F434886

General Info

Members Datasets Scaffolds Average Seq Length
401 226 802 138

Family's Representative Sequence

Representative Sequence 3300035113|Ga0373936_0101248|Ga0373936_0101248_239_706
Length 155
Sequence VLSGAEGDDPMLKEFRTFIARGNVLDLAVAVIIGAAFGKIVTTLVEGVIMPPIGLVLGKVDFSSLFVVLDRSKGNPMSLAEAKTLGVPVIAYGAFLNDVVNFVIVAFAVFLIVRQANRLKGPAQPAAAPATRECPKCLTMIPVAARRCAACCADL

Samples

Sample ID Description Type Environment
1 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
141 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
154 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
155 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
160 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
161 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
162 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
163 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
164 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
167 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
168 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
169 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
170 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
171 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
172 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
173 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
174 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
175 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
176 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
177 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
181 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
202 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
203 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
204 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
207 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
208 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
209 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
210 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
211 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
215 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
221 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
224 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
225 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
226 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 3.49
Rhizosphere 96.26
Stem 0
Stem Tuber 0
Unclassified 3.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373936_0101248 3300035113 Bacteria 1216
2 JGI24739J22299_10115297 3300001989 Bacteria 804
3 JGI24748J21848_1000002 3300002074 Bacteria 426946
4 JGI24034J26672_10000004 3300002239 Bacteria 426946
5 JGI24742J22300_10013274 3300002244 Bacteria 1378
6 JGI25406J46586_10047514 3300003203 Bacteria 1462
7 Ga0065712_10123320 3300005290 Bacteria 1640
8 Ga0065712_10130322 3300005290 Bacteria 1543
9 Ga0065712_10328254 3300005290 Unclassified 818
10 Ga0065715_10120475 3300005293 Bacteria 2257
11 Ga0065715_10174572 3300005293 Bacteria 1518
12 Ga0065715_10181077 3300005293 Bacteria 1476
13 Ga0065715_10320794 3300005293 Bacteria 1002
14 Ga0065707_10467065 3300005295 Bacteria 786
15 Ga0065707_10843671 3300005295 Bacteria 584
16 Ga0065707_11125706 3300005295 Bacteria 510
17 Ga0070676_10158847 3300005328 Bacteria 1453
18 Ga0070676_10165392 3300005328 Bacteria 1427
19 Ga0070676_10400300 3300005328 Unclassified 955
20 Ga0070683_100017848 3300005329 Bacteria 6273
21 Ga0070690_100265841 3300005330 Bacteria 1218
22 Ga0070690_100859165 3300005330 Bacteria 707
23 Ga0070670_100251110 3300005331 Bacteria 1541
24 Ga0068869_100036834 3300005334 Bacteria 3475
25 Ga0070666_10158573 3300005335 Bacteria 1581
26 Ga0070666_10213372 3300005335 Bacteria 1360
27 Ga0070666_10374840 3300005335 Bacteria 1021
28 Ga0068868_100050694 3300005338 Bacteria 3261
29 Ga0068868_100195281 3300005338 Bacteria 1685
30 Ga0070687_100145442 3300005343 Bacteria 1385
31 Ga0070692_10192079 3300005345 Bacteria 1190
32 Ga0070668_100148241 3300005347 Bacteria 1895
33 Ga0070669_100005896 3300005353 Bacteria 8840
34 Ga0070669_100646451 3300005353 Bacteria 889
35 Ga0070669_100820603 3300005353 Bacteria 791
36 Ga0070675_100079359 3300005354 Unclassified 2734
37 Ga0070671_100079256 3300005355 Bacteria 2745
38 Ga0070671_100082810 3300005355 Bacteria 2683
39 Ga0070671_100233017 3300005355 Bacteria 1563
40 Ga0070671_100406895 3300005355 Bacteria 1164
41 Ga0070674_100576195 3300005356 Bacteria 948
42 Ga0070673_100668488 3300005364 Bacteria 952
43 Ga0070673_101335503 3300005364 Bacteria 674
44 Ga0070688_100014591 3300005365 Bacteria 4455
45 Ga0070688_100567690 3300005365 Bacteria 865
46 Ga0070667_100015693 3300005367 Bacteria 6262
47 Ga0070667_100610681 3300005367 Bacteria 1005
48 Ga0070713_101325135 3300005436 Bacteria 698
49 Ga0070701_10551234 3300005438 Bacteria 756
50 Ga0070711_100039057 3300005439 Bacteria 3194
51 Ga0070700_100204968 3300005441 Unclassified 1388
52 Ga0070700_100326589 3300005441 Bacteria 1129
53 Ga0070694_100297341 3300005444 Bacteria 1236
54 Ga0070694_100793593 3300005444 Bacteria 776
55 Ga0070678_100032412 3300005456 Bacteria 3617
56 Ga0070678_101495496 3300005456 Bacteria 632
57 Ga0070662_100050108 3300005457 Bacteria 3012
58 Ga0070662_100896506 3300005457 Bacteria 756
59 Ga0068867_102396345 3300005459 Bacteria 502
60 Ga0070685_10582787 3300005466 Bacteria 803
61 Ga0070706_100001542 3300005467 Bacteria 24114
62 Ga0070706_100985321 3300005467 Unclassified 777
63 Ga0070707_100285721 3300005468 Bacteria 1603
64 Ga0070707_100330057 3300005468 Bacteria 1482
65 Ga0070707_100609828 3300005468 Bacteria 1054
66 Ga0070699_100150958 3300005518 Bacteria 2055
67 Ga0070699_100775084 3300005518 Bacteria 877
68 Ga0070672_100079956 3300005543 Bacteria 2618
69 Ga0070672_100084750 3300005543 Bacteria 2545
70 Ga0070672_100106626 3300005543 Bacteria 2279
71 Ga0070672_100178070 3300005543 Unclassified 1771
72 Ga0070672_100533012 3300005543 Bacteria 1018
73 Ga0070686_100012918 3300005544 Bacteria 4768
74 Ga0070686_100044666 3300005544 Bacteria 2787
75 Ga0070686_100064717 3300005544 Bacteria 2373
76 Ga0070665_100002487 3300005548 Bacteria 20285
77 Ga0070665_100178750 3300005548 Bacteria 2123
78 Ga0070665_100355940 3300005548 Bacteria 1470
79 Ga0070665_101642942 3300005548 Bacteria 650
80 Ga0070704_100055587 3300005549 Bacteria 2807
81 Ga0070704_100407329 3300005549 Bacteria 1162
82 Ga0070664_100038614 3300005564 Bacteria 4020
83 Ga0070664_100089595 3300005564 Bacteria 2662
84 Ga0068857_100147097 3300005577 Bacteria 2132
85 Ga0068854_100065200 3300005578 Bacteria 2648
86 Ga0070702_100077288 3300005615 Bacteria 1984
87 Ga0070702_100471019 3300005615 Bacteria 916
88 Ga0068859_100303261 3300005617 Bacteria 1691
89 Ga0068859_100766876 3300005617 Bacteria 1053
90 Ga0068859_100934421 3300005617 Bacteria 951
91 Ga0068859_101230811 3300005617 Bacteria 825
92 Ga0068864_100265322 3300005618 Bacteria 1598
93 Ga0068864_100302307 3300005618 Unclassified 1498
94 Ga0068866_10020263 3300005718 Bacteria 3045
95 Ga0068861_100024425 3300005719 Bacteria 4371
96 Ga0068870_10543518 3300005840 Bacteria 781
97 Ga0068863_100401495 3300005841 Bacteria 1341
98 Ga0068858_100000105 3300005842 Bacteria 87839
99 Ga0068858_100136851 3300005842 Bacteria 2298
100 Ga0068858_100528542 3300005842 Bacteria 1141
101 Ga0068860_100707199 3300005843 Bacteria 1017
102 Ga0068860_101743894 3300005843 Bacteria 645
103 Ga0068862_100008018 3300005844 Bacteria 8739
104 Ga0068862_100471927 3300005844 Bacteria 1186
105 Ga0081455_10105262 3300005937 Bacteria 2255
106 Ga0081539_10000228 3300005985 Bacteria 131823
107 Ga0070717_10230651 3300006028 Bacteria 1630
108 Ga0075432_10211823 3300006058 Bacteria 771
109 Ga0097621_100053621 3300006237 Bacteria 3287
110 Ga0097621_100064769 3300006237 Bacteria 3007
111 Ga0097621_100544533 3300006237 Bacteria 1056
112 Ga0068871_100009359 3300006358 Bacteria 7094
113 Ga0068871_100545659 3300006358 Bacteria 1049
114 Ga0075428_100281160 3300006844 Bacteria 1790
115 Ga0075430_100041459 3300006846 Bacteria 3894
116 Ga0075430_100124394 3300006846 Bacteria 2150
117 Ga0075431_100267246 3300006847 Bacteria 1734
118 Ga0075431_100967289 3300006847 Bacteria 819
119 Ga0075433_10063546 3300006852 Bacteria 3234
120 Ga0075433_10310420 3300006852 Bacteria 1396
121 Ga0075433_10390303 3300006852 Bacteria 1228
122 Ga0075434_100007428 3300006871 Bacteria 10145
123 Ga0075434_100147549 3300006871 Bacteria 2372
124 Ga0075434_101090905 3300006871 Bacteria 812
125 Ga0075429_100049879 3300006880 Unclassified 3641
126 Ga0075429_100056704 3300006880 Bacteria 3410
127 Ga0075429_100162246 3300006880 Bacteria 1957
128 Ga0075429_100243616 3300006880 Bacteria 1574
129 Ga0075429_101085496 3300006880 Bacteria 699
130 Ga0068865_100366466 3300006881 Bacteria 1171
131 Ga0097620_100303256 3300006931 Bacteria 1691
132 Ga0097620_100766970 3300006931 Bacteria 1053
133 Ga0097620_100934470 3300006931 Bacteria 951
134 Ga0097620_101230911 3300006931 Bacteria 825
135 Ga0075435_101005929 3300007076 Bacteria 728
136 Ga0111539_10000733 3300009094 Bacteria 42654
137 Ga0111539_10001399 3300009094 Bacteria 32116
138 Ga0111539_10007259 3300009094 Bacteria 14194
139 Ga0111539_10025066 3300009094 Bacteria 7310
140 Ga0111539_10155429 3300009094 Bacteria 2676
141 Ga0111539_10194010 3300009094 Bacteria 2369
142 Ga0111539_10577995 3300009094 Bacteria 1309
143 Ga0111539_10853166 3300009094 Bacteria 1060
144 Ga0105245_10007446 3300009098 Bacteria 9586
145 Ga0105245_10821147 3300009098 Bacteria 968
146 Ga0105245_11520626 3300009098 Bacteria 720
147 Ga0105247_10000005 3300009101 Bacteria 426989
148 Ga0114129_10048978 3300009147 Bacteria 5939
149 Ga0114129_10092475 3300009147 Bacteria 4190
150 Ga0114129_10426691 3300009147 Bacteria 1743
151 Ga0105243_11155867 3300009148 Bacteria 785
152 Ga0105242_10004233 3300009176 Bacteria 11188
153 Ga0105242_10155602 3300009176 Bacteria 1997
154 Ga0105242_11753864 3300009176 Bacteria 658
155 Ga0105248_10007272 3300009177 Bacteria 12146
156 Ga0105248_10015287 3300009177 Bacteria 8463
157 Ga0105248_10039551 3300009177 Bacteria 5283
158 Ga0105248_11143220 3300009177 Bacteria 880
159 Ga0105238_10866579 3300009551 Bacteria 921
160 Ga0105249_10071449 3300009553 Bacteria 3206
161 Ga0105239_10008279 3300010375 Bacteria 11857
162 Ga0105246_11578859 3300011119 Unclassified 619
163 Ga0157371_10093885 3300013102 Bacteria 2126
164 Ga0157370_12036167 3300013104 Bacteria 515
165 Ga0157374_11018718 3300013296 Bacteria 847
166 Ga0157378_10556436 3300013297 Bacteria 1153
167 Ga0157378_10592189 3300013297 Bacteria 1119
168 Ga0163162_10538241 3300013306 Bacteria 1297
169 Ga0157375_10165274 3300013308 Bacteria 2357
170 Ga0163163_10010383 3300014325 Bacteria 8369
171 Ga0163163_10267731 3300014325 Bacteria 1760
172 Ga0157380_10995339 3300014326 Bacteria 871
173 Ga0157377_10024073 3300014745 Bacteria 3233
174 Ga0157377_10590301 3300014745 Bacteria 791
175 Ga0157379_10021815 3300014968 Bacteria 5674
176 Ga0157379_10085840 3300014968 Bacteria 2822
177 Ga0157379_10375094 3300014968 Bacteria 1305
178 Ga0157379_10771635 3300014968 Bacteria 906
179 Ga0157379_11431065 3300014968 Unclassified 671
180 Ga0157376_10015817 3300014969 Bacteria 5710
181 Ga0157376_10918940 3300014969 Bacteria 894
182 Ga0163161_10573056 3300017792 Bacteria 928
183 Ga0207672_1000410 3300025223 Bacteria 5440
184 Ga0207697_10002895 3300025315 Bacteria 8688
185 Ga0207697_10107511 3300025315 Unclassified 1193
186 Ga0207710_10000004 3300025900 Bacteria 846540
187 Ga0207688_10057584 3300025901 Bacteria 2185
188 Ga0207688_10186373 3300025901 Bacteria 1239
189 Ga0207680_10173410 3300025903 Bacteria 1454
190 Ga0207680_10249629 3300025903 Bacteria 1225
191 Ga0207645_10165664 3300025907 Bacteria 1447
192 Ga0207684_10013030 3300025910 Bacteria 7198
193 Ga0207693_10146022 3300025915 Bacteria 1860
194 Ga0207663_10065489 3300025916 Bacteria 2323
195 Ga0207662_10070065 3300025918 Bacteria 2120
196 Ga0207662_10558066 3300025918 Bacteria 794
197 Ga0207662_10668403 3300025918 Bacteria 726
198 Ga0207646_10225509 3300025922 Bacteria 1693
199 Ga0207646_11334541 3300025922 Bacteria 625
200 Ga0207681_10002998 3300025923 Bacteria 10612
201 Ga0207681_10011878 3300025923 Bacteria 5361
202 Ga0207650_10163342 3300025925 Bacteria 1766
203 Ga0207650_10335651 3300025925 Bacteria 1240
204 Ga0207700_10783064 3300025928 Bacteria 853
205 Ga0207644_10000362 3300025931 Bacteria 29550
206 Ga0207644_10085507 3300025931 Bacteria 2340
207 Ga0207644_10100293 3300025931 Bacteria 2174
208 Ga0207644_10111681 3300025931 Bacteria 2068
209 Ga0207706_10740285 3300025933 Bacteria 838
210 Ga0207686_10299502 3300025934 Bacteria 1194
211 Ga0207709_10815338 3300025935 Bacteria 754
212 Ga0207670_10127470 3300025936 Bacteria 1859
213 Ga0207669_10064408 3300025937 Bacteria 2268
214 Ga0207669_10376881 3300025937 Bacteria 1104
215 Ga0207704_10008826 3300025938 Bacteria 4840
216 Ga0207704_10016812 3300025938 Bacteria 3771
217 Ga0207665_10418530 3300025939 Bacteria 1023
218 Ga0207691_10021539 3300025940 Bacteria 6086
219 Ga0207691_10111783 3300025940 Bacteria 2429
220 Ga0207691_10216043 3300025940 Bacteria 1664
221 Ga0207691_10341498 3300025940 Bacteria 1282
222 Ga0207711_10030554 3300025941 Bacteria 4545
223 Ga0207711_10124825 3300025941 Bacteria 2301
224 Ga0207711_10637937 3300025941 Bacteria 994
225 Ga0207711_10796575 3300025941 Bacteria 880
226 Ga0207689_10023051 3300025942 Bacteria 5228
227 Ga0207661_10052656 3300025944 Bacteria 3253
228 Ga0207679_10077692 3300025945 Bacteria 2526
229 Ga0207679_10141138 3300025945 Bacteria 1947
230 Ga0207651_10058094 3300025960 Bacteria 2672
231 Ga0207651_10400465 3300025960 Bacteria 1167
232 Ga0207651_10666873 3300025960 Bacteria 914
233 Ga0207712_10129444 3300025961 Bacteria 1921
234 Ga0207668_10144558 3300025972 Bacteria 1833
235 Ga0207668_10301680 3300025972 Bacteria 1322
236 Ga0207640_10187109 3300025981 Bacteria 1558
237 Ga0207658_10022624 3300025986 Bacteria 4379
238 Ga0207658_10212906 3300025986 Bacteria 1621
239 Ga0207658_10550519 3300025986 Bacteria 1032
240 Ga0207677_10063790 3300026023 Bacteria 2563
241 Ga0207677_10627886 3300026023 Bacteria 946
242 Ga0207703_10000127 3300026035 Bacteria 91856
243 Ga0207703_10321457 3300026035 Bacteria 1417
244 Ga0207678_10032332 3300026067 Bacteria 4559
245 Ga0207678_11660270 3300026067 Bacteria 562
246 Ga0207708_10213396 3300026075 Bacteria 1544
247 Ga0207708_10640261 3300026075 Bacteria 904
248 Ga0207708_11151604 3300026075 Bacteria 677
249 Ga0207641_10188918 3300026088 Bacteria 1892
250 Ga0207648_10088793 3300026089 Bacteria 2699
251 Ga0207648_11021774 3300026089 Bacteria 774
252 Ga0207676_10337116 3300026095 Unclassified 1390
253 Ga0207675_100002879 3300026118 Bacteria 16917
254 Ga0207675_100383830 3300026118 Unclassified 1382
255 Ga0207675_101098164 3300026118 Bacteria 815
256 Ga0207683_10060030 3300026121 Bacteria 3342
257 Ga0207683_10296272 3300026121 Bacteria 1480
258 Ga0207683_10687035 3300026121 Bacteria 949
259 Ga0207683_11111675 3300026121 Bacteria 733
260 Ga0209971_1146620 3300027682 Bacteria 582
261 Ga0207428_10001313 3300027907 Bacteria 26459
262 Ga0207428_10026516 3300027907 Bacteria 4838
263 Ga0207428_10033816 3300027907 Bacteria 4193
264 Ga0207428_10328006 3300027907 Bacteria 1129
265 Ga0207428_10372113 3300027907 Bacteria 1049
266 Ga0268266_10173742 3300028379 Bacteria 1957
267 Ga0268266_10197645 3300028379 Bacteria 1839
268 Ga0268266_10349297 3300028379 Bacteria 1390
269 Ga0268265_10183603 3300028380 Bacteria 1799
270 Ga0268265_10324572 3300028380 Bacteria 1396
271 Ga0268265_10407156 3300028380 Bacteria 1259
272 Ga0268264_10893772 3300028381 Bacteria 891
273 Ga0268264_11146898 3300028381 Bacteria 786
274 Ga0265323_10000235 3300028653 Bacteria 32680
275 Ga0265316_10060941 3300031344 Bacteria 2932
276 Ga0307408_100251583 3300031548 Bacteria 1458
277 Ga0307405_10078228 3300031731 Bacteria 2152
278 Ga0307405_10618845 3300031731 Bacteria 886
279 Ga0307413_10072439 3300031824 Bacteria 2175
280 Ga0307410_10204658 3300031852 Bacteria 1509
281 Ga0307410_10282910 3300031852 Bacteria 1302
282 Ga0307410_12089941 3300031852 Bacteria 506
283 Ga0307406_11408822 3300031901 Bacteria 611
284 Ga0307407_10824342 3300031903 Bacteria 707
285 Ga0307412_10139237 3300031911 Bacteria 1775
286 Ga0307412_10198222 3300031911 Bacteria 1523
287 Ga0307409_100163285 3300031995 Bacteria 1951
288 Ga0307409_100167246 3300031995 Bacteria 1931
289 Ga0307416_100108867 3300032002 Bacteria 2436
290 Ga0307416_100147038 3300032002 Bacteria 2154
291 Ga0307416_100266549 3300032002 Bacteria 1678
292 Ga0307416_101449901 3300032002 Bacteria 792
293 Ga0307414_10212005 3300032004 Bacteria 1584
294 Ga0307414_10252764 3300032004 Bacteria 1466
295 Ga0307414_10283168 3300032004 Bacteria 1394
296 Ga0307414_10506329 3300032004 Bacteria 1069
297 Ga0307411_10335072 3300032005 Bacteria 1227
298 Ga0307411_10773106 3300032005 Bacteria 843
299 Ga0373939_0302162 3300035114 Bacteria 638
300 Ga0373953_0175187 3300035117 Bacteria 924
301 Ga0373962_0088714 3300035242 Bacteria 950
302 Ga0373931_0144357 3300035691 Bacteria 1382
303 Ga0373933_0229945 3300035724 Bacteria 1191
304 Ga0373937_0274598 3300036401 Unclassified 1591
305 Ga0373937_0642970 3300036401 Bacteria 1006
306 Ga0436360_0572392 3300039438 Bacteria 838
307 Ga0451802_1469144 3300041460 Bacteria 840
308 Ga0439464_0092936 3300042439 Bacteria 911
309 Ga0451577_0165369 3300042876 Bacteria 1993
310 Ga0453683_0860458 3300044673 Bacteria 598
311 Ga0453684_0489785 3300044712 Bacteria 1363
312 Ga0451576_1868285 3300045051 Bacteria 620
313 Ga0495653_0831052 3300046463 Bacteria 554
314 Ga0495662_0425564 3300046476 Bacteria 652
315 Ga0495585_0242135 3300046492 Bacteria 903
316 Ga0495594_0008361 3300046499 Bacteria 5331
317 Ga0495643_0003757 3300046522 Bacteria 10986
318 Ga0495663_0190643 3300046525 Bacteria 713
319 Ga0495666_0436629 3300046526 Bacteria 587
320 Ga0495640_0540964 3300046533 Bacteria 707
321 Ga0495621_0091220 3300046539 Bacteria 1148
322 Ga0495656_0290884 3300046615 Bacteria 835
323 Ga0495659_0449427 3300046664 Bacteria 561
324 Ga0495588_0098447 3300046674 Bacteria 1535
325 Ga0495658_0072843 3300046683 Bacteria 1999
326 Ga0495613_0346128 3300046689 Bacteria 1022
327 Ga0495670_0532453 3300046691 Bacteria 639
328 Ga0495684_0702188 3300047471 Bacteria 671
329 Ga0496101_0477200 3300048904 Bacteria 985
330 Ga0496102_1655920 3300048905 Bacteria 558
331 Ga0496104_0088650 3300048907 Bacteria 2956
332 Ga0496104_0341782 3300048907 Bacteria 1410
333 Ga0496105_0189703 3300048908 Bacteria 1681
334 Ga0496106_0662125 3300048909 Bacteria 834
335 Ga0496107_0024003 3300048910 Bacteria 4311
336 Ga0496108_0102451 3300048911 Bacteria 2443
337 Ga0496108_0582685 3300048911 Bacteria 975
338 Ga0496109_0063134 3300048912 Bacteria 3388
339 Ga0496113_1518485 3300048916 Bacteria 517
340 Ga0496114_0280078 3300048917 Bacteria 1470
341 Ga0496114_1229502 3300048917 Bacteria 635
342 Ga0501031_0070599 3300049568 Bacteria 2275
343 Ga0501036_0030104 3300049572 Bacteria 4586
344 Ga0501038_0142990 3300049574 Bacteria 1956
345 Ga0501039_0094609 3300049575 Bacteria 2329
346 Ga0501042_0572106 3300049578 Bacteria 821
347 Ga0501043_0969321 3300049579 Bacteria 607
348 Ga0501046_0070981 3300049580 Bacteria 2707
349 Ga0501047_0478641 3300049581 Bacteria 1073
350 Ga0501048_0030380 3300049582 Bacteria 3909
351 Ga0501070_0755906 3300049586 Bacteria 766
352 Ga0501071_0108858 3300049587 Bacteria 2047
353 Ga0501071_1127482 3300049587 Bacteria 606
354 Ga0501072_0174367 3300049588 Bacteria 1716
355 Ga0501072_0821225 3300049588 Bacteria 727
356 Ga0501073_0645400 3300049589 Bacteria 731
357 Ga0501074_0125619 3300049590 Bacteria 1835
358 Ga0501074_0614000 3300049590 Bacteria 769
359 Ga0501075_0031325 3300049591 Bacteria 3946
360 Ga0501076_0014424 3300049592 Bacteria 5952
361 Ga0501077_0881391 3300049593 Bacteria 576
362 Ga0501243_086426 3300049675 Bacteria 617
363 Ga0501079_0887282 3300049741 Bacteria 702
364 Ga0501081_0058990 3300049743 Bacteria 2656
365 Ga0501081_0089880 3300049743 Bacteria 2158
366 Ga0501045_0028773 3300049824 Bacteria 4010
367 Ga0501045_0530018 3300049824 Bacteria 874
368 nmdc:mga05p37_108910_c1 3300050507 Bacteria 3408
369 nmdc:mga05p37_148783_c1 3300050507 Bacteria 2866
370 nmdc:mga05p37_229903_c1 3300050507 Bacteria 2235
371 nmdc:mga05p37_363138_c1 3300050507 Bacteria 1702
372 nmdc:mga09592_121216_c1 3300050508 Bacteria 2247
373 nmdc:mga09592_15411_c1 3300050508 Bacteria 6245
374 nmdc:mga0qj67_224979_c1 3300050509 Bacteria 1523
375 nmdc:mga06r32_1080667_c1 3300050510 Unclassified 752
376 nmdc:mga06r32_178118_c1 3300050510 Bacteria 2111
377 nmdc:mga06r32_36652_c1 3300050510 Bacteria 4636
378 nmdc:mga06r32_885958_c1 3300050510 Bacteria 850
379 nmdc:mga08y16_163758_c1 3300050511 Bacteria 2310
380 nmdc:mga08y16_18114_c1 3300050511 Bacteria 7419
381 nmdc:mga08y16_209_c1 3300050511 Bacteria 52522
382 nmdc:mga08y16_2571_c1 3300050511 Bacteria 18666
383 nmdc:mga08y16_26160_c1 3300050511 Bacteria 6154
384 nmdc:mga08y16_422571_c1 3300050511 Bacteria 1362
385 nmdc:mga08y16_555902_c1 3300050511 Bacteria 1161
386 nmdc:mga0n895_1217282_c1 3300050512 Bacteria 726
387 nmdc:mga0n895_25914_c1 3300050512 Bacteria 5545
388 nmdc:mga0a205_167375_c1 3300050515 Bacteria 2094
389 nmdc:mga0a205_239990_c1 3300050515 Bacteria 1693
390 nmdc:mga0a205_26181_c2 3300050515 Bacteria 3904
391 Ga0495601_0615638 3300053077 Bacteria 696
392 Ga0495595_0075532 3300053084 Unclassified 1599
393 Ga0495619_0078616 3300053085 Bacteria 2218
394 Ga0495619_0469739 3300053085 Bacteria 866
395 Ga0500556_0014340 3300053104 Bacteria 2418
396 Ga0501084_0121287 3300054114 Bacteria 2198
397 Ga0501082_0357838 3300060353 Bacteria 1273
398 Ga0501082_0449839 3300060353 Bacteria 1125
399 Ga0501082_1030520 3300060353 Bacteria 720
400 Ga0501082_1040806 3300060353 Bacteria 716
401 Ga0530510_0016510 3300061734 Bacteria 5228
402 Ga0373936_0101248
403 JGI24739J22299_10115297
404 JGI24748J21848_1000002
405 JGI24034J26672_10000004
406 JGI24742J22300_10013274
407 JGI25406J46586_10047514
408 Ga0065712_10123320
409 Ga0065712_10130322
410 Ga0065712_10328254
411 Ga0065715_10120475
412 Ga0065715_10174572
413 Ga0065715_10181077
414 Ga0065715_10320794
415 Ga0065707_10467065
416 Ga0065707_10843671
417 Ga0065707_11125706
418 Ga0070676_10158847
419 Ga0070676_10165392
420 Ga0070676_10400300
421 Ga0070683_100017848
422 Ga0070690_100265841
423 Ga0070690_100859165
424 Ga0070670_100251110
425 Ga0068869_100036834
426 Ga0070666_10158573
427 Ga0070666_10213372
428 Ga0070666_10374840
429 Ga0068868_100050694
430 Ga0068868_100195281
431 Ga0070687_100145442
432 Ga0070692_10192079
433 Ga0070668_100148241
434 Ga0070669_100005896
435 Ga0070669_100646451
436 Ga0070669_100820603
437 Ga0070675_100079359
438 Ga0070671_100079256
439 Ga0070671_100082810
440 Ga0070671_100233017
441 Ga0070671_100406895
442 Ga0070674_100576195
443 Ga0070673_100668488
444 Ga0070673_101335503
445 Ga0070688_100014591
446 Ga0070688_100567690
447 Ga0070667_100015693
448 Ga0070667_100610681
449 Ga0070713_101325135
450 Ga0070701_10551234
451 Ga0070711_100039057
452 Ga0070700_100204968
453 Ga0070700_100326589
454 Ga0070694_100297341
455 Ga0070694_100793593
456 Ga0070678_100032412
457 Ga0070678_101495496
458 Ga0070662_100050108
459 Ga0070662_100896506
460 Ga0068867_102396345
461 Ga0070685_10582787
462 Ga0070706_100001542
463 Ga0070706_100985321
464 Ga0070707_100285721
465 Ga0070707_100330057
466 Ga0070707_100609828
467 Ga0070699_100150958
468 Ga0070699_100775084
469 Ga0070672_100079956
470 Ga0070672_100084750
471 Ga0070672_100106626
472 Ga0070672_100178070
473 Ga0070672_100533012
474 Ga0070686_100012918
475 Ga0070686_100044666
476 Ga0070686_100064717
477 Ga0070665_100002487
478 Ga0070665_100178750
479 Ga0070665_100355940
480 Ga0070665_101642942
481 Ga0070704_100055587
482 Ga0070704_100407329
483 Ga0070664_100038614
484 Ga0070664_100089595
485 Ga0068857_100147097
486 Ga0068854_100065200
487 Ga0070702_100077288
488 Ga0070702_100471019
489 Ga0068859_100303261
490 Ga0068859_100766876
491 Ga0068859_100934421
492 Ga0068859_101230811
493 Ga0068864_100265322
494 Ga0068864_100302307
495 Ga0068866_10020263
496 Ga0068861_100024425
497 Ga0068870_10543518
498 Ga0068863_100401495
499 Ga0068858_100000105
500 Ga0068858_100136851
501 Ga0068858_100528542
502 Ga0068860_100707199
503 Ga0068860_101743894
504 Ga0068862_100008018
505 Ga0068862_100471927
506 Ga0081455_10105262
507 Ga0081539_10000228
508 Ga0070717_10230651
509 Ga0075432_10211823
510 Ga0097621_100053621
511 Ga0097621_100064769
512 Ga0097621_100544533
513 Ga0068871_100009359
514 Ga0068871_100545659
515 Ga0075428_100281160
516 Ga0075430_100041459
517 Ga0075430_100124394
518 Ga0075431_100267246
519 Ga0075431_100967289
520 Ga0075433_10063546
521 Ga0075433_10310420
522 Ga0075433_10390303
523 Ga0075434_100007428
524 Ga0075434_100147549
525 Ga0075434_101090905
526 Ga0075429_100049879
527 Ga0075429_100056704
528 Ga0075429_100162246
529 Ga0075429_100243616
530 Ga0075429_101085496
531 Ga0068865_100366466
532 Ga0097620_100303256
533 Ga0097620_100766970
534 Ga0097620_100934470
535 Ga0097620_101230911
536 Ga0075435_101005929
537 Ga0111539_10000733
538 Ga0111539_10001399
539 Ga0111539_10007259
540 Ga0111539_10025066
541 Ga0111539_10155429
542 Ga0111539_10194010
543 Ga0111539_10577995
544 Ga0111539_10853166
545 Ga0105245_10007446
546 Ga0105245_10821147
547 Ga0105245_11520626
548 Ga0105247_10000005
549 Ga0114129_10048978
550 Ga0114129_10092475
551 Ga0114129_10426691
552 Ga0105243_11155867
553 Ga0105242_10004233
554 Ga0105242_10155602
555 Ga0105242_11753864
556 Ga0105248_10007272
557 Ga0105248_10015287
558 Ga0105248_10039551
559 Ga0105248_11143220
560 Ga0105238_10866579
561 Ga0105249_10071449
562 Ga0105239_10008279
563 Ga0105246_11578859
564 Ga0157371_10093885
565 Ga0157370_12036167
566 Ga0157374_11018718
567 Ga0157378_10556436
568 Ga0157378_10592189
569 Ga0163162_10538241
570 Ga0157375_10165274
571 Ga0163163_10010383
572 Ga0163163_10267731
573 Ga0157380_10995339
574 Ga0157377_10024073
575 Ga0157377_10590301
576 Ga0157379_10021815
577 Ga0157379_10085840
578 Ga0157379_10375094
579 Ga0157379_10771635
580 Ga0157379_11431065
581 Ga0157376_10015817
582 Ga0157376_10918940
583 Ga0163161_10573056
584 Ga0207672_1000410
585 Ga0207697_10002895
586 Ga0207697_10107511
587 Ga0207710_10000004
588 Ga0207688_10057584
589 Ga0207688_10186373
590 Ga0207680_10173410
591 Ga0207680_10249629
592 Ga0207645_10165664
593 Ga0207684_10013030
594 Ga0207693_10146022
595 Ga0207663_10065489
596 Ga0207662_10070065
597 Ga0207662_10558066
598 Ga0207662_10668403
599 Ga0207646_10225509
600 Ga0207646_11334541
601 Ga0207681_10002998
602 Ga0207681_10011878
603 Ga0207650_10163342
604 Ga0207650_10335651
605 Ga0207700_10783064
606 Ga0207644_10000362
607 Ga0207644_10085507
608 Ga0207644_10100293
609 Ga0207644_10111681
610 Ga0207706_10740285
611 Ga0207686_10299502
612 Ga0207709_10815338
613 Ga0207670_10127470
614 Ga0207669_10064408
615 Ga0207669_10376881
616 Ga0207704_10008826
617 Ga0207704_10016812
618 Ga0207665_10418530
619 Ga0207691_10021539
620 Ga0207691_10111783
621 Ga0207691_10216043
622 Ga0207691_10341498
623 Ga0207711_10030554
624 Ga0207711_10124825
625 Ga0207711_10637937
626 Ga0207711_10796575
627 Ga0207689_10023051
628 Ga0207661_10052656
629 Ga0207679_10077692
630 Ga0207679_10141138
631 Ga0207651_10058094
632 Ga0207651_10400465
633 Ga0207651_10666873
634 Ga0207712_10129444
635 Ga0207668_10144558
636 Ga0207668_10301680
637 Ga0207640_10187109
638 Ga0207658_10022624
639 Ga0207658_10212906
640 Ga0207658_10550519
641 Ga0207677_10063790
642 Ga0207677_10627886
643 Ga0207703_10000127
644 Ga0207703_10321457
645 Ga0207678_10032332
646 Ga0207678_11660270
647 Ga0207708_10213396
648 Ga0207708_10640261
649 Ga0207708_11151604
650 Ga0207641_10188918
651 Ga0207648_10088793
652 Ga0207648_11021774
653 Ga0207676_10337116
654 Ga0207675_100002879
655 Ga0207675_100383830
656 Ga0207675_101098164
657 Ga0207683_10060030
658 Ga0207683_10296272
659 Ga0207683_10687035
660 Ga0207683_11111675
661 Ga0209971_1146620
662 Ga0207428_10001313
663 Ga0207428_10026516
664 Ga0207428_10033816
665 Ga0207428_10328006
666 Ga0207428_10372113
667 Ga0268266_10173742
668 Ga0268266_10197645
669 Ga0268266_10349297
670 Ga0268265_10183603
671 Ga0268265_10324572
672 Ga0268265_10407156
673 Ga0268264_10893772
674 Ga0268264_11146898
675 Ga0265323_10000235
676 Ga0265316_10060941
677 Ga0307408_100251583
678 Ga0307405_10078228
679 Ga0307405_10618845
680 Ga0307413_10072439
681 Ga0307410_10204658
682 Ga0307410_10282910
683 Ga0307410_12089941
684 Ga0307406_11408822
685 Ga0307407_10824342
686 Ga0307412_10139237
687 Ga0307412_10198222
688 Ga0307409_100163285
689 Ga0307409_100167246
690 Ga0307416_100108867
691 Ga0307416_100147038
692 Ga0307416_100266549
693 Ga0307416_101449901
694 Ga0307414_10212005
695 Ga0307414_10252764
696 Ga0307414_10283168
697 Ga0307414_10506329
698 Ga0307411_10335072
699 Ga0307411_10773106
700 Ga0373939_0302162
701 Ga0373953_0175187
702 Ga0373962_0088714
703 Ga0373931_0144357
704 Ga0373933_0229945
705 Ga0373937_0274598
706 Ga0373937_0642970
707 Ga0436360_0572392
708 Ga0451802_1469144
709 Ga0439464_0092936
710 Ga0451577_0165369
711 Ga0453683_0860458
712 Ga0453684_0489785
713 Ga0451576_1868285
714 Ga0495653_0831052
715 Ga0495662_0425564
716 Ga0495585_0242135
717 Ga0495594_0008361
718 Ga0495643_0003757
719 Ga0495663_0190643
720 Ga0495666_0436629
721 Ga0495640_0540964
722 Ga0495621_0091220
723 Ga0495656_0290884
724 Ga0495659_0449427
725 Ga0495588_0098447
726 Ga0495658_0072843
727 Ga0495613_0346128
728 Ga0495670_0532453
729 Ga0495684_0702188
730 Ga0496101_0477200
731 Ga0496102_1655920
732 Ga0496104_0088650
733 Ga0496104_0341782
734 Ga0496105_0189703
735 Ga0496106_0662125
736 Ga0496107_0024003
737 Ga0496108_0102451
738 Ga0496108_0582685
739 Ga0496109_0063134
740 Ga0496113_1518485
741 Ga0496114_0280078
742 Ga0496114_1229502
743 Ga0501031_0070599
744 Ga0501036_0030104
745 Ga0501038_0142990
746 Ga0501039_0094609
747 Ga0501042_0572106
748 Ga0501043_0969321
749 Ga0501046_0070981
750 Ga0501047_0478641
751 Ga0501048_0030380
752 Ga0501070_0755906
753 Ga0501071_0108858
754 Ga0501071_1127482
755 Ga0501072_0174367
756 Ga0501072_0821225
757 Ga0501073_0645400
758 Ga0501074_0125619
759 Ga0501074_0614000
760 Ga0501075_0031325
761 Ga0501076_0014424
762 Ga0501077_0881391
763 Ga0501243_086426
764 Ga0501079_0887282
765 Ga0501081_0058990
766 Ga0501081_0089880
767 Ga0501045_0028773
768 Ga0501045_0530018
769 nmdc:mga05p37_108910_c1
770 nmdc:mga05p37_148783_c1
771 nmdc:mga05p37_229903_c1
772 nmdc:mga05p37_363138_c1
773 nmdc:mga09592_121216_c1
774 nmdc:mga09592_15411_c1
775 nmdc:mga0qj67_224979_c1
776 nmdc:mga06r32_1080667_c1
777 nmdc:mga06r32_178118_c1
778 nmdc:mga06r32_36652_c1
779 nmdc:mga06r32_885958_c1
780 nmdc:mga08y16_163758_c1
781 nmdc:mga08y16_18114_c1
782 nmdc:mga08y16_209_c1
783 nmdc:mga08y16_2571_c1
784 nmdc:mga08y16_26160_c1
785 nmdc:mga08y16_422571_c1
786 nmdc:mga08y16_555902_c1
787 nmdc:mga0n895_1217282_c1
788 nmdc:mga0n895_25914_c1
789 nmdc:mga0a205_167375_c1
790 nmdc:mga0a205_239990_c1
791 nmdc:mga0a205_26181_c2
792 Ga0495601_0615638
793 Ga0495595_0075532
794 Ga0495619_0078616
795 Ga0495619_0469739
796 Ga0500556_0014340
797 Ga0501084_0121287
798 Ga0501082_0357838
799 Ga0501082_0449839
800 Ga0501082_1030520
801 Ga0501082_1040806
802 Ga0530510_0016510

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01741

MscL

Large-conductance mechanosensitive channel, MscL

11

145

0.89

Map