3300014497 Bacteria 1157
167 Ga0157379_10372410 3300014968 Bacteria 1310
168 Ga0157376_11232292 3300014969 Bacteria 777
169 Ga0206353_11753332 3300020082 Bacteria 981
170 Ga0207697_10498448 3300025315 Bacteria 538
171 Ga0207682_10033276 3300025893 Bacteria 2075
172 Ga0207642_10122251 3300025899 Bacteria 1345
173 Ga0207680_10071469 3300025903 Bacteria 2151
174 Ga0207647_10119958 3300025904 Bacteria 1551
175 Ga0207647_10157997 3300025904 Bacteria 1323
176 Ga0207699_10032538 3300025906 Bacteria 2939
177 Ga0207645_11026576 3300025907 Bacteria 558
178 Ga0207705_10000382 3300025909 Bacteria 39603
179 Ga0207705_10007994 3300025909 Bacteria 7759
180 Ga0207705_10040344 3300025909 Bacteria 3348
181 Ga0207705_10068498 3300025909 Bacteria 2569
182 Ga0207705_10599869 3300025909 Bacteria 856
183 Ga0207705_11047933 3300025909 Bacteria 629
184 Ga0207654_10119320 3300025911 Bacteria 1653
185 Ga0207654_10732574 3300025911 Bacteria 711
186 Ga0207707_10124110 3300025912 Bacteria 2258
187 Ga0207707_10626890 3300025912 Bacteria 908
188 Ga0207695_10321435 3300025913 Bacteria 1437
189 Ga0207693_10150089 3300025915 Bacteria 1833
190 Ga0207660_10000400 3300025917 Bacteria 28576
191 Ga0207660_10004486 3300025917 Bacteria 9103
192 Ga0207660_10052623 3300025917 Bacteria 2899
193 Ga0207660_10088476 3300025917 Bacteria 2290
194 Ga0207660_10158562 3300025917 Bacteria 1744
195 Ga0207660_10339079 3300025917 Bacteria 1203
196 Ga0207660_10433416 3300025917 Bacteria 1062
197 Ga0207657_10003169 3300025919 Bacteria 17602
198 Ga0207657_10107449 3300025919 Bacteria 2308
199 Ga0207657_10120533 3300025919 Bacteria 2158
200 Ga0207657_10197256 3300025919 Bacteria 1621
201 Ga0207657_10236847 3300025919 Bacteria 1458
202 Ga0207657_10494660 3300025919 Bacteria 958
203 Ga0207649_10188306 3300025920 Bacteria 1449
204 Ga0207649_10264300 3300025920 Bacteria 1245
205 Ga0207649_10347187 3300025920 Bacteria 1097
206 Ga0207652_10103477 3300025921 Bacteria 2517
207 Ga0207652_10114033 3300025921 Bacteria 2399
208 Ga0207652_10194221 3300025921 Bacteria 1826
209 Ga0207652_10441361 3300025921 Bacteria 1173
210 Ga0207652_10461457 3300025921 Bacteria 1145
211 Ga0207652_10708779 3300025921 Bacteria 898
212 Ga0207652_11042643 3300025921 Bacteria 717
213 Ga0207687_10581252 3300025927 Bacteria 942
214 Ga0207700_10066091 3300025928 Bacteria 2762
215 Ga0207700_10202807 3300025928 Bacteria 1672
216 Ga0207664_10090206 3300025929 Bacteria 2511
217 Ga0207664_10094488 3300025929 Bacteria 2457
218 Ga0207664_10103925 3300025929 Bacteria 2351
219 Ga0207664_11641080 3300025929 Bacteria 565
220 Ga0207644_10003745 3300025931 Bacteria 9851
221 Ga0207644_10013778 3300025931 Bacteria 5400
222 Ga0207690_10040601 3300025932 Bacteria 3043
223 Ga0207690_10094784 3300025932 Bacteria 2119
224 Ga0207690_10212460 3300025932 Bacteria 1476
225 Ga0207690_10901026 3300025932 Bacteria 734
226 Ga0207706_10000407 3300025933 Bacteria 46229
227 Ga0207706_10063039 3300025933 Bacteria 3264
228 Ga0207706_10097758 3300025933 Bacteria 2582
229 Ga0207706_10189581 3300025933 Bacteria 1805
230 Ga0207706_10769662 3300025933 Bacteria 819
231 Ga0207706_11134354 3300025933 Bacteria 652
232 Ga0207686_10062424 3300025934 Bacteria 2366
233 Ga0207669_10072640 3300025937 Bacteria 2167
234 Ga0207704_10005247 3300025938 Bacteria 5968
235 Ga0207691_10389301 3300025940 Bacteria 1189
236 Ga0207691_10989559 3300025940 Bacteria 702
237 Ga0207711_10000193 3300025941 Bacteria 65165
238 Ga0207661_10038106 3300025944 Bacteria 3765
239 Ga0207679_10023827 3300025945 Bacteria 4191
240 Ga0207679_10212334 3300025945 Bacteria 1624
241 Ga0207667_10008859 3300025949 Bacteria 11909
242 Ga0207667_10105008 3300025949 Bacteria 2914
243 Ga0207667_10270848 3300025949 Bacteria 1736
244 Ga0207667_10415806 3300025949 Bacteria 1368
245 Ga0207667_11416601 3300025949 Bacteria 668
246 Ga0207651_10010506 3300025960 Bacteria 5135
247 Ga0207640_10007152 3300025981 Bacteria 6150
248 Ga0207640_10071916 3300025981 Bacteria 2331
249 Ga0207640_10752721 3300025981 Bacteria 840
250 Ga0207640_10971361 3300025981 Bacteria 746
251 Ga0207658_10294663 3300025986 Bacteria 1395
252 Ga0207677_10002084 3300026023 Bacteria 10526
253 Ga0207703_10030049 3300026035 Bacteria 4292
254 Ga0207639_10469516 3300026041 Bacteria 1145
255 Ga0207639_10679570 3300026041 Bacteria 954
256 Ga0207639_11178110 3300026041 Bacteria 719
257 Ga0207678_10041652 3300026067 Bacteria 3982
258 Ga0207678_10133849 3300026067 Bacteria 2115
259 Ga0207678_10149684 3300026067 Bacteria 1992
260 Ga0207702_10020548 3300026078 Bacteria 5466
261 Ga0207702_10190785 3300026078 Bacteria 1893
262 Ga0207702_10560958 3300026078 Bacteria 1118
263 Ga0207702_10610936 3300026078 Bacteria 1070
264 Ga0207702_10993139 3300026078 Bacteria 833
265 Ga0207702_11432121 3300026078 Bacteria 685
266 Ga0207648_10123948 3300026089 Bacteria 2273
267 Ga0207674_10005284 3300026116 Bacteria 15364
268 Ga0207674_10098357 3300026116 Bacteria 2909
269 Ga0207674_10155935 3300026116 Bacteria 2239
270 Ga0207683_10077643 3300026121 Bacteria 2941
271 Ga0207698_10009478 3300026142 Bacteria 6212
272 Ga0207698_10201504 3300026142 Bacteria 1782
273 Ga0207698_10474018 3300026142 Bacteria 1213
274 Ga0207698_10555795 3300026142 Bacteria 1126
275 Ga0207698_10994191 3300026142 Bacteria 849
276 Ga0268266_10116828 3300028379 Bacteria 2370
277 Ga0268266_10927633 3300028379 Bacteria 842
278 Ga0268264_10685141 3300028381 Bacteria 1017
279 Ga0307413_10677361 3300031824 Bacteria 854
280 Ga0307414_10318833 3300032004 Bacteria 1322
281 Ga0373936_0111474 3300035113 Bacteria 1162
282 Ga0373960_0428618 3300035121 Bacteria 515
283 Ga0373943_0008932 3300035170 Bacteria 4490
284 Ga0373946_0144800 3300035171 Bacteria 1104
285 Ga0373947_0641827 3300035725 Bacteria 724
286 Ga0373925_0042611 3300037068 Bacteria 3367
287 Ga0395899_0048679 3300037312 Bacteria 3153
288 Ga0395899_0151226 3300037312 Bacteria 1645
289 Ga0395899_0153722 3300037312 Bacteria 1629
290 Ga0395899_0221482 3300037312 Bacteria 1310
291 Ga0395899_0239717 3300037312 Bacteria 1248
292 Ga0395899_0333410 3300037312 Bacteria 1019
293 Ga0395899_0609405 3300037312 Bacteria 694
294 Ga0395899_0623149 3300037312 Bacteria 685
295 Ga0395900_0000336 3300037418 Bacteria 69212
296 Ga0395900_0013525 3300037418 Bacteria 8338
297 Ga0395900_0017419 3300037418 Bacteria 7333
298 Ga0395900_0024147 3300037418 Bacteria 6223
299 Ga0395900_0031588 3300037418 Bacteria 5443
300 Ga0395900_0034608 3300037418 Bacteria 5203
301 Ga0395900_0111456 3300037418 Bacteria 2810
302 Ga0395900_0150736 3300037418 Bacteria 2375
303 Ga0395900_0174718 3300037418 Bacteria 2185
304 Ga0395900_0176060 3300037418 Bacteria 2176
305 Ga0395900_0210810 3300037418 Bacteria 1962
306 Ga0395900_0243993 3300037418 Bacteria 1801
307 Ga0395900_0293010 3300037418 Bacteria 1615
308 Ga0395900_0449624 3300037418 Bacteria 1245
309 Ga0395900_0452739 3300037418 Bacteria 1239
310 Ga0395900_0523479 3300037418 Bacteria 1133
311 Ga0395900_0631105 3300037418 Bacteria 1010
312 Ga0395900_0686087 3300037418 Bacteria 959
313 Ga0395900_0793077 3300037418 Bacteria 875
314 Ga0395900_0814275 3300037418 Bacteria 861
315 Ga0395900_1163618 3300037418 Bacteria 687
316 Ga0395900_1629397 3300037418 Bacteria 556
317 Ga0395898_0028849 3300037466 Bacteria 5562
318 Ga0395898_0127088 3300037466 Bacteria 2442
319 Ga0395898_0133154 3300037466 Bacteria 2380
320 Ga0395898_0233314 3300037466 Bacteria 1755
321 Ga0395898_0237251 3300037466 Bacteria 1739
322 Ga0395898_0435323 3300037466 Bacteria 1249
323 Ga0395905_0051937 3300037471 Bacteria 3839
324 Ga0395905_0076046 3300037471 Bacteria 3146
325 Ga0395905_0083162 3300037471 Bacteria 2999
326 Ga0395905_0083415 3300037471 Bacteria 2994
327 Ga0395905_0303007 3300037471 Bacteria 1485
328 Ga0395905_0371934 3300037471 Bacteria 1322
329 Ga0395905_0674927 3300037471 Bacteria 935
330 Ga0395905_0960586 3300037471 Bacteria 757
331 Ga0395905_1142021 3300037471 Bacteria 682
332 Ga0395905_1374348 3300037471 Bacteria 610
333 Ga0395905_1572285 3300037471 Bacteria 562
334 Ga0395905_1732282 3300037471 Bacteria 530
335 Ga0436364_0900648 3300037853 Bacteria 9522
336 Ga0395901_0052384 3300038443 Bacteria 4241
337 Ga0395901_0072747 3300038443 Bacteria 3584
338 Ga0395901_0082569 3300038443 Bacteria 3357
339 Ga0395901_0120852 3300038443 Bacteria 2753
340 Ga0395901_0291752 3300038443 Bacteria 1692
341 Ga0395901_0298819 3300038443 Bacteria 1669
342 Ga0395901_0330258 3300038443 Bacteria 1576
343 Ga0395901_0369435 3300038443 Bacteria 1478
344 Ga0395901_0555916 3300038443 Bacteria 1162
345 Ga0395901_0841053 3300038443 Bacteria 904
346 Ga0395901_1435881 3300038443 Bacteria 647
347 Ga0439462_0188534 3300042015 Bacteria 586
348 Ga0466972_0086756 3300044658 Bacteria 1487
349 Ga0466972_0306764 3300044658 Bacteria 742
350 Ga0466972_0395477 3300044658 Bacteria 648
351 Ga0466965_0636050 3300044683 Bacteria 608
352 Ga0466961_0191679 3300044693 Bacteria 1267
353 Ga0466961_0474074 3300044693 Bacteria 757
354 Ga0466961_0967197 3300044693 Bacteria 506
355 Ga0466963_0027436 3300044694 Bacteria 3646
356 Ga0466963_0037475 3300044694 Bacteria 3166
357 Ga0466963_0111975 3300044694 Bacteria 1874
358 Ga0466963_0144195 3300044694 Bacteria 1651
359 Ga0466963_0162099 3300044694 Bacteria 1556
360 Ga0466963_0203182 3300044694 Bacteria 1386
361 Ga0466963_0381842 3300044694 Bacteria 993
362 Ga0466963_0896675 3300044694 Bacteria 625
363 Ga0466964_0173930 3300044706 Bacteria 1016
364 Ga0466971_0038137 3300044719 Bacteria 2155
365 Ga0466968_0060768 3300044735 Bacteria 1629
366 Ga0466970_0013095 3300044765 Bacteria 4250
367 Ga0466970_0197924 3300044765 Bacteria 1117
368 Ga0466957_0000787 3300044842 Bacteria 16194
369 Ga0466957_0030051 3300044842 Bacteria 3243
370 Ga0466957_0065914 3300044842 Bacteria 2231
371 Ga0466957_0213449 3300044842 Bacteria 1272
372 Ga0466957_0545736 3300044842 Bacteria 807
373 Ga0466957_1342117 3300044842 Bacteria 520
374 Ga0466960_0002588 3300044901 Bacteria 6802
375 Ga0466960_0344739 3300044901 Bacteria 848
376 Ga0466959_0088396 3300045049 Bacteria 2227
377 Ga0466959_0398469 3300045049 Bacteria 936
378 Ga0466958_0030943 3300045836 Bacteria 3181
379 Ga0466958_0050619 3300045836 Bacteria 2514
380 Ga0466958_0058697 3300045836 Bacteria 2339
381 Ga0466958_0549142 3300045836 Bacteria 751
382 Ga0466958_0785906 3300045836 Bacteria 621
383 Ga0466958_0801475 3300045836 Bacteria 614
384 Ga0466967_0037232 3300045976 Bacteria 4161
385 Ga0466967_0061782 3300045976 Bacteria 3324
386 Ga0466967_0076205 3300045976 Bacteria 3016
387 Ga0466967_0217506 3300045976 Bacteria 1814
388 Ga0466967_1561214 3300045976 Bacteria 657
389 Ga0495642_0336605 3300046528 Bacteria 663
390 Ga0495598_0000405 3300046537 Bacteria 7769
391 Ga0495621_0000147 3300046539 Bacteria 15233
392 Ga0495669_0015819 3300046684 Bacteria 3229
393 Ga0495670_0000192 3300046691 Bacteria 27204
394 Ga0496101_0031651 3300048904 Bacteria 3720
395 Ga0496109_1231809 3300048912 Bacteria 685
396 Ga0496111_1017862 3300048914 Bacteria 593
397 Ga0496112_0395833 3300048915 Bacteria 1321
398 nmdc:mga09592_615509_c1 3300050508 Bacteria 929
399 Ga0466962_0106967 3300061719 Bacteria 1346
400 Ga0466962_0209083 3300061719 Bacteria 954
401 Ga0466962_0322754 3300061719 Bacteria 766
402 Ga0466962_0468625 3300061719 Bacteria 635
403 Ga0070658_10895407
404 JGI24741J21665_1005647
405 JGI24740J21852_10002142
406 JGI24740J21852_10002345
407 JGI24735J21928_10025041
408 JGI24034J26672_10106847
409 Ga0070658_10009386
410 Ga0070658_10023900
411 Ga0070658_10545300
412 Ga0070658_10653253
413 Ga0070658_10777514
414 Ga0070658_10954989
415 Ga0070676_11358028
416 Ga0070683_100039236
417 Ga0070683_100084862
418 Ga0070683_100141589
419 Ga0070683_100205955
420 Ga0070683_100337643
421 Ga0070690_100028987
422 Ga0070666_10000175
423 Ga0070680_100000406
424 Ga0070680_100002838
425 Ga0070680_100005002
426 Ga0070680_100087457
427 Ga0070680_100281712
428 Ga0070682_100120292
429 Ga0068868_100000365
430 Ga0070660_100009510
431 Ga0070660_100090774
432 Ga0070660_100114506
433 Ga0070660_100459749
434 Ga0070660_100534206
435 Ga0070660_101310371
436 Ga0070689_100493213
437 Ga0070691_10006466
438 Ga0070687_100260335
439 Ga0070661_100102287
440 Ga0070661_100119411
441 Ga0070661_100164252
442 Ga0070661_100645726
443 Ga0070661_100826319
444 Ga0070692_10127859
445 Ga0070675_100367379
446 Ga0070674_100005852
447 Ga0070673_100002439
448 Ga0070659_100030599
449 Ga0070659_100112642
450 Ga0070659_100620159
451 Ga0070659_100727184
452 Ga0070659_101023201
453 Ga0070659_101389286
454 Ga0070667_100023594
455 Ga0070714_100029406
456 Ga0070714_100235073
457 Ga0070713_100075140
458 Ga0070713_100079326
459 Ga0070710_10300234
460 Ga0070663_100221258
461 Ga0070663_100389304
462 Ga0070678_100028660
463 Ga0070662_100001943
464 Ga0070662_100071616
465 Ga0070662_100160885
466 Ga0070662_100256889
467 Ga0070662_100621296
468 Ga0070662_100848763
469 Ga0070662_101292128
470 Ga0070681_10218273
471 Ga0070681_10455594
472 Ga0070679_100040091
473 Ga0070679_100064966
474 Ga0070679_100275242
475 Ga0070679_100451700
476 Ga0070679_100594367
477 Ga0070684_100001026
478 Ga0070684_100004556
479 Ga0070684_100495339
480 Ga0068853_100016746
481 Ga0068853_100121918
482 Ga0068853_100140057
483 Ga0068853_100495767
484 Ga0070672_100392250
485 Ga0070672_100537143
486 Ga0070686_100081821
487 Ga0070665_100388557
488 Ga0070665_100500748
489 Ga0068855_100006137
490 Ga0068855_100192793
491 Ga0068855_100356097
492 Ga0068855_100780478
493 Ga0068855_100858458
494 Ga0068855_101041860
495 Ga0070664_100075187
496 Ga0070664_100200806
497 Ga0070664_100527053
498 Ga0068857_100017625
499 Ga0068857_100268201
500 Ga0068857_100377074
501 Ga0068857_100582962
502 Ga0068854_100006147
503 Ga0068854_100018383
504 Ga0068854_100251747
505 Ga0068856_100044902
506 Ga0068856_100079193
507 Ga0068856_100205148
508 Ga0068856_100360981
509 Ga0068852_100010589
510 Ga0068852_100101667
511 Ga0068852_100154406
512 Ga0068852_100197211
513 Ga0068852_100503155
514 Ga0068852_100704174
515 Ga0068852_101041756
516 Ga0068859_100118175
517 Ga0068866_10139666
518 Ga0068858_100001465
519 Ga0068860_100214188
520 Ga0070717_10022282
521 Ga0070716_100132832
522 Ga0070712_100035292
523 Ga0075427_10106350
524 Ga0097621_101306959
525 Ga0068865_100009838
526 Ga0097620_100118176
527 Ga0105240_10086436
528 Ga0105240_10789738
529 Ga0105240_11020034
530 Ga0105240_11870215
531 Ga0105245_10955768
532 Ga0114129_10436973
533 Ga0105241_11030101
534 Ga0105248_10000818
535 Ga0105238_10058464
536 Ga0105238_10131150
537 Ga0105238_10256933
538 Ga0105239_12580148
539 Ga0157373_10043793
540 Ga0157373_10047425
541 Ga0157373_10075751
542 Ga0157373_10216322
543 Ga0157373_10264227
544 Ga0157373_10312534
545 Ga0157373_10348121
546 Ga0157371_10030425
547 Ga0157371_10065575
548 Ga0157371_10088804
549 Ga0157371_10156795
550 Ga0157371_10247937
551 Ga0157371_10943866
552 Ga0157370_10010844
553 Ga0157370_10017662
554 Ga0157370_10105784
555 Ga0157370_10189950
556 Ga0157370_10283137
557 Ga0157369_10005258
558 Ga0157369_10014928
559 Ga0157369_10168045
560 Ga0157369_10322585
561 Ga0157369_10810361
562 Ga0157369_11217801
563 Ga0157374_11051104
564 Ga0157378_10078577
565 Ga0157372_10102817
566 Ga0157372_10935954
567 Ga0157372_11979213
568 Ga0182008_10153079
569 Ga0157379_10372410
570 Ga0157376_11232292
571 Ga0206353_11753332
572 Ga0207697_10498448
573 Ga0207682_10033276
574 Ga0207642_10122251
575 Ga0207680_10071469
576 Ga0207647_10119958
577 Ga0207647_10157997
578 Ga0207699_10032538
579 Ga0207645_11026576
580 Ga0207705_10000382
581 Ga0207705_10007994
582 Ga0207705_10040344
583 Ga0207705_10068498
584 Ga0207705_10599869
585 Ga0207705_11047933
586 Ga0207654_10119320
587 Ga0207654_10732574
588 Ga0207707_10124110
589 Ga0207707_10626890
590 Ga0207695_10321435
591 Ga0207693_10150089
592 Ga0207660_10000400
593 Ga0207660_10004486
594 Ga0207660_10052623
595 Ga0207660_10088476
596 Ga0207660_10158562
597 Ga0207660_10339079
598 Ga0207660_10433416
599 Ga0207657_10003169
600 Ga0207657_10107449
601 Ga0207657_10120533
602 Ga0207657_10197256
603 Ga0207657_10236847
604 Ga0207657_10494660
605 Ga0207649_10188306
606 Ga0207649_10264300
607 Ga0207649_10347187
608 Ga0207652_10103477
609 Ga0207652_10114033
610 Ga0207652_10194221
611 Ga0207652_10441361
612 Ga0207652_10461457
613 Ga0207652_10708779
614 Ga0207652_11042643
615 Ga0207687_10581252
616 Ga0207700_10066091
617 Ga0207700_10202807
618 Ga0207664_10090206
619 Ga0207664_10094488
620 Ga0207664_10103925
621 Ga0207664_11641080
622 Ga0207644_10003745
623 Ga0207644_10013778
624 Ga0207690_10040601
625 Ga0207690_10094784
626 Ga0207690_10212460
627 Ga0207690_10901026
628 Ga0207706_10000407
629 Ga0207706_10063039
630 Ga0207706_10097758
631 Ga0207706_10189581
632 Ga0207706_10769662
633 Ga0207706_11134354
634 Ga0207686_10062424
635 Ga0207669_10072640
636 Ga0207704_10005247
637 Ga0207691_10389301
638 Ga0207691_10989559
639 Ga0207711_10000193
640 Ga0207661_10038106
641 Ga0207679_10023827
642 Ga0207679_10212334
643 Ga0207667_10008859
644 Ga0207667_10105008
645 Ga0207667_10270848
646 Ga0207667_10415806
647 Ga0207667_11416601
648 Ga0207651_10010506
649 Ga0207640_10007152
650 Ga0207640_10071916
651 Ga0207640_10752721
652 Ga0207640_10971361
653 Ga0207658_10294663
654 Ga0207677_10002084
655 Ga0207703_10030049
656 Ga0207639_10469516
657 Ga0207639_10679570
658 Ga0207639_11178110
659 Ga0207678_10041652
660 Ga0207678_10133849
661 Ga0207678_10149684
662 Ga0207702_10020548
663 Ga0207702_10190785
664 Ga0207702_10560958
665 Ga0207702_10610936
666 Ga0207702_10993139
667 Ga0207702_11432121
668 Ga0207648_10123948
669 Ga0207674_10005284
670 Ga0207674_10098357
671 Ga0207674_10155935
672 Ga0207683_10077643
673 Ga0207698_10009478
674 Ga0207698_10201504
675 Ga0207698_10474018
676 Ga0207698_10555795
677 Ga0207698_10994191
678 Ga0268266_10116828
679 Ga0268266_10927633
680 Ga0268264_10685141
681 Ga0307413_10677361
682 Ga0307414_10318833
683 Ga0373936_0111474
684 Ga0373960_0428618
685 Ga0373943_0008932
686 Ga0373946_0144800
687 Ga0373947_0641827
688 Ga0373925_0042611
689 Ga0395899_0048679
690 Ga0395899_0151226
691 Ga0395899_0153722
692 Ga0395899_0221482
693 Ga0395899_0239717
694 Ga0395899_0333410
695 Ga0395899_0609405
696 Ga0395899_0623149
697 Ga0395900_0000336
698 Ga0395900_0013525
699 Ga0395900_0017419
700 Ga0395900_0024147
701 Ga0395900_0031588
702 Ga0395900_0034608
703 Ga0395900_0111456
704 Ga0395900_0150736
705 Ga0395900_0174718
706 Ga0395900_0176060
707 Ga0395900_0210810
708 Ga0395900_0243993
709 Ga0395900_0293010
710 Ga0395900_0449624
711 Ga0395900_0452739
712 Ga0395900_0523479
713 Ga0395900_0631105
714 Ga0395900_0686087
715 Ga0395900_0793077
716 Ga0395900_0814275
717 Ga0395900_1163618
718 Ga0395900_1629397
719 Ga0395898_0028849
720 Ga0395898_0127088
721 Ga0395898_0133154
722 Ga0395898_0233314
723 Ga0395898_0237251
724 Ga0395898_0435323
725 Ga0395905_0051937
726 Ga0395905_0076046
727 Ga0395905_0083162
728 Ga0395905_0083415
729 Ga0395905_0303007
730 Ga0395905_0371934
731 Ga0395905_0674927
732 Ga0395905_0960586
733 Ga0395905_1142021
734 Ga0395905_1374348
735 Ga0395905_1572285
736 Ga0395905_1732282
737 Ga0436364_0900648
738 Ga0395901_0052384
739 Ga0395901_0072747
740 Ga0395901_0082569
741 Ga0395901_0120852
742 Ga0395901_0291752
743 Ga0395901_0298819
744 Ga0395901_0330258
745 Ga0395901_0369435
746 Ga0395901_0555916
747 Ga0395901_0841053
748 Ga0395901_1435881
749 Ga0439462_0188534
750 Ga0466972_0086756
751 Ga0466972_0306764
752 Ga0466972_0395477
753 Ga0466965_0636050
754 Ga0466961_0191679
755 Ga0466961_0474074
756 Ga0466961_0967197
757 Ga0466963_0027436
758 Ga0466963_0037475
759 Ga0466963_0111975
760 Ga0466963_0144195
761 Ga0466963_0162099
762 Ga0466963_0203182
763 Ga0466963_0381842
764 Ga0466963_0896675
765 Ga0466964_0173930
766 Ga0466971_0038137
767 Ga0466968_0060768
768 Ga0466970_0013095
769 Ga0466970_0197924
770 Ga0466957_0000787
771 Ga0466957_0030051
772 Ga0466957_0065914
773 Ga0466957_0213449
774 Ga0466957_0545736
775 Ga0466957_1342117
776 Ga0466960_0002588
777 Ga0466960_0344739
778 Ga0466959_0088396
779 Ga0466959_0398469
780 Ga0466958_0030943
781 Ga0466958_0050619
782 Ga0466958_0058697
783 Ga0466958_0549142
784 Ga0466958_0785906
785 Ga0466958_0801475
786 Ga0466967_0037232
787 Ga0466967_0061782
788 Ga0466967_0076205
789 Ga0466967_0217506
790 Ga0466967_1561214
791 Ga0495642_0336605
792 Ga0495598_0000405
793 Ga0495621_0000147
794 Ga0495669_0015819
795 Ga0495670_0000192
796 Ga0496101_0031651
797 Ga0496109_1231809
798 Ga0496111_1017862
799 Ga0496112_0395833
800 nmdc:mga09592_615509_c1
801 Ga0466962_0106967
802 Ga0466962_0209083
803 Ga0466962_0322754
804 Ga0466962_0468625

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

21

83

0.97

PF01643

Acyl-ACP_TE

Acyl-ACP thioesterase N-terminal domain

4

131

0.9

PF13279

4HBT_2

Thioesterase-like superfamily

13

131

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2egi-assembly1.cif.gz_H crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus 0.9244 6 113
2egi-assembly1.cif.gz_H crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus 0.9154 6 113
5dio-assembly1.cif.gz_B-2 crystal structure of unnamed thioesterase lpg2867 from legionella pneumophila, the d21a mutant 0.9047 7 123
5dio-assembly1.cif.gz_A-2 crystal structure of unnamed thioesterase lpg2867 from legionella pneumophila, the d21a mutant 0.903 7 123
1tbu-assembly1.cif.gz_D crystal structure of n-terminal domain of yeast peroxisomal thioesterase-1 0.8947 54 112
ID Description Score Start End Superfamily
af_Q80ZW2_46_168_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9271 5 112 3.10.129.10
2egiH00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9244 6 113 3.10.129.10
5eo2A01 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9158 3 109 3.10.129.10
2egiH00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9154 6 113 3.10.129.10
5dioB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9047 7 123 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A1Y2QRU0-F1-model_v4 Thioesterase 0.9861 5 130
AF-A0A2D4Y2R4-F1-model_v4 deleted 0.9827 6 130
AF-A0A1B6ZBT6-F1-model_v4 Thioesterase 0.9808 5 131 GO:0047617
AF-A0A437M194-F1-model_v4 Acyl-CoA thioesterase 0.9807 3 132 GO:0006633
GO:0016790
AF-A0A840HSX7-F1-model_v4 Acyl-CoA thioester hydrolase (EC 3.1.2.-) 0.9799 3 131 GO:0047617

Map