F434985

General Info

Members Datasets Scaffolds Average Seq Length
401 256 353 320

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2816332133|2816475592
Length 370
Sequence GGVFGGRQEPQRGGAVHWPCRHCRSQGLQGLAPTALKDWQVALDNGPMPINELRSITTFARTAELGSLRKAAAAQGITPQAASQALVQLEQHLGVRLFHRTTRSMSLTDEGRQFLEAALPPLAGLQRALEITRRAKDEIGGPLRIVGPRSVFAPVLWSLLDEFCTRHPEVQPDVQLDDRIGNWVEDRVDVGFRIGRSAAEGVVARRLFPLQLIVCASPAYLRRHGAPDNLGALTNHRCSVFRSPGTGRVMPWRMKVADSVVEQPMLPALCVNDEVLETDAVLAGHVLGLLSGVAAAAHIRAGRLVPLLTDHVDDQSSAFVYYGSRSAQPLRVRAFIELAVQRLADTPDYVLTGEELAAAEARGRKAARRK

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2547132374 Acidovorax radicis N35 Isolate Unclassified
3 2547132512 Azospira oryzae 6a3 Isolate Unclassified
4 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
5 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
6 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
7 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
8 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
9 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
10 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
11 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
12 2643221570 Acidovorax sp. Root568 Isolate Unclassified
13 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
14 2643221596 Acidovorax sp. Root70 Isolate Unclassified
15 2643221609 Acidovorax sp. Root217 Isolate Unclassified
16 2643221611 Acidovorax sp. Root219 Isolate Unclassified
17 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
18 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
19 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
20 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
21 2643221652 Acidovorax sp. Root402 Isolate Unclassified
22 2643221717 Acidovorax sp. Root267 Isolate Unclassified
23 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
24 2721755523 Delftia sp. HK171 Isolate Unclassified
25 2738541277 Variovorax sp. GV051 Isolate Unclassified
26 2738541307 Variovorax sp. GV008 Isolate Unclassified
27 2738541337 Pelomonas sp. BT06 Isolate Unclassified
28 2738543012 Acidovorax sp. CF301 Isolate Unclassified
29 2738543019 Variovorax sp. GV040 Isolate Unclassified
30 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
31 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
32 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
33 2816332133 Acidovorax radicis 2721A Isolate Unclassified
34 2831864461 Roseateles noduli HZ7 Isolate Nodule
35 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
36 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
37 2842733646 Variovorax sp. R-72446 Isolate Unclassified
38 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
39 2885198086 Variovorax sp. 679 Isolate Unclassified
40 2885211737 Variovorax sp. 553 Isolate Unclassified
41 2928070936 Variovorax gossypii 1167 Isolate Unclassified
42 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
43 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
44 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
45 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
46 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
47 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
48 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
49 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
50 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
51 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
52 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
53 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
54 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
55 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
56 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
57 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
58 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
59 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
60 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
61 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
62 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
63 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
64 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
65 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
66 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
67 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
68 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
69 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
70 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
71 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
72 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
73 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
74 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
75 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
84 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
99 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
100 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
104 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
105 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
106 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
108 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
116 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
119 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
138 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
139 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
140 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
141 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
142 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
145 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
146 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
154 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
158 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
159 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
160 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
161 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
162 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
163 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
164 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
165 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
166 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
167 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
168 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
169 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
170 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
171 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
172 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
173 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
174 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
175 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
176 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
177 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
178 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
179 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
180 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
181 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
182 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
183 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
184 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
185 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
186 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
187 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
188 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
189 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
192 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
193 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
194 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
195 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
196 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
197 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
198 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
199 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
200 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
201 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
202 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
203 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
204 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
205 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
206 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
211 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
212 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
213 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
214 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
215 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
216 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
217 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
218 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
221 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
222 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
223 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
224 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
225 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
228 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
229 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
230 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
231 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
232 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
233 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
234 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
235 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
236 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
237 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
238 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
239 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
240 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
241 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
242 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
243 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
244 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
245 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
246 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
247 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
248 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
249 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
250 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
251 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
252 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
253 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
254 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
255 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
256 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.03
Metatranscriptomes 0
Isolates 11.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.93
Nodule 0.75
Rhizoplane 1.75
Rhizosphere 43.39
Stem 0
Stem Tuber 0
Unclassified 26.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000057 3300002704 Bacteria 72575
2 JGI25156J39149_1000073 3300002705 Bacteria 77465
3 JGI25156J39149_1000412 3300002705 Bacteria 26731
4 JGI25154J39366_1000097 3300002738 Bacteria 77399
5 JGI25157J39369_1000089 3300002741 Bacteria 77465
6 JGI25159J45721_1000385 3300002987 Bacteria 20489
7 JGI25159J45721_1006537 3300002987 Bacteria 3474
8 JGI25151J46595_10003208 3300003187 Bacteria 9161
9 JGI25151J46595_10039487 3300003187 Bacteria 1742
10 rootL2_10021407 3300003322 Bacteria 4094
11 rootL2_10021640 3300003322 Bacteria 13443
12 rootL2_10044200 3300003322 Bacteria 3938
13 rootL2_10105792 3300003322 Bacteria 1925
14 rootH1_10028834 3300003323 Bacteria 8622
15 rootH1_10204873 3300003323 Bacteria 1729
16 JGI25160J50197_1000584 3300003354 Bacteria 20489
17 JGI25161J50226_1000173 3300003374 Bacteria 43112
18 Ga0055539_1000174 3300003752 Bacteria 54849
19 Ga0055533_1000011 3300003756 Bacteria 467893
20 Ga0055525_1000607 3300003759 Bacteria 15117
21 Ga0055526_1003043 3300003771 Bacteria 10896
22 Ga0055537_1000366 3300003773 Bacteria 30767
23 Ga0055524_1000264 3300003775 Bacteria 52840
24 Ga0055534_1009337 3300003784 Bacteria 2139
25 Ga0055528_1007389 3300003790 Bacteria 4863
26 Ga0055530_10003736 3300003791 Bacteria 8436
27 Ga0055530_10008534 3300003791 Bacteria 4088
28 Ga0055540_1000264 3300003792 Bacteria 47407
29 Ga0055531_10000443 3300003794 Bacteria 38774
30 Ga0055543_1001001 3300004625 Bacteria 12679
31 Ga0065165_1001129 3300005262 Bacteria 31369
32 Ga0065165_1002743 3300005262 Bacteria 14058
33 Ga0065704_10075365 3300005289 Bacteria 5633
34 Ga0070670_100022026 3300005331 Bacteria 5483
35 Ga0070670_100272375 3300005331 Bacteria 1477
36 Ga0070682_100044448 3300005337 Bacteria 2750
37 Ga0070661_100162153 3300005344 Bacteria 1694
38 Ga0070673_100165072 3300005364 Bacteria 1886
39 Ga0070667_100094387 3300005367 Bacteria 2577
40 Ga0070663_100173785 3300005455 Bacteria 1667
41 Ga0070678_100312405 3300005456 Bacteria 1339
42 Ga0070672_100083533 3300005543 Bacteria 2563
43 Ga0070672_100096672 3300005543 Bacteria 2390
44 Ga0070665_100050103 3300005548 Bacteria 4190
45 Ga0070665_100324114 3300005548 Bacteria 1545
46 Ga0068855_100009096 3300005563 Bacteria 12004
47 Ga0070664_100136737 3300005564 Bacteria 2155
48 Ga0068863_100200787 3300005841 Bacteria 1918
49 Ga0075363_100009079 3300006048 Bacteria 4666
50 Ga0075363_100029947 3300006048 Bacteria 2814
51 Ga0075364_10002946 3300006051 Bacteria 9598
52 Ga0075432_10000485 3300006058 Bacteria 11865
53 Ga0075362_10001544 3300006177 Bacteria 7426
54 Ga0075366_10003043 3300006195 Bacteria 8753
55 Ga0075366_10009739 3300006195 Bacteria 5372
56 Ga0075366_10087712 3300006195 Bacteria 1863
57 Ga0075370_10008336 3300006353 Bacteria 5329
58 Ga0075434_100064464 3300006871 Bacteria 3648
59 Ga0079104_1000007 3300006946 Bacteria 390531
60 Ga0075435_100279108 3300007076 Bacteria 1426
61 Ga0105244_10000056 3300009036 Bacteria 130022
62 Ga0105240_10005357 3300009093 Bacteria 19140
63 Ga0105243_10001502 3300009148 Bacteria 20406
64 Ga0105248_10009543 3300009177 Bacteria 10680
65 Ga0105248_10036502 3300009177 Bacteria 5497
66 Ga0157373_10016380 3300013100 Bacteria 5409
67 Ga0157370_10087025 3300013104 Bacteria 2935
68 Ga0182008_10000075 3300014497 Bacteria 77531
69 Ga0163161_10048883 3300017792 Bacteria 3056
70 Ga0163161_10176733 3300017792 Bacteria 1635
71 Ga0213872_10001827 3300021361 Bacteria 13205
72 Ga0213872_10025756 3300021361 Bacteria 2703
73 Ga0209435_100008 3300025206 Bacteria 503644
74 Ga0209674_100003 3300025226 Bacteria 2196646
75 Ga0209563_100010 3300025230 Bacteria 1337457
76 Ga0207427_101456 3300025231 Bacteria 8526
77 Ga0207425_1003288 3300025245 Bacteria 5248
78 Ga0209646_1000029 3300025246 Bacteria 386414
79 Ga0209026_1000016 3300025250 Bacteria 386457
80 Ga0209677_100083 3300025253 Bacteria 117063
81 Ga0209759_1000016 3300025256 Bacteria 386414
82 Ga0209759_1000739 3300025256 Bacteria 28453
83 Ga0209565_1000041 3300025263 Bacteria 251081
84 Ga0209673_1000012 3300025273 Bacteria 579480
85 Ga0209673_1005494 3300025273 Bacteria 6353
86 Ga0209130_1000014 3300025284 Bacteria 412039
87 Ga0209130_1001388 3300025284 Bacteria 16276
88 Ga0209675_1000856 3300025291 Bacteria 19729
89 Ga0209675_1006302 3300025291 Bacteria 4789
90 Ga0209675_1008906 3300025291 Bacteria 3609
91 Ga0209676_1000013 3300025292 Bacteria 816080
92 Ga0209676_1004860 3300025292 Bacteria 7279
93 Ga0209025_1004661 3300025294 Bacteria 11725
94 Ga0209025_1005839 3300025294 Bacteria 9854
95 Ga0209025_1044736 3300025294 Bacteria 1845
96 Ga0209564_1001460 3300025295 Bacteria 24001
97 Ga0209564_1013290 3300025295 Bacteria 3513
98 Ga0209758_1013005 3300025297 Bacteria 4590
99 Ga0209050_1000008 3300025298 Bacteria 1144179
100 Ga0209050_1001381 3300025298 Bacteria 26455
101 Ga0209050_1005285 3300025298 Bacteria 8214
102 Ga0209050_1018902 3300025298 Bacteria 2651
103 Ga0209050_1024060 3300025298 Bacteria 2121
104 Ga0209256_1000039 3300025299 Bacteria 372337
105 Ga0207426_1000174 3300025302 Bacteria 160877
106 Ga0207426_1003342 3300025302 Bacteria 8839
107 Ga0209051_1000005 3300025303 Bacteria 1142353
108 Ga0209257_1000031 3300025304 Bacteria 688770
109 Ga0209257_1000117 3300025304 Bacteria 227328
110 Ga0209257_1007077 3300025304 Bacteria 6926
111 Ga0207655_1000288 3300025728 Bacteria 76899
112 Ga0207682_10007256 3300025893 Bacteria 4426
113 Ga0207695_10000301 3300025913 Bacteria 121221
114 Ga0207695_10008174 3300025913 Bacteria 13145
115 Ga0207695_10016563 3300025913 Bacteria 8618
116 Ga0207650_10241164 3300025925 Bacteria 1461
117 Ga0207644_10045866 3300025931 Bacteria 3111
118 Ga0207644_10104476 3300025931 Bacteria 2133
119 Ga0207706_10021567 3300025933 Bacteria 5783
120 Ga0207709_10000112 3300025935 Bacteria 127357
121 Ga0207691_10006643 3300025940 Bacteria 11162
122 Ga0207691_10360979 3300025940 Bacteria 1242
123 Ga0207711_10035680 3300025941 Bacteria 4217
124 Ga0207711_10089921 3300025941 Bacteria 2698
125 Ga0207667_10023430 3300025949 Bacteria 6798
126 Ga0207641_10173889 3300026088 Bacteria 1968
127 Ga0207648_10422328 3300026089 Bacteria 1211
128 Ga0207648_10492820 3300026089 Bacteria 1120
129 Ga0207683_10087367 3300026121 Bacteria 2773
130 Ga0207683_10154692 3300026121 Bacteria 2071
131 Ga0209281_1000020 3300027111 Bacteria 575972
132 Ga0207428_10132849 3300027907 Bacteria 1904
133 Ga0268266_10075740 3300028379 Bacteria 2923
134 Ga0307517_10000395 3300028786 Bacteria 74663
135 Ga0307515_10000618 3300028794 Bacteria 83065
136 Ga0307515_10003269 3300028794 Bacteria 34269
137 Ga0307515_10006977 3300028794 Bacteria 22434
138 Ga0307515_10020113 3300028794 Bacteria 11942
139 Ga0307515_10029894 3300028794 Bacteria 9182
140 Ga0307515_10038152 3300028794 Bacteria 7696
141 Ga0307515_10049677 3300028794 Bacteria 6301
142 Ga0307515_10154445 3300028794 Bacteria 2378
143 Ga0307515_10170350 3300028794 Bacteria 2173
144 Ga0307512_10018137 3300030522 Bacteria 6436
145 Ga0307512_10022753 3300030522 Bacteria 5619
146 Ga0265332_10000132 3300031238 Bacteria 62297
147 Ga0265332_10087676 3300031238 Bacteria 1317
148 Ga0307513_10000008 3300031456 Bacteria 442128
149 Ga0307513_10000037 3300031456 Bacteria 175364
150 Ga0307513_10016021 3300031456 Bacteria 9060
151 Ga0307513_10063853 3300031456 Bacteria 3884
152 Ga0307513_10100324 3300031456 Bacteria 2921
153 Ga0307513_10138067 3300031456 Bacteria 2369
154 Ga0307513_10288828 3300031456 Bacteria 1413
155 Ga0307509_10037572 3300031507 Bacteria 5292
156 Ga0307509_10327338 3300031507 Bacteria 1266
157 Ga0307408_100000117 3300031548 Bacteria 87442
158 Ga0307408_100002052 3300031548 Bacteria 14494
159 Ga0307508_10000254 3300031616 Bacteria 65091
160 Ga0307508_10003099 3300031616 Bacteria 17064
161 Ga0307514_10031044 3300031649 Bacteria 4285
162 Ga0307514_10041949 3300031649 Bacteria 3601
163 Ga0307516_10011266 3300031730 Bacteria 9744
164 Ga0307516_10122944 3300031730 Bacteria 2382
165 Ga0307516_10265568 3300031730 Bacteria 1405
166 Ga0307405_10115364 3300031731 Bacteria 1827
167 Ga0307413_10084602 3300031824 Bacteria 2045
168 Ga0307410_10025344 3300031852 Bacteria 3720
169 Ga0307406_10000220 3300031901 Bacteria 34643
170 Ga0307406_10008445 3300031901 Bacteria 5745
171 Ga0307407_10048431 3300031903 Bacteria 2419
172 Ga0307416_100197185 3300032002 Bacteria 1906
173 Ga0307510_10000038 3300033180 Bacteria 106256
174 Ga0307510_10061521 3300033180 Bacteria 3848
175 Ga0373934_0011956 3300035086 Bacteria 3274
176 Ga0373937_0150794 3300036401 Bacteria 2178
177 Ga0395905_0008952 3300037471 Bacteria 9825
178 Ga0436361_0495680 3300039447 Bacteria 3412
179 Ga0436361_0914613 3300039447 Bacteria 28796
180 Ga0451853_3882237 3300041512 Bacteria 1310
181 Ga0466969_0090651 3300044656 Bacteria 1449
182 Ga0495627_004860 3300046453 Bacteria 5532
183 Ga0495627_015653 3300046453 Bacteria 2613
184 Ga0495627_023769 3300046453 Bacteria 2004
185 Ga0495592_0000021 3300046454 Bacteria 140462
186 Ga0495592_0059575 3300046454 Bacteria 2811
187 Ga0495590_0033598 3300046457 Bacteria 1793
188 Ga0495638_0000058 3300046460 Bacteria 192656
189 Ga0495638_0013008 3300046460 Bacteria 5683
190 Ga0495638_0071282 3300046460 Bacteria 2126
191 Ga0495650_0000027 3300046471 Bacteria 475071
192 Ga0495650_0000510 3300046471 Bacteria 57886
193 Ga0495605_0003782 3300046474 Bacteria 8982
194 Ga0495605_0023935 3300046474 Bacteria 3203
195 Ga0495605_0141946 3300046474 Unclassified 1077
196 Ga0495584_0000306 3300046491 Bacteria 34682
197 Ga0495584_0013846 3300046491 Bacteria 4110
198 Ga0495584_0045943 3300046491 Bacteria 2203
199 Ga0495607_0003257 3300046501 Bacteria 12488
200 Ga0495583_0000014 3300046506 Bacteria 320136
201 Ga0495583_0000093 3300046506 Bacteria 158708
202 Ga0495583_0002339 3300046506 Bacteria 16462
203 Ga0495583_0022531 3300046506 Bacteria 3210
204 Ga0495610_0000963 3300046512 Bacteria 26633
205 Ga0495616_0000779 3300046513 Bacteria 23301
206 Ga0495616_0008406 3300046513 Bacteria 6117
207 Ga0495616_0076652 3300046513 Bacteria 1606
208 Ga0495620_0020056 3300046515 Bacteria 3272
209 Ga0495628_0050279 3300046516 Bacteria 3298
210 Ga0495631_0009791 3300046518 Bacteria 4773
211 Ga0495632_0005536 3300046519 Bacteria 8326
212 Ga0495637_0007625 3300046520 Bacteria 5356
213 Ga0495637_0040601 3300046520 Bacteria 2002
214 Ga0495643_0029262 3300046522 Bacteria 3083
215 Ga0495644_0000156 3300046523 Bacteria 32480
216 Ga0495644_0000695 3300046523 Bacteria 13941
217 Ga0495648_0000082 3300046524 Bacteria 123682
218 Ga0495648_0000653 3300046524 Bacteria 37038
219 Ga0495648_0001000 3300046524 Bacteria 29021
220 Ga0495648_0123700 3300046524 Bacteria 1386
221 Ga0495642_0010477 3300046528 Bacteria 3551
222 Ga0495654_0010514 3300046530 Bacteria 5034
223 Ga0495609_0000690 3300046538 Bacteria 26016
224 Ga0495609_0011437 3300046538 Bacteria 4226
225 Ga0495609_0021237 3300046538 Bacteria 2995
226 Ga0495621_0123193 3300046539 Bacteria 1003
227 Ga0495622_0047053 3300046557 Bacteria 2005
228 Ga0495633_0000214 3300046558 Bacteria 72530
229 Ga0495633_0067079 3300046558 Bacteria 1676
230 Ga0495656_0015442 3300046615 Bacteria 2882
231 Ga0495656_0015498 3300046615 Bacteria 2878
232 Ga0495656_0026225 3300046615 Bacteria 2318
233 Ga0495611_0001169 3300046648 Bacteria 13683
234 Ga0495611_0001316 3300046648 Bacteria 12633
235 Ga0495625_0000728 3300046660 Bacteria 46253
236 Ga0495625_0006294 3300046660 Bacteria 10616
237 Ga0495625_0009208 3300046660 Bacteria 8292
238 Ga0495625_0011624 3300046660 Bacteria 7161
239 Ga0495625_0043455 3300046660 Bacteria 3258
240 Ga0495659_0003028 3300046664 Bacteria 5391
241 Ga0495659_0011958 3300046664 Bacteria 2801
242 Ga0495659_0053771 3300046664 Bacteria 1472
243 Ga0495661_0051093 3300046665 Bacteria 2498
244 Ga0495658_0010856 3300046683 Bacteria 4562
245 Ga0495669_0019655 3300046684 Bacteria 2917
246 Ga0495624_0127799 3300046690 Bacteria 1559
247 Ga0495670_0005427 3300046691 Bacteria 6259
248 Ga0495671_0000418 3300046692 Bacteria 33868
249 Ga0495671_0011715 3300046692 Bacteria 4809
250 Ga0495671_0015596 3300046692 Bacteria 4067
251 Ga0495660_0157568 3300046810 Unclassified 1116
252 Ga0495636_0072704 3300047318 Bacteria 1470
253 Ga0495672_0000372 3300047320 Bacteria 55920
254 Ga0495672_0015028 3300047320 Bacteria 5271
255 Ga0495676_0014615 3300047321 Bacteria 7020
256 Ga0495683_0010535 3300047323 Bacteria 4880
257 Ga0495687_000334 3300047443 Bacteria 60345
258 Ga0495687_000982 3300047443 Bacteria 28711
259 Ga0495687_045225 3300047443 Bacteria 1907
260 Ga0495677_0004037 3300047445 Bacteria 5666
261 Ga0495685_000002 3300047447 Bacteria 132680
262 Ga0495681_0034907 3300047470 Bacteria 2501
263 Ga0495686_0035676 3300047472 Bacteria 3195
264 Ga0495593_0007093 3300047673 Bacteria 6571
265 Ga0495614_0005859 3300048089 Bacteria 5536
266 Ga0496101_0002787 3300048904 Bacteria 10718
267 Ga0496101_0142400 3300048904 Bacteria 1828
268 Ga0496107_0146898 3300048910 Bacteria 1743
269 Ga0496113_0316052 3300048916 Bacteria 1251
270 Ga0496116_0037718 3300048919 Bacteria 3366
271 Ga0496117_0006927 3300048920 Bacteria 11234
272 Ga0496117_0022306 3300048920 Bacteria 5082
273 Ga0496118_0000880 3300048921 Bacteria 47321
274 Ga0496118_0000955 3300048921 Bacteria 45248
275 Ga0496118_0006542 3300048921 Bacteria 12745
276 Ga0496119_0000131 3300048922 Bacteria 105813
277 Ga0496119_0014228 3300048922 Bacteria 6249
278 Ga0496120_0000845 3300048923 Bacteria 43524
279 Ga0496120_0010930 3300048923 Bacteria 6280
280 Ga0496121_0003101 3300048924 Bacteria 24033
281 Ga0496121_0016229 3300048924 Bacteria 7706
282 Ga0496121_0035215 3300048924 Bacteria 4491
283 Ga0496121_0056436 3300048924 Bacteria 3262
284 Ga0496121_0095220 3300048924 Bacteria 2314
285 Ga0496121_0126070 3300048924 Bacteria 1924
286 Ga0496122_0014595 3300048925 Bacteria 7582
287 Ga0496122_0055554 3300048925 Bacteria 2961
288 Ga0496122_0078310 3300048925 Bacteria 2316
289 Ga0496123_0020803 3300048926 Bacteria 5120
290 Ga0496123_0045437 3300048926 Bacteria 2992
291 Ga0496123_0053366 3300048926 Bacteria 2672
292 Ga0496125_0000812 3300048928 Bacteria 50762
293 Ga0496125_0002073 3300048928 Bacteria 27064
294 Ga0496125_0006842 3300048928 Bacteria 12225
295 Ga0496125_0048786 3300048928 Bacteria 3526
296 Ga0496125_0080854 3300048928 Bacteria 2485
297 Ga0496126_0000925 3300048929 Bacteria 50764
298 Ga0496126_0002988 3300048929 Bacteria 21956
299 Ga0496126_0113674 3300048929 Bacteria 2356
300 Ga0495678_000689 3300049459 Bacteria 30888
301 Ga0495678_051079 3300049459 Unclassified 1599
302 Ga0495682_0000706 3300049460 Bacteria 21870
303 Ga0495682_0001810 3300049460 Bacteria 10765
304 nmdc:mga03683_10037_c1 3300050489 Bacteria 3385
305 nmdc:mga03n38_110589_c1 3300050490 Bacteria 1337
306 nmdc:mga03n38_450_c1 3300050490 Bacteria 10274
307 nmdc:mga03n38_86513_c1 3300050490 Bacteria 1483
308 nmdc:mga00v17_177994_c1 3300050491 Bacteria 1372
309 nmdc:mga00v17_20532_c1 3300050491 Bacteria 3786
310 nmdc:mga0k408_13829_c1 3300050493 Bacteria 4434
311 nmdc:mga0k408_243909_c1 3300050493 Bacteria 1073
312 nmdc:mga0k408_95_c1 3300050493 Bacteria 37179
313 nmdc:mga0rr50_29903_c1 3300050513 Bacteria 3848
314 Ga0500610_0001484 3300053079 Bacteria 8016
315 Ga0500610_0160220 3300053079 Bacteria 1120
316 Ga0500643_005455 3300053087 Bacteria 5481
317 Ga0500644_0027960 3300053088 Bacteria 1759
318 Ga0500644_0053090 3300053088 Bacteria 1398
319 Ga0500651_0000234 3300053093 Bacteria 34517
320 Ga0500560_072032 3300053107 Bacteria 1140
321 Ga0500562_002723 3300053108 Bacteria 4397
322 Ga0500571_000076 3300053110 Bacteria 30903
323 Ga0500593_000332 3300053117 Bacteria 19012
324 Ga0500593_007680 3300053117 Bacteria 4402
325 Ga0500594_0051438 3300053118 Bacteria 1161
326 Ga0500595_052092 3300053119 Bacteria 1265
327 Ga0500607_003258 3300053121 Bacteria 11988
328 Ga0500608_060184 3300053122 Bacteria 1816
329 Ga0500618_001065 3300053125 Bacteria 13588
330 Ga0500618_020034 3300053125 Bacteria 1642
331 Ga0500655_000742 3300053133 Bacteria 6453
332 Ga0500658_0000096 3300053134 Bacteria 40172
333 Ga0500658_0000100 3300053134 Bacteria 39487
334 Ga0500559_0000441 3300053136 Bacteria 29453
335 Ga0500559_0005742 3300053136 Bacteria 5667
336 Ga0500559_0017105 3300053136 Bacteria 3062
337 Ga0500559_0023899 3300053136 Bacteria 2596
338 Ga0500564_010595 3300053138 Bacteria 4046
339 Ga0500568_0032731 3300053139 Bacteria 2136
340 Ga0500573_0137444 3300053140 Bacteria 1348
341 Ga0500574_014108 3300053141 Bacteria 1876
342 Ga0500590_000338 3300053148 Bacteria 15298
343 Ga0500622_0008053 3300053156 Bacteria 5929
344 Ga0500624_005490 3300053157 Bacteria 1687
345 Ga0500627_0000769 3300053158 Bacteria 8543
346 Ga0500634_0009687 3300053161 Bacteria 4893
347 Ga0500634_0019673 3300053161 Bacteria 3640
348 Ga0500634_0036571 3300053161 Bacteria 2673
349 Ga0500638_032021 3300053162 Bacteria 2538
350 Ga0500636_0002564 3300053177 Bacteria 10104
351 Ga0500645_005687 3300053730 Bacteria 4552
352 Ga0500645_013207 3300053730 Bacteria 2656
353 Ga0500596_013952 3300053735 Bacteria 1211

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053140 Ga0500573_0137444 Ga0500573_0137444_532_1329 256
2 3300053735 Ga0500596_013952 Ga0500596_013952_12_818 261
3 3300046518 Ga0495631_0009791 Ga0495631_0009791_3815_4699 281
4 3300046539 Ga0495621_0123193 Ga0495621_0123193_109_993 281
5 3300053093 Ga0500651_0000234 Ga0500651_0000234_33595_34485 283
6 3300046453 Ga0495627_023769 Ga0495627_023769_560_1531 288
7 3300028794 Ga0307515_10006977 Ga0307515_1000697723 290
8 3300028794 Ga0307515_10170350 Ga0307515_101703503 291
9 3300003322 rootL2_10105792 rootL2_101057922 292
10 3300003323 rootH1_10204873 rootH1_102048731 292
11 3300005337 Ga0070682_100044448 Ga0070682_1000444482 292
12 3300046471 Ga0495650_0000027 Ga0495650_0000027_227408_228373 292
13 3300002987 JGI25159J45721_1000385 JGI25159J45721_10003858 293
14 3300003354 JGI25160J50197_1000584 JGI25160J50197_10005848 293
15 3300003374 JGI25161J50226_1000173 JGI25161J50226_100017337 293
16 3300004625 Ga0055543_1001001 Ga0055543_10010018 293
17 3300025284 Ga0209130_1000014 Ga0209130_1000014327 293
18 3300025298 Ga0209050_1024060 Ga0209050_10240601 293
19 3300025302 Ga0207426_1000174 Ga0207426_100017464 293
20 3300050489 nmdc:mga03683_10037_c1 nmdc:mga03683_10037_c1_74_976 293
21 iso_pu_bacteria 2863421361 2863425986 294
22 iso_pu_bacteria 2981990288 2981990658 294
23 3300003187 JGI25151J46595_10003208 JGI25151J46595_100032083 295
24 3300025291 Ga0209675_1008906 Ga0209675_10089061 295
25 3300025292 Ga0209676_1004860 Ga0209676_10048603 295
26 3300025294 Ga0209025_1004661 Ga0209025_10046614 295
27 3300025295 Ga0209564_1013290 Ga0209564_10132903 295
28 3300025304 Ga0209257_1007077 Ga0209257_10070775 295
29 3300046522 Ga0495643_0029262 Ga0495643_0029262_1744_2721 296
30 3300017792 Ga0163161_10176733 Ga0163161_101767332 297
31 3300025940 Ga0207691_10360979 Ga0207691_103609791 297
32 3300046454 Ga0495592_0059575 Ga0495592_0059575_965_1945 297
33 3300046615 Ga0495656_0026225 Ga0495656_0026225_977_1942 297
34 3300053148 Ga0500590_000338 Ga0500590_000338_6647_7627 297
35 3300005563 Ga0068855_100009096 Ga0068855_1000090965 298
36 3300025949 Ga0207667_10023430 Ga0207667_100234306 298
37 3300033180 Ga0307510_10000038 Ga0307510_1000003871 298
38 3300044656 Ga0466969_0090651 Ga0466969_0090651_109_1041 298
39 iso_pu_bacteria 2834641062 2834645279 298
40 iso_pu_bacteria 8003400568 8003403515 298
41 3300048920 Ga0496117_0006927 Ga0496117_0006927_4300_5259 299
42 3300048921 Ga0496118_0006542 Ga0496118_0006542_5927_6886 299
43 3300048922 Ga0496119_0014228 Ga0496119_0014228_946_1905 299
44 3300048923 Ga0496120_0010930 Ga0496120_0010930_1203_2162 299
45 3300048928 Ga0496125_0002073 Ga0496125_0002073_13538_14497 299
46 3300013104 Ga0157370_10087025 Ga0157370_100870253 300
47 3300028794 Ga0307515_10020113 Ga0307515_100201136 301
48 3300031456 Ga0307513_10288828 Ga0307513_102888282 301
49 3300035086 Ga0373934_0011956 Ga0373934_0011956_543_1514 301
50 3300005548 Ga0070665_100050103 Ga0070665_1000501032 302
51 3300014497 Ga0182008_10000075 Ga0182008_100000757 302
52 3300028379 Ga0268266_10075740 Ga0268266_100757404 302
53 3300031456 Ga0307513_10138067 Ga0307513_101380673 302
54 3300053136 Ga0500559_0017105 Ga0500559_0017105_1569_2546 302
55 iso_pu_bacteria 2511231003 2511249513 303
56 3300031730 Ga0307516_10011266 Ga0307516_100112667 304
57 3300003794 Ga0055531_10000443 Ga0055531_1000044316 305
58 3300025298 Ga0209050_1018902 Ga0209050_10189022 305
59 3300025304 Ga0209257_1000117 Ga0209257_100011733 305
60 3300041512 Ga0451853_3882237 Ga0451853_3882237_191_1165 305
61 3300046506 Ga0495583_0002339 Ga0495583_0002339_3830_4801 305
62 3300006048 Ga0075363_100029947 Ga0075363_1000299472 306
63 3300050490 nmdc:mga03n38_86513_c1 nmdc:mga03n38_86513_c1_188_1213 306
64 iso_pu_bacteria 2547132512 2548848264 306
65 iso_pu_bacteria 2643221639 2644219090 306
66 iso_pu_bacteria 2643221646 2644255605 306
67 iso_pu_bacteria 2808606384 2808968834 306
68 iso_pu_bacteria 2808606390 2809003665 306
69 iso_pu_bacteria 2808606391 2809010942 306
70 3300005262 Ga0065165_1002743 Ga0065165_10027431 307
71 3300005331 Ga0070670_100272375 Ga0070670_1002723752 307
72 3300009036 Ga0105244_10000056 Ga0105244_1000005666 307
73 3300009093 Ga0105240_10005357 Ga0105240_100053577 307
74 3300025728 Ga0207655_1000288 Ga0207655_100028816 307
75 3300025913 Ga0207695_10008174 Ga0207695_100081746 307
76 3300025925 Ga0207650_10241164 Ga0207650_102411641 307
77 3300031456 Ga0307513_10063853 Ga0307513_100638532 307
78 3300046520 Ga0495637_0040601 Ga0495637_0040601_887_1858 307
79 3300048924 Ga0496121_0035215 Ga0496121_0035215_2686_3627 307
80 3300053079 Ga0500610_0160220 Ga0500610_0160220_138_1109 307
81 3300053088 Ga0500644_0027960 Ga0500644_0027960_170_1138 307
82 3300053125 Ga0500618_001065 Ga0500618_001065_1652_2593 307
83 3300053136 Ga0500559_0000441 Ga0500559_0000441_18975_19943 307
84 iso_pu_bacteria 2643221592 2643968289 307
85 iso_pu_bacteria 2643221625 2644143558 307
86 iso_pu_bacteria 2643221648 2644272067 307
87 iso_pu_bacteria 2721755523 2722883263 307
88 iso_pu_bacteria 2738541337 2739054071 307
89 iso_pu_bacteria 2839138175 2839142818 307
90 3300003791 Ga0055530_10008534 Ga0055530_100085343 308
91 3300025298 Ga0209050_1001381 Ga0209050_100138119 308
92 3300048925 Ga0496122_0014595 Ga0496122_0014595_2557_3501 308
93 3300048925 Ga0496122_0055554 Ga0496122_0055554_756_1700 308
94 3300048926 Ga0496123_0020803 Ga0496123_0020803_1459_2403 308
95 3300048928 Ga0496125_0000812 Ga0496125_0000812_2695_3639 308
96 3300048929 Ga0496126_0113674 Ga0496126_0113674_422_1366 308
97 3300053157 Ga0500624_005490 Ga0500624_005490_96_1061 308
98 iso_pu_bacteria 2599185214 2599620628 308
99 iso_pu_bacteria 2599185226 2599673927 308
100 iso_pu_bacteria 2599185227 2599678756 308
101 iso_pu_bacteria 2599185229 2599690139 308
102 iso_pu_bacteria 2643221609 2644058301 308
103 iso_pu_bacteria 2643221611 2644073353 308
104 iso_pu_bacteria 2928070936 2928073336 308
105 3300003322 rootL2_10044200 rootL2_100442002 309
106 3300021361 Ga0213872_10001827 Ga0213872_100018273 309
107 3300028794 Ga0307515_10003269 Ga0307515_1000326932 309
108 3300028794 Ga0307515_10029894 Ga0307515_100298945 309
109 3300030522 Ga0307512_10022753 Ga0307512_100227533 309
110 3300031238 Ga0265332_10087676 Ga0265332_100876762 309
111 3300031507 Ga0307509_10327338 Ga0307509_103273381 309
112 3300031616 Ga0307508_10000254 Ga0307508_1000025442 309
113 3300031649 Ga0307514_10031044 Ga0307514_100310445 309
114 3300039447 Ga0436361_0914613 Ga0436361_0914613_9707_10657 309
115 3300046474 Ga0495605_0023935 Ga0495605_0023935_258_1211 309
116 3300046491 Ga0495584_0045943 Ga0495584_0045943_240_1193 309
117 3300046501 Ga0495607_0003257 Ga0495607_0003257_7764_8717 309
118 3300046506 Ga0495583_0000014 Ga0495583_0000014_150534_151487 309
119 3300046513 Ga0495616_0076652 Ga0495616_0076652_227_1180 309
120 3300046523 Ga0495644_0000156 Ga0495644_0000156_28350_29303 309
121 3300046523 Ga0495644_0000695 Ga0495644_0000695_1473_2426 309
122 3300046524 Ga0495648_0001000 Ga0495648_0001000_5356_6309 309
123 3300046538 Ga0495609_0000690 Ga0495609_0000690_16423_17376 309
124 3300046615 Ga0495656_0015442 Ga0495656_0015442_253_1206 309
125 3300046648 Ga0495611_0001169 Ga0495611_0001169_3177_4130 309
126 3300046648 Ga0495611_0001316 Ga0495611_0001316_7782_8735 309
127 3300046660 Ga0495625_0011624 Ga0495625_0011624_5197_6150 309
128 3300046664 Ga0495659_0003028 Ga0495659_0003028_2908_3861 309
129 3300046665 Ga0495661_0051093 Ga0495661_0051093_1084_2037 309
130 3300046691 Ga0495670_0005427 Ga0495670_0005427_4522_5475 309
131 3300046692 Ga0495671_0015596 Ga0495671_0015596_843_1796 309
132 3300047320 Ga0495672_0015028 Ga0495672_0015028_2977_3930 309
133 3300047443 Ga0495687_000982 Ga0495687_000982_12845_13798 309
134 3300047447 Ga0495685_000002 Ga0495685_000002_3854_4807 309
135 3300049459 Ga0495678_000689 Ga0495678_000689_23128_24081 309
136 3300049460 Ga0495682_0000706 Ga0495682_0000706_5657_6610 309
137 3300053136 Ga0500559_0005742 Ga0500559_0005742_3762_4736 309
138 iso_pu_bacteria 2585428057 2587725644 309
139 3300005262 Ga0065165_1001129 Ga0065165_100112914 310
140 3300005367 Ga0070667_100094387 Ga0070667_1000943872 310
141 3300005548 Ga0070665_100324114 Ga0070665_1003241142 310
142 3300017792 Ga0163161_10048883 Ga0163161_100488833 310
143 3300025273 Ga0209673_1005494 Ga0209673_10054945 310
144 3300031238 Ga0265332_10000132 Ga0265332_100001326 310
145 3300046460 Ga0495638_0013008 Ga0495638_0013008_1696_2667 310
146 3300046513 Ga0495616_0000779 Ga0495616_0000779_18849_19820 310
147 3300046530 Ga0495654_0010514 Ga0495654_0010514_2970_3941 310
148 3300046557 Ga0495622_0047053 Ga0495622_0047053_881_1852 310
149 3300046660 Ga0495625_0043455 Ga0495625_0043455_1806_2777 310
150 3300048924 Ga0496121_0095220 Ga0496121_0095220_1247_2218 310
151 3300048926 Ga0496123_0053366 Ga0496123_0053366_1461_2432 310
152 3300053118 Ga0500594_0051438 Ga0500594_0051438_17_988 310
153 3300053122 Ga0500608_060184 Ga0500608_060184_337_1308 310
154 3300053134 Ga0500658_0000096 Ga0500658_0000096_23459_24430 310
155 3300053139 Ga0500568_0032731 Ga0500568_0032731_521_1492 310
156 3300053161 Ga0500634_0036571 Ga0500634_0036571_500_1471 310
157 3300005289 Ga0065704_10075365 Ga0065704_100753655 311
158 3300006946 Ga0079104_1000007 Ga0079104_1000007159 311
159 3300009148 Ga0105243_10001502 Ga0105243_100015023 311
160 3300025935 Ga0207709_10000112 Ga0207709_100001127 311
161 3300027111 Ga0209281_1000020 Ga0209281_1000020338 311
162 3300031456 Ga0307513_10000037 Ga0307513_1000003773 311
163 3300046519 Ga0495632_0005536 Ga0495632_0005536_5371_6345 311
164 3300046660 Ga0495625_0006294 Ga0495625_0006294_8785_9759 311
165 3300053117 Ga0500593_007680 Ga0500593_007680_2574_3545 311
166 3300053158 Ga0500627_0000769 Ga0500627_0000769_7166_8137 311
167 iso_pu_bacteria 2585428062 2587754299 311
168 iso_pu_bacteria 2842733646 2842736571 311
169 3300005543 Ga0070672_100096672 Ga0070672_1000966722 312
170 3300025291 Ga0209675_1006302 Ga0209675_10063022 312
171 3300031456 Ga0307513_10000008 Ga0307513_10000008189 312
172 3300046683 Ga0495658_0010856 Ga0495658_0010856_437_1435 312
173 3300046690 Ga0495624_0127799 Ga0495624_0127799_212_1189 312
174 3300047321 Ga0495676_0014615 Ga0495676_0014615_2142_3140 312
175 3300047673 Ga0495593_0007093 Ga0495593_0007093_4730_5728 312
176 3300048089 Ga0495614_0005859 Ga0495614_0005859_3585_4583 312
177 3300053087 Ga0500643_005455 Ga0500643_005455_3842_4840 312
178 3300053107 Ga0500560_072032 Ga0500560_072032_60_1058 312
179 3300053110 Ga0500571_000076 Ga0500571_000076_15243_16241 312
180 3300053133 Ga0500655_000742 Ga0500655_000742_1670_2647 312
181 3300053134 Ga0500658_0000100 Ga0500658_0000100_21064_22062 312
182 3300053136 Ga0500559_0023899 Ga0500559_0023899_521_1522 312
183 3300053138 Ga0500564_010595 Ga0500564_010595_2592_3590 312
184 3300053141 Ga0500574_014108 Ga0500574_014108_80_1078 312
185 3300053161 Ga0500634_0009687 Ga0500634_0009687_244_1221 312
186 3300053162 Ga0500638_032021 Ga0500638_032021_169_1146 312
187 3300053177 Ga0500636_0002564 Ga0500636_0002564_765_1763 312
188 3300053730 Ga0500645_005687 Ga0500645_005687_2798_3760 312
189 iso_pu_bacteria 2643221570 2643864605 312
190 iso_pu_bacteria 2643221596 2643992783 312
191 iso_pu_bacteria 2643221652 2644296398 312
192 iso_pu_bacteria 2738541307 2738881166 312
193 iso_pu_bacteria 2738541307 2738884639 312
194 iso_pu_bacteria 2738543012 2739244809 312
195 iso_pu_bacteria 2831864461 2831864670 312
196 iso_pu_bacteria 2885198086 2885202688 312
197 iso_pu_bacteria 2885211737 2885216341 312
198 3300002987 JGI25159J45721_1006537 JGI25159J45721_10065373 313
199 3300003187 JGI25151J46595_10039487 JGI25151J46595_100394872 313
200 3300003322 rootL2_10021640 rootL2_1002164010 313
201 3300003771 Ga0055526_1003043 Ga0055526_10030435 313
202 3300003773 Ga0055537_1000366 Ga0055537_10003668 313
203 3300003775 Ga0055524_1000264 Ga0055524_100026443 313
204 3300003784 Ga0055534_1009337 Ga0055534_10093372 313
205 3300003790 Ga0055528_1007389 Ga0055528_10073894 313
206 3300003791 Ga0055530_10003736 Ga0055530_100037368 313
207 3300003792 Ga0055540_1000264 Ga0055540_100026440 313
208 3300025263 Ga0209565_1000041 Ga0209565_1000041189 313
209 3300025273 Ga0209673_1000012 Ga0209673_1000012111 313
210 3300025284 Ga0209130_1001388 Ga0209130_100138814 313
211 3300025292 Ga0209676_1000013 Ga0209676_1000013424 313
212 3300025294 Ga0209025_1044736 Ga0209025_10447361 313
213 3300025295 Ga0209564_1001460 Ga0209564_100146018 313
214 3300025298 Ga0209050_1000008 Ga0209050_1000008424 313
215 3300025299 Ga0209256_1000039 Ga0209256_100003923 313
216 3300025302 Ga0207426_1003342 Ga0207426_10033422 313
217 3300025303 Ga0209051_1000005 Ga0209051_1000005424 313
218 3300025304 Ga0209257_1000031 Ga0209257_100003114 313
219 3300028794 Ga0307515_10154445 Ga0307515_101544451 313
220 3300031548 Ga0307408_100002052 Ga0307408_10000205214 313
221 3300031901 Ga0307406_10008445 Ga0307406_100084455 313
222 3300048919 Ga0496116_0037718 Ga0496116_0037718_34_1044 313
223 3300048924 Ga0496121_0056436 Ga0496121_0056436_1401_2411 313
224 3300048925 Ga0496122_0078310 Ga0496122_0078310_708_1718 313
225 iso_pu_bacteria 2547132374 2548500362 313
226 iso_pu_bacteria 2588253510 2588292157 313
227 iso_pu_bacteria 2643221717 2644647087 313
228 iso_pu_bacteria 2738541277 2738721144 313
229 iso_pu_bacteria 2738543012 2739244357 313
230 iso_pu_bacteria 2738543019 2739280343 313
231 iso_pu_bacteria 2816332133 2816469788 313
232 3300003322 rootL2_10021407 rootL2_100214072 314
233 3300003323 rootH1_10028834 rootH1_100288343 314
234 3300003752 Ga0055539_1000174 Ga0055539_100017410 314
235 3300003756 Ga0055533_1000011 Ga0055533_1000011157 314
236 3300003759 Ga0055525_1000607 Ga0055525_10006078 314
237 3300006048 Ga0075363_100009079 Ga0075363_1000090793 314
238 3300006051 Ga0075364_10002946 Ga0075364_100029466 314
239 3300006058 Ga0075432_10000485 Ga0075432_100004852 314
240 3300006177 Ga0075362_10001544 Ga0075362_100015446 314
241 3300006195 Ga0075366_10009739 Ga0075366_100097392 314
242 3300006871 Ga0075434_100064464 Ga0075434_1000644643 314
243 3300007076 Ga0075435_100279108 Ga0075435_1002791082 314
244 3300021361 Ga0213872_10025756 Ga0213872_100257562 314
245 3300025226 Ga0209674_100003 Ga0209674_100003458 314
246 3300025230 Ga0209563_100010 Ga0209563_100010187 314
247 3300025231 Ga0207427_101456 Ga0207427_1014564 314
248 3300025245 Ga0207425_1003288 Ga0207425_10032885 314
249 3300025253 Ga0209677_100083 Ga0209677_10008347 314
250 3300025291 Ga0209675_1000856 Ga0209675_10008565 314
251 3300025294 Ga0209025_1005839 Ga0209025_10058399 314
252 3300025297 Ga0209758_1013005 Ga0209758_10130052 314
253 3300025298 Ga0209050_1005285 Ga0209050_10052857 314
254 3300025913 Ga0207695_10016563 Ga0207695_100165639 314
255 3300027907 Ga0207428_10132849 Ga0207428_101328492 314
256 3300030522 Ga0307512_10018137 Ga0307512_100181372 314
257 3300037471 Ga0395905_0008952 Ga0395905_0008952_941_1924 314
258 3300039447 Ga0436361_0495680 Ga0436361_0495680_502_1467 314
259 3300048928 Ga0496125_0006842 Ga0496125_0006842_8115_9095 314
260 3300048928 Ga0496125_0080854 Ga0496125_0080854_287_1255 314
261 3300050490 nmdc:mga03n38_450_c1 nmdc:mga03n38_450_c1_2443_3408 314
262 3300050491 nmdc:mga00v17_177994_c1 nmdc:mga00v17_177994_c1_138_1118 314
263 3300050491 nmdc:mga00v17_20532_c1 nmdc:mga00v17_20532_c1_2439_3404 314
264 3300050493 nmdc:mga0k408_13829_c1 nmdc:mga0k408_13829_c1_745_1710 314
265 3300050513 nmdc:mga0rr50_29903_c1 nmdc:mga0rr50_29903_c1_603_1577 314
266 3300053088 Ga0500644_0053090 Ga0500644_0053090_25_990 314
267 3300053108 Ga0500562_002723 Ga0500562_002723_2195_3160 314
268 3300053117 Ga0500593_000332 Ga0500593_000332_14052_15017 314
269 iso_pu_bacteria 2718218334 2721027495 314
270 iso_pu_bacteria 2932422444 2932423357 314
271 3300031456 Ga0307513_10016021 Ga0307513_100160215 315
272 3300031649 Ga0307514_10041949 Ga0307514_100419493 315
273 3300053125 Ga0500618_020034 Ga0500618_020034_486_1454 315
274 3300009177 Ga0105248_10036502 Ga0105248_100365022 316
275 3300025941 Ga0207711_10035680 Ga0207711_100356805 316
276 3300026121 Ga0207683_10154692 Ga0207683_101546922 316
277 3300031730 Ga0307516_10265568 Ga0307516_102655682 316
278 3300046453 Ga0495627_004860 Ga0495627_004860_1295_2266 316
279 3300046453 Ga0495627_015653 Ga0495627_015653_250_1221 316
280 3300046457 Ga0495590_0033598 Ga0495590_0033598_672_1643 316
281 3300046460 Ga0495638_0000058 Ga0495638_0000058_138050_139021 316
282 3300046512 Ga0495610_0000963 Ga0495610_0000963_24585_25556 316
283 3300046515 Ga0495620_0020056 Ga0495620_0020056_763_1734 316
284 3300046524 Ga0495648_0000082 Ga0495648_0000082_69724_70695 316
285 3300046528 Ga0495642_0010477 Ga0495642_0010477_200_1171 316
286 3300046538 Ga0495609_0021237 Ga0495609_0021237_1442_2413 316
287 3300046692 Ga0495671_0011715 Ga0495671_0011715_652_1623 316
288 3300048924 Ga0496121_0003101 Ga0496121_0003101_12050_13021 316
289 3300048926 Ga0496123_0045437 Ga0496123_0045437_304_1275 316
290 3300048928 Ga0496125_0048786 Ga0496125_0048786_1603_2574 316
291 3300048929 Ga0496126_0002988 Ga0496126_0002988_20831_21802 316
292 3300049459 Ga0495678_051079 Ga0495678_051079_54_1025 316
293 3300053079 Ga0500610_0001484 Ga0500610_0001484_5250_6221 316
294 3300053119 Ga0500595_052092 Ga0500595_052092_253_1224 316
295 3300053156 Ga0500622_0008053 Ga0500622_0008053_1637_2608 316
296 3300053161 Ga0500634_0019673 Ga0500634_0019673_1058_2029 316
297 3300053730 Ga0500645_013207 Ga0500645_013207_405_1376 316
298 iso_pu_bacteria 2816332133 2816475592 316
299 iso_pu_bacteria 2990710928 2990715185 316
300 3300046491 Ga0495584_0000306 Ga0495584_0000306_13867_14853 317
301 3300046516 Ga0495628_0050279 Ga0495628_0050279_2191_3165 317
302 3300046520 Ga0495637_0007625 Ga0495637_0007625_1812_2786 317
303 3300046524 Ga0495648_0000653 Ga0495648_0000653_9777_10763 317
304 3300046558 Ga0495633_0067079 Ga0495633_0067079_308_1282 317
305 3300048904 Ga0496101_0002787 Ga0496101_0002787_9251_10225 317
306 3300002704 JGI25155J39150_1000057 JGI25155J39150_100005740 318
307 3300002705 JGI25156J39149_1000073 JGI25156J39149_100007340 318
308 3300002705 JGI25156J39149_1000412 JGI25156J39149_10004121 318
309 3300002738 JGI25154J39366_1000097 JGI25154J39366_100009732 318
310 3300002741 JGI25157J39369_1000089 JGI25157J39369_100008932 318
311 3300005331 Ga0070670_100022026 Ga0070670_1000220265 318
312 3300005344 Ga0070661_100162153 Ga0070661_1001621531 318
313 3300005364 Ga0070673_100165072 Ga0070673_1001650723 318
314 3300005455 Ga0070663_100173785 Ga0070663_1001737853 318
315 3300005456 Ga0070678_100312405 Ga0070678_1003124052 318
316 3300005543 Ga0070672_100083533 Ga0070672_1000835334 318
317 3300005564 Ga0070664_100136737 Ga0070664_1001367373 318
318 3300005841 Ga0068863_100200787 Ga0068863_1002007872 318
319 3300006195 Ga0075366_10003043 Ga0075366_100030437 318
320 3300006195 Ga0075366_10087712 Ga0075366_100877122 318
321 3300006353 Ga0075370_10008336 Ga0075370_100083363 318
322 3300009177 Ga0105248_10009543 Ga0105248_100095433 318
323 3300013100 Ga0157373_10016380 Ga0157373_100163805 318
324 3300025206 Ga0209435_100008 Ga0209435_100008238 318
325 3300025246 Ga0209646_1000029 Ga0209646_100002940 318
326 3300025250 Ga0209026_1000016 Ga0209026_100001640 318
327 3300025256 Ga0209759_1000016 Ga0209759_100001640 318
328 3300025256 Ga0209759_1000739 Ga0209759_10007391 318
329 3300025893 Ga0207682_10007256 Ga0207682_100072561 318
330 3300025913 Ga0207695_10000301 Ga0207695_1000030136 318
331 3300025931 Ga0207644_10045866 Ga0207644_100458664 318
332 3300025931 Ga0207644_10104476 Ga0207644_101044763 318
333 3300025933 Ga0207706_10021567 Ga0207706_100215674 318
334 3300025940 Ga0207691_10006643 Ga0207691_100066431 318
335 3300025941 Ga0207711_10089921 Ga0207711_100899212 318
336 3300026088 Ga0207641_10173889 Ga0207641_101738892 318
337 3300026089 Ga0207648_10422328 Ga0207648_104223281 318
338 3300026089 Ga0207648_10492820 Ga0207648_104928201 318
339 3300026121 Ga0207683_10087367 Ga0207683_100873672 318
340 3300028786 Ga0307517_10000395 Ga0307517_1000039512 318
341 3300028794 Ga0307515_10000618 Ga0307515_1000061824 318
342 3300028794 Ga0307515_10038152 Ga0307515_100381524 318
343 3300028794 Ga0307515_10049677 Ga0307515_100496772 318
344 3300031456 Ga0307513_10100324 Ga0307513_101003242 318
345 3300031507 Ga0307509_10037572 Ga0307509_100375725 318
346 3300031548 Ga0307408_100000117 Ga0307408_10000011741 318
347 3300031616 Ga0307508_10003099 Ga0307508_100030999 318
348 3300031730 Ga0307516_10122944 Ga0307516_101229442 318
349 3300031731 Ga0307405_10115364 Ga0307405_101153642 318
350 3300031824 Ga0307413_10084602 Ga0307413_100846023 318
351 3300031852 Ga0307410_10025344 Ga0307410_100253443 318
352 3300031901 Ga0307406_10000220 Ga0307406_1000022016 318
353 3300031903 Ga0307407_10048431 Ga0307407_100484313 318
354 3300032002 Ga0307416_100197185 Ga0307416_1001971852 318
355 3300033180 Ga0307510_10061521 Ga0307510_100615213 318
356 3300036401 Ga0373937_0150794 Ga0373937_0150794_91_1077 318
357 3300046454 Ga0495592_0000021 Ga0495592_0000021_53599_54618 318
358 3300046460 Ga0495638_0071282 Ga0495638_0071282_90_1100 318
359 3300046471 Ga0495650_0000510 Ga0495650_0000510_8373_9383 318
360 3300046474 Ga0495605_0003782 Ga0495605_0003782_5059_6069 318
361 3300046474 Ga0495605_0141946 Ga0495605_0141946_48_1043 318
362 3300046491 Ga0495584_0013846 Ga0495584_0013846_20_1015 318
363 3300046506 Ga0495583_0000093 Ga0495583_0000093_148037_149047 318
364 3300046506 Ga0495583_0022531 Ga0495583_0022531_618_1613 318
365 3300046513 Ga0495616_0008406 Ga0495616_0008406_1035_2030 318
366 3300046524 Ga0495648_0123700 Ga0495648_0123700_179_1174 318
367 3300046538 Ga0495609_0011437 Ga0495609_0011437_1635_2630 318
368 3300046558 Ga0495633_0000214 Ga0495633_0000214_24171_25181 318
369 3300046615 Ga0495656_0015498 Ga0495656_0015498_1646_2656 318
370 3300046660 Ga0495625_0000728 Ga0495625_0000728_8110_9120 318
371 3300046660 Ga0495625_0009208 Ga0495625_0009208_4553_5584 318
372 3300046664 Ga0495659_0011958 Ga0495659_0011958_1441_2436 318
373 3300046664 Ga0495659_0053771 Ga0495659_0053771_160_1170 318
374 3300046684 Ga0495669_0019655 Ga0495669_0019655_890_1885 318
375 3300046692 Ga0495671_0000418 Ga0495671_0000418_20489_21499 318
376 3300046810 Ga0495660_0157568 Ga0495660_0157568_95_1090 318
377 3300047318 Ga0495636_0072704 Ga0495636_0072704_318_1328 318
378 3300047320 Ga0495672_0000372 Ga0495672_0000372_4331_5341 318
379 3300047323 Ga0495683_0010535 Ga0495683_0010535_2061_3071 318
380 3300047443 Ga0495687_000334 Ga0495687_000334_11415_12425 318
381 3300047443 Ga0495687_045225 Ga0495687_045225_687_1682 318
382 3300047445 Ga0495677_0004037 Ga0495677_0004037_465_1460 318
383 3300047470 Ga0495681_0034907 Ga0495681_0034907_298_1293 318
384 3300047472 Ga0495686_0035676 Ga0495686_0035676_1708_2739 318
385 3300048904 Ga0496101_0142400 Ga0496101_0142400_541_1527 318
386 3300048910 Ga0496107_0146898 Ga0496107_0146898_709_1695 318
387 3300048916 Ga0496113_0316052 Ga0496113_0316052_253_1239 318
388 3300048920 Ga0496117_0022306 Ga0496117_0022306_3845_4831 318
389 3300048921 Ga0496118_0000880 Ga0496118_0000880_18310_19296 318
390 3300048921 Ga0496118_0000955 Ga0496118_0000955_13705_14715 318
391 3300048922 Ga0496119_0000131 Ga0496119_0000131_74648_75700 318
392 3300048923 Ga0496120_0000845 Ga0496120_0000845_22763_23815 318
393 3300048924 Ga0496121_0016229 Ga0496121_0016229_5431_6417 318
394 3300048924 Ga0496121_0126070 Ga0496121_0126070_205_1191 318
395 3300048929 Ga0496126_0000925 Ga0496126_0000925_22575_23561 318
396 3300049460 Ga0495682_0001810 Ga0495682_0001810_3400_4410 318
397 3300050490 nmdc:mga03n38_110589_c1 nmdc:mga03n38_110589_c1_89_1105 318
398 3300050493 nmdc:mga0k408_243909_c1 nmdc:mga0k408_243909_c1_16_1002 318
399 3300050493 nmdc:mga0k408_95_c1 nmdc:mga0k408_95_c1_33152_34153 318
400 3300053121 Ga0500607_003258 Ga0500607_003258_1112_2104 318
401 iso_pu_bacteria 2585428058 2587736922 318

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

53

112

0.98

PF03466

LysR_substrate

LysR substrate binding domain

136

344

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x0o-assembly1.cif.gz_B regulatory domain of aphb treated with cumene hydroperoxide from vibrio vulnificus 0.9025 87 288
5fhk-assembly1.cif.gz_B regulatory domain of aphb in vibrio vulnificus 0.8985 88 288
5x0n-assembly3.cif.gz_F regulatory domain of variant c227s aphb from vibrio vulnificus 0.8936 88 288
5x0o-assembly1.cif.gz_B regulatory domain of aphb treated with cumene hydroperoxide from vibrio vulnificus 0.8936 87 288
5x0n-assembly2.cif.gz_B regulatory domain of variant c227s aphb from vibrio vulnificus 0.891 88 288
ID Description Score Start End Superfamily
af_P52696_4_93_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9345 5 80 1.10.10.10
af_P75836_90_290_3.40.190.290 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9202 85 286 3.40.190.290
af_P37641_3_87_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9141 6 75 1.10.10.10
3t1bB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9072 4 81 1.10.10.10
af_P75836_90_290_3.40.190.290 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9072 85 286 3.40.190.290
ID Description Score Start End GO Terms
AF-A0A242M2C6-F1-model_v4 Putative transcription regulator protein of MDR efflux pump cluster 0.9364 160 258 GO:0003700
GO:0006351
GO:0043565
AF-A0A447T6W0-F1-model_v4 D-malate degradation protein R 0.9189 87 300 GO:0003700
GO:0006351
GO:0043565
AF-N9LMW5-F1-model_v4 LysR substrate-binding domain-containing protein 0.9052 87 290 GO:0003700
GO:0006351
GO:0043565
AF-A0A067B4C9-F1-model_v4 LysR family transcriptional regulator 0.8987 4 291 GO:0003700
GO:0006351
GO:0043565
AF-D0IG20-F1-model_v4 Transcriptional regulator 0.897 37 291 GO:0003700
GO:0006351
GO:0043565

Feature Viewer

pLDDT pTM Quality
88.01 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map