F434882

General Info

Members Datasets Scaffolds Average Seq Length
401 209 394 163

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100454692|Ga0307416_1004546922
Length 191
Sequence MVTPLRPPVTNPAESPAGRRTSDGSTSEAWGIAASVLDPEVPVLTIEDLGILRDVGVVPGGGVVVTITPTYSGCPAMESIRSDILAAFAEAGWRDVRVEFVLAPAWTTDWISDEGRRKLEEFGIAPPVRRGLDRLDHPGGSSGSVLLRLSLRCPQCGSPDTRELSRFGSTACKSLWVCNACREPFDHFKAI

Samples

Sample ID Description Type Environment
1 2643221561 Nocardioides sp. Root151 Isolate Unclassified
2 2643221615 Nocardioides sp. Root224 Isolate Unclassified
3 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
4 2643221679 Angustibacter sp. Root456 Isolate Unclassified
5 2643221696 Nocardioides sp. Root140 Isolate Unclassified
6 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
113 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
114 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
118 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
119 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
120 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
121 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
122 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
123 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
124 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
125 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
128 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
129 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
130 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
131 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
132 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
133 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
134 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
142 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
143 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
144 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
145 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
146 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
147 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
148 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
149 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
154 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
155 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
165 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
166 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
180 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
181 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
182 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
183 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
188 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
189 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
190 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
191 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
192 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
195 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
200 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
203 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
204 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
205 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
208 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
209 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.76
Metatranscriptomes 0.5
Isolates 1.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.49
Nodule 0
Rhizoplane 12.22
Rhizosphere 82.29
Stem 0
Stem Tuber 0
Unclassified 2.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10024918 3300002067 Bacteria 1807
2 Ga0006562J51391_1111915 3300003578 Bacteria 26433
3 Ga0006562J51391_1111917 3300003578 Bacteria 16790
4 Ga0070658_10224393 3300005327 Bacteria 1590
5 Ga0070683_100005477 3300005329 Bacteria 10604
6 Ga0070683_100229961 3300005329 Bacteria 1763
7 Ga0070683_100536174 3300005329 Bacteria 1119
8 Ga0070683_100980812 3300005329 Bacteria 811
9 Ga0070682_100689581 3300005337 Bacteria 818
10 Ga0070682_100834287 3300005337 Bacteria 752
11 Ga0068868_100257291 3300005338 Bacteria 1471
12 Ga0070660_100001482 3300005339 Bacteria 16068
13 Ga0070660_100150940 3300005339 Bacteria 1868
14 Ga0070691_10750141 3300005341 Bacteria 590
15 Ga0070687_100083035 3300005343 Bacteria 1753
16 Ga0070687_100790906 3300005343 Bacteria 671
17 Ga0070675_100925905 3300005354 Bacteria 799
18 Ga0070674_101558105 3300005356 Bacteria 595
19 Ga0070659_100012665 3300005366 Bacteria 6257
20 Ga0070659_100064662 3300005366 Bacteria 2896
21 Ga0070659_100556620 3300005366 Bacteria 982
22 Ga0070667_100297389 3300005367 Bacteria 1453
23 Ga0070700_100765195 3300005441 Bacteria 774
24 Ga0070678_100058101 3300005456 Bacteria 2838
25 Ga0070681_10261995 3300005458 Bacteria 1641
26 Ga0070681_10898700 3300005458 Bacteria 804
27 Ga0070685_10262603 3300005466 Bacteria 1149
28 Ga0070679_100020128 3300005530 Bacteria 6502
29 Ga0070679_100528231 3300005530 Bacteria 1124
30 Ga0070684_100019709 3300005535 Bacteria 5583
31 Ga0070684_100420903 3300005535 Bacteria 1233
32 Ga0070684_100571844 3300005535 Bacteria 1050
33 Ga0070686_101055297 3300005544 Bacteria 669
34 Ga0070665_100000865 3300005548 Bacteria 39234
35 Ga0070665_100922940 3300005548 Bacteria 886
36 Ga0068855_100627253 3300005563 Bacteria 1157
37 Ga0068855_100813477 3300005563 Bacteria 992
38 Ga0068857_100039063 3300005577 Bacteria 4203
39 Ga0068856_100038638 3300005614 Bacteria 4686
40 Ga0070702_100046343 3300005615 Bacteria 2464
41 Ga0068852_100016940 3300005616 Bacteria 5701
42 Ga0068852_100110231 3300005616 Bacteria 2501
43 Ga0068852_100265368 3300005616 Bacteria 1650
44 Ga0068864_100974528 3300005618 Bacteria 840
45 Ga0068866_10067374 3300005718 Bacteria 1879
46 Ga0068851_10000008 3300005834 Bacteria 231006
47 Ga0068858_100000096 3300005842 Bacteria 91762
48 Ga0068862_100087322 3300005844 Bacteria 2713
49 Ga0081455_10644245 3300005937 Bacteria 683
50 Ga0075365_10115466 3300006038 Bacteria 1848
51 Ga0075364_10439841 3300006051 Bacteria 891
52 Ga0075366_10258637 3300006195 Bacteria 1062
53 Ga0097621_101156606 3300006237 Bacteria 728
54 Ga0068871_101499534 3300006358 Bacteria 637
55 Ga0075428_100596553 3300006844 Bacteria 1180
56 Ga0068865_100090578 3300006881 Bacteria 2218
57 Ga0105240_10294970 3300009093 Bacteria 1857
58 Ga0111539_11512581 3300009094 Bacteria 778
59 Ga0105245_10004166 3300009098 Bacteria 12841
60 Ga0105245_10396797 3300009098 Bacteria 1377
61 Ga0105247_10141056 3300009101 Bacteria 1579
62 Ga0105247_10162148 3300009101 Bacteria 1481
63 Ga0105247_10217982 3300009101 Bacteria 1290
64 Ga0105243_10115319 3300009148 Bacteria 2255
65 Ga0105243_10886890 3300009148 Bacteria 886
66 Ga0105242_10795165 3300009176 Bacteria 936
67 Ga0105248_10000713 3300009177 Bacteria 37644
68 Ga0105248_10016623 3300009177 Bacteria 8100
69 Ga0105237_10000688 3300009545 Bacteria 46838
70 Ga0105237_10696238 3300009545 Bacteria 1023
71 Ga0105238_10006337 3300009551 Bacteria 11764
72 Ga0105238_10866514 3300009551 Bacteria 921
73 Ga0105249_10133403 3300009553 Bacteria 2373
74 Ga0105249_11357629 3300009553 Bacteria 783
75 Ga0105239_10003785 3300010375 Bacteria 18414
76 Ga0105239_10420727 3300010375 Bacteria 1513
77 Ga0105246_10003879 3300011119 Bacteria 9062
78 Ga0105246_10074753 3300011119 Bacteria 2396
79 Ga0105246_11090750 3300011119 Bacteria 728
80 Ga0157371_10272020 3300013102 Bacteria 1223
81 Ga0157370_10540997 3300013104 Bacteria 1068
82 Ga0157369_10218588 3300013105 Bacteria 1995
83 Ga0157374_11302627 3300013296 Bacteria 749
84 Ga0157378_11366770 3300013297 Bacteria 751
85 Ga0163162_10046206 3300013306 Bacteria 4364
86 Ga0157372_10022310 3300013307 Bacteria 6848
87 Ga0157372_10372264 3300013307 Bacteria 1664
88 Ga0157372_12194567 3300013307 Bacteria 634
89 Ga0157375_10770562 3300013308 Bacteria 1112
90 Ga0157375_10925264 3300013308 Bacteria 1015
91 Ga0157375_11357882 3300013308 Bacteria 836
92 Ga0157375_12284646 3300013308 Bacteria 645
93 Ga0163163_10551174 3300014325 Bacteria 1215
94 Ga0157380_10442206 3300014326 Bacteria 1246
95 Ga0157377_11039819 3300014745 Bacteria 623
96 Ga0157379_10055035 3300014968 Bacteria 3555
97 Ga0157379_10383687 3300014968 Bacteria 1289
98 Ga0157379_11941400 3300014968 Bacteria 581
99 Ga0157376_10286175 3300014969 Bacteria 1554
100 Ga0163161_10360801 3300017792 Bacteria 1157
101 Ga0163161_10740794 3300017792 Bacteria 821
102 Ga0209148_1018783 3300025254 Bacteria 1157
103 Ga0207656_10000005 3300025321 Bacteria 490514
104 Ga0207642_10572771 3300025899 Bacteria 700
105 Ga0207688_10057408 3300025901 Bacteria 2188
106 Ga0207688_10114442 3300025901 Bacteria 1569
107 Ga0207647_10012942 3300025904 Bacteria 5798
108 Ga0207647_10034671 3300025904 Bacteria 3220
109 Ga0207705_10005614 3300025909 Bacteria 9370
110 Ga0207707_10139837 3300025912 Bacteria 2117
111 Ga0207671_10000016 3300025914 Bacteria 435413
112 Ga0207662_10107305 3300025918 Bacteria 1737
113 Ga0207657_10007618 3300025919 Bacteria 11079
114 Ga0207657_10140063 3300025919 Bacteria 1977
115 Ga0207657_10213435 3300025919 Bacteria 1548
116 Ga0207652_10055237 3300025921 Bacteria 3415
117 Ga0207652_10204530 3300025921 Bacteria 1777
118 Ga0207652_10421606 3300025921 Bacteria 1204
119 Ga0207694_10000196 3300025924 Bacteria 60714
120 Ga0207694_10707478 3300025924 Bacteria 850
121 Ga0207690_10067939 3300025932 Bacteria 2447
122 Ga0207690_10634293 3300025932 Bacteria 874
123 Ga0207706_10557498 3300025933 Bacteria 986
124 Ga0207669_10459227 3300025937 Bacteria 1011
125 Ga0207704_10328115 3300025938 Bacteria 1183
126 Ga0207704_10448327 3300025938 Bacteria 1029
127 Ga0207704_10559507 3300025938 Bacteria 931
128 Ga0207711_10002484 3300025941 Bacteria 16451
129 Ga0207711_10438007 3300025941 Bacteria 1216
130 Ga0207661_10011900 3300025944 Bacteria 6318
131 Ga0207661_10045532 3300025944 Bacteria 3473
132 Ga0207661_10146840 3300025944 Bacteria 2035
133 Ga0207661_10220304 3300025944 Bacteria 1677
134 Ga0207661_10330175 3300025944 Bacteria 1373
135 Ga0207667_10091497 3300025949 Bacteria 3142
136 Ga0207667_10777415 3300025949 Bacteria 955
137 Ga0207667_10852153 3300025949 Bacteria 905
138 Ga0207677_10314955 3300026023 Bacteria 1298
139 Ga0207703_10000156 3300026035 Bacteria 78672
140 Ga0207678_10512493 3300026067 Bacteria 1046
141 Ga0207702_10121631 3300026078 Bacteria 2337
142 Ga0207702_10996587 3300026078 Bacteria 831
143 Ga0207641_10151123 3300026088 Bacteria 2103
144 Ga0207676_10008379 3300026095 Bacteria 7348
145 Ga0207676_10159992 3300026095 Bacteria 1950
146 Ga0207674_10000405 3300026116 Bacteria 55884
147 Ga0207674_10009443 3300026116 Bacteria 11145
148 Ga0207675_100011002 3300026118 Bacteria 8474
149 Ga0207683_10073636 3300026121 Bacteria 3021
150 Ga0207683_10449217 3300026121 Bacteria 1188
151 Ga0207698_10062453 3300026142 Bacteria 2909
152 Ga0207698_10080609 3300026142 Bacteria 2623
153 Ga0207698_10083931 3300026142 Bacteria 2580
154 Ga0207698_11406284 3300026142 Bacteria 713
155 Ga0268266_10001168 3300028379 Bacteria 32486
156 Ga0268265_10123790 3300028380 Bacteria 2136
157 Ga0268264_11224372 3300028381 Bacteria 760
158 Ga0307405_10063688 3300031731 Bacteria 2340
159 Ga0307405_10227399 3300031731 Bacteria 1373
160 Ga0307413_10158105 3300031824 Bacteria 1589
161 Ga0307410_10195742 3300031852 Bacteria 1540
162 Ga0307410_10264358 3300031852 Bacteria 1343
163 Ga0307410_10427079 3300031852 Bacteria 1076
164 Ga0307406_10163997 3300031901 Bacteria 1601
165 Ga0307407_10320140 3300031903 Bacteria 1088
166 Ga0307412_10102668 3300031911 Bacteria 2025
167 Ga0307412_10402982 3300031911 Bacteria 1114
168 Ga0307409_100048526 3300031995 Bacteria 3232
169 Ga0307409_100051262 3300031995 Bacteria 3157
170 Ga0307409_100075795 3300031995 Bacteria 2695
171 Ga0307409_100153240 3300031995 Bacteria 2004
172 Ga0307409_100192192 3300031995 Bacteria 1818
173 Ga0307409_100626600 3300031995 Bacteria 1066
174 Ga0307416_100454692 3300032002 Bacteria 1334
175 Ga0307416_100525287 3300032002 Bacteria 1252
176 Ga0307416_100557138 3300032002 Bacteria 1220
177 Ga0307416_100568794 3300032002 Bacteria 1209
178 Ga0307416_100738345 3300032002 Bacteria 1076
179 Ga0307414_10986913 3300032004 Bacteria 775
180 Ga0307414_11647762 3300032004 Bacteria 598
181 Ga0307411_10044566 3300032005 Bacteria 2847
182 Ga0307411_10472680 3300032005 Bacteria 1054
183 Ga0307415_100010735 3300032126 Bacteria 5203
184 Ga0307415_100084456 3300032126 Bacteria 2278
185 Ga0307415_100323620 3300032126 Bacteria 1287
186 Ga0307415_100455892 3300032126 Bacteria 1107
187 Ga0307415_101507159 3300032126 Bacteria 643
188 Ga0395898_0091037 3300037466 Bacteria 2935
189 Ga0395901_0059059 3300038443 Bacteria 3990
190 Ga0395901_0292089 3300038443 Bacteria 1691
191 Ga0439438_028223 3300041405 Bacteria 1511
192 Ga0451793_1918891 3300041452 Bacteria 741
193 Ga0451833_0948827 3300041491 Bacteria 739
194 Ga0451851_0299830 3300041507 Bacteria 698
195 Ga0451853_1753908 3300041512 Bacteria 2175
196 Ga0439431_0042149 3300041997 Bacteria 1165
197 Ga0439446_0003731 3300042156 Bacteria 3806
198 Ga0439434_0008552 3300042435 Bacteria 3003
199 Ga0451577_0222110 3300042876 Bacteria 1708
200 Ga0466966_0031355 3300044684 Bacteria 3448
201 Ga0466961_0061756 3300044693 Bacteria 2381
202 Ga0466961_0418584 3300044693 Bacteria 812
203 Ga0466963_0082556 3300044694 Bacteria 2179
204 Ga0466963_0199686 3300044694 Bacteria 1399
205 Ga0466963_0230263 3300044694 Bacteria 1298
206 Ga0466963_1214196 3300044694 Bacteria 530
207 Ga0466964_0426033 3300044706 Bacteria 699
208 Ga0453684_1457997 3300044712 Bacteria 708
209 Ga0466971_0054494 3300044719 Bacteria 1802
210 Ga0466957_0818450 3300044842 Bacteria 662
211 Ga0466960_0001472 3300044901 Bacteria 8579
212 Ga0466960_0404937 3300044901 Bacteria 786
213 Ga0466959_0045104 3300045049 Bacteria 3247
214 Ga0466959_0147627 3300045049 Bacteria 1659
215 Ga0451576_0123697 3300045051 Bacteria 2694
216 Ga0451576_0170193 3300045051 Bacteria 2274
217 Ga0466967_0008587 3300045976 Bacteria 7505
218 Ga0466967_0031186 3300045976 Bacteria 4484
219 Ga0466967_0038045 3300045976 Bacteria 4123
220 Ga0466967_0059306 3300045976 Bacteria 3387
221 Ga0466967_0174842 3300045976 Bacteria 2022
222 Ga0466967_0374464 3300045976 Bacteria 1381
223 Ga0466967_0669682 3300045976 Bacteria 1027
224 Ga0466967_0711552 3300045976 Bacteria 995
225 Ga0495603_0136249 3300046455 Bacteria 1429
226 Ga0495603_0333814 3300046455 Bacteria 870
227 Ga0495629_0197537 3300046459 Bacteria 1391
228 Ga0495641_0068333 3300046461 Bacteria 1598
229 Ga0495582_0036981 3300046473 Bacteria 2686
230 Ga0495664_0039428 3300046477 Bacteria 2791
231 Ga0495664_0924344 3300046477 Bacteria 509
232 Ga0495594_0549735 3300046499 Bacteria 655
233 Ga0495635_0101159 3300046663 Bacteria 1970
234 Ga0495657_0288120 3300046675 Bacteria 981
235 Ga0495647_0452493 3300046681 Bacteria 594
236 Ga0495684_0472726 3300047471 Bacteria 867
237 Ga0495602_0287384 3300048088 Bacteria 1209
238 Ga0496100_0368610 3300048903 Bacteria 1088
239 Ga0496100_0444826 3300048903 Bacteria 993
240 Ga0496101_0009135 3300048904 Bacteria 6506
241 Ga0496101_0034512 3300048904 Bacteria 3573
242 Ga0496101_0061827 3300048904 Bacteria 2721
243 Ga0496101_0831042 3300048904 Bacteria 728
244 Ga0496102_0010967 3300048905 Bacteria 7809
245 Ga0496102_0036573 3300048905 Bacteria 4424
246 Ga0496102_0164199 3300048905 Bacteria 2089
247 Ga0496102_0182697 3300048905 Bacteria 1976
248 Ga0496102_0455627 3300048905 Bacteria 1200
249 Ga0496103_0035568 3300048906 Bacteria 3050
250 Ga0496103_0140175 3300048906 Bacteria 1546
251 Ga0496104_0388301 3300048907 Bacteria 1308
252 Ga0496105_0007027 3300048908 Bacteria 8671
253 Ga0496105_0013575 3300048908 Bacteria 6470
254 Ga0496106_0075942 3300048909 Bacteria 2575
255 Ga0496106_0144574 3300048909 Bacteria 1872
256 Ga0496106_0873189 3300048909 Bacteria 711
257 Ga0496106_1188106 3300048909 Bacteria 595
258 Ga0496107_0008412 3300048910 Bacteria 7140
259 Ga0496107_0181511 3300048910 Bacteria 1563
260 Ga0496108_0332453 3300048911 Bacteria 1325
261 Ga0496109_0011804 3300048912 Bacteria 7520
262 Ga0496109_0078553 3300048912 Bacteria 3039
263 Ga0496109_0176225 3300048912 Bacteria 2007
264 Ga0496109_0231014 3300048912 Bacteria 1740
265 Ga0496109_0235614 3300048912 Bacteria 1722
266 Ga0496109_0437186 3300048912 Bacteria 1236
267 Ga0496109_0607378 3300048912 Bacteria 1030
268 Ga0496109_1335217 3300048912 Bacteria 653
269 Ga0496110_0111004 3300048913 Bacteria 2464
270 Ga0496110_0516266 3300048913 Bacteria 1087
271 Ga0496111_0014076 3300048914 Bacteria 5456
272 Ga0496112_0449291 3300048915 Bacteria 1227
273 Ga0496113_0332545 3300048916 Bacteria 1218
274 Ga0496113_1178969 3300048916 Bacteria 599
275 Ga0496113_1489561 3300048916 Bacteria 522
276 Ga0496114_0003085 3300048917 Bacteria 12765
277 Ga0496114_0010211 3300048917 Bacteria 7471
278 Ga0496114_0122861 3300048917 Bacteria 2234
279 Ga0496114_0238204 3300048917 Bacteria 1600
280 Ga0496114_0370190 3300048917 Bacteria 1268
281 Ga0496114_0618065 3300048917 Bacteria 955
282 Ga0496114_0726127 3300048917 Bacteria 870
283 Ga0496114_0774515 3300048917 Bacteria 837
284 Ga0496115_0070473 3300048918 Bacteria 2834
285 Ga0496115_0288891 3300048918 Bacteria 1345
286 Ga0496126_0222974 3300048929 Bacteria 1582
287 Ga0501291_038684 3300049514 Bacteria 832
288 Ga0501031_0030554 3300049568 Bacteria 3514
289 Ga0501031_0032528 3300049568 Bacteria 3401
290 Ga0501031_0038386 3300049568 Bacteria 3125
291 Ga0501032_0071898 3300049569 Bacteria 2305
292 Ga0501033_0150990 3300049570 Bacteria 1676
293 Ga0501034_0066583 3300049571 Bacteria 3615
294 Ga0501034_0326928 3300049571 Bacteria 1465
295 Ga0501034_0476530 3300049571 Bacteria 1164
296 Ga0501034_0509335 3300049571 Bacteria 1116
297 Ga0501036_0002673 3300049572 Bacteria 14064
298 Ga0501036_0101747 3300049572 Bacteria 2431
299 Ga0501038_0096075 3300049574 Bacteria 2474
300 Ga0501039_0039828 3300049575 Bacteria 3628
301 Ga0501039_0164788 3300049575 Bacteria 1743
302 Ga0501039_0188375 3300049575 Bacteria 1623
303 Ga0501040_0050843 3300049576 Bacteria 2835
304 Ga0501041_0026626 3300049577 Bacteria 3479
305 Ga0501041_0129387 3300049577 Bacteria 1573
306 Ga0501042_0006535 3300049578 Bacteria 7575
307 Ga0501042_0340884 3300049578 Bacteria 1084
308 Ga0501042_0964605 3300049578 Bacteria 621
309 Ga0501043_0583648 3300049579 Bacteria 827
310 Ga0501046_0085625 3300049580 Bacteria 2430
311 Ga0501048_0032155 3300049582 Bacteria 3793
312 Ga0501048_0076842 3300049582 Bacteria 2357
313 Ga0501048_0193355 3300049582 Bacteria 1442
314 Ga0501067_0001116 3300049583 Bacteria 14530
315 Ga0501067_0001853 3300049583 Bacteria 11627
316 Ga0501067_0064758 3300049583 Bacteria 2023
317 Ga0501068_0066745 3300049584 Bacteria 2191
318 Ga0501068_0281988 3300049584 Bacteria 1062
319 Ga0501068_0489004 3300049584 Bacteria 798
320 Ga0501068_0510016 3300049584 Bacteria 780
321 Ga0501069_0018043 3300049585 Bacteria 3806
322 Ga0501069_0022664 3300049585 Bacteria 3419
323 Ga0501069_0036146 3300049585 Bacteria 2723
324 Ga0501069_0081066 3300049585 Bacteria 1828
325 Ga0501069_0092220 3300049585 Bacteria 1713
326 Ga0501069_0150248 3300049585 Bacteria 1338
327 Ga0501070_0003400 3300049586 Bacteria 13815
328 Ga0501070_0011977 3300049586 Bacteria 7322
329 Ga0501070_0013917 3300049586 Bacteria 6773
330 Ga0501070_0115733 3300049586 Bacteria 2214
331 Ga0501070_0231386 3300049586 Bacteria 1514
332 Ga0501070_0277278 3300049586 Bacteria 1368
333 Ga0501070_0415020 3300049586 Bacteria 1087
334 Ga0501071_0000493 3300049587 Bacteria 19987
335 Ga0501071_0004571 3300049587 Bacteria 8778
336 Ga0501071_0009400 3300049587 Bacteria 6511
337 Ga0501071_0039710 3300049587 Bacteria 3367
338 Ga0501071_0070551 3300049587 Bacteria 2545
339 Ga0501071_0917703 3300049587 Bacteria 676
340 Ga0501072_0011045 3300049588 Bacteria 6891
341 Ga0501072_0041168 3300049588 Bacteria 3628
342 Ga0501072_0081388 3300049588 Bacteria 2567
343 Ga0501072_0131544 3300049588 Bacteria 1994
344 Ga0501073_0005484 3300049589 Bacteria 9506
345 Ga0501073_0049977 3300049589 Bacteria 2931
346 Ga0501073_0123714 3300049589 Bacteria 1793
347 Ga0501074_0000838 3300049590 Bacteria 19549
348 Ga0501074_0005285 3300049590 Bacteria 9297
349 Ga0501074_0034672 3300049590 Bacteria 3658
350 Ga0501075_0079421 3300049591 Bacteria 2483
351 Ga0501075_0081759 3300049591 Bacteria 2446
352 Ga0501075_0627408 3300049591 Bacteria 820
353 Ga0501075_0718299 3300049591 Bacteria 761
354 Ga0501076_0775410 3300049592 Bacteria 791
355 Ga0501077_0010216 3300049593 Bacteria 5845
356 Ga0501077_0144653 3300049593 Bacteria 1508
357 Ga0501077_0340282 3300049593 Bacteria 957
358 Ga0501209_104451 3300049656 Bacteria 833
359 Ga0501217_125811 3300049661 Bacteria 748
360 Ga0501229_040821 3300049706 Bacteria 661
361 Ga0501079_0048457 3300049741 Bacteria 3278
362 Ga0501079_0246957 3300049741 Bacteria 1394
363 Ga0501079_0255993 3300049741 Bacteria 1368
364 Ga0501080_0022437 3300049742 Bacteria 5848
365 Ga0501080_0188954 3300049742 Bacteria 1893
366 Ga0501080_0225832 3300049742 Bacteria 1712
367 Ga0501083_0004571 3300049744 Bacteria 9774
368 Ga0501083_0078392 3300049744 Bacteria 2192
369 Ga0501035_0033679 3300049822 Bacteria 4657
370 Ga0501035_0288015 3300049822 Bacteria 1387
371 Ga0501044_0457504 3300049823 Bacteria 1182
372 Ga0501045_0516136 3300049824 Bacteria 887
373 Ga0501045_0583035 3300049824 Bacteria 829
374 nmdc:mga0yw44_36679_c1 3300050492 Bacteria 2890
375 nmdc:mga0yw44_80438_c1 3300050492 Bacteria 2041
376 nmdc:mga0yw44_972463_c1 3300050492 Bacteria 575
377 nmdc:mga0k408_122693_c1 3300050493 Bacteria 1540
378 nmdc:mga08y16_633128_c1 3300050511 Bacteria 1075
379 Ga0495655_0133815 3300053083 Bacteria 766
380 Ga0495619_0010703 3300053085 Bacteria 5776
381 Ga0500556_0001934 3300053104 Bacteria 7343
382 Ga0500620_312458 3300053155 Bacteria 506
383 Ga0501084_0008229 3300054114 Bacteria 8603
384 Ga0501084_0017393 3300054114 Bacteria 5977
385 Ga0501084_0244358 3300054114 Bacteria 1515
386 Ga0501082_0101926 3300060353 Bacteria 2483
387 Ga0501082_0159112 3300060353 Bacteria 1962
388 Ga0501082_0913505 3300060353 Bacteria 768
389 Ga0501082_1138415 3300060353 Bacteria 682
390 Ga0530510_0168579 3300061734 Bacteria 1621
391 Ga0530510_0256143 3300061734 Bacteria 1304
392 Ga0530510_0359358 3300061734 Bacteria 1094
393 Ga0530510_0417122 3300061734 Bacteria 1013
394 Ga0530510_0642309 3300061734 Bacteria 808

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005337 Ga0070682_100689581 Ga0070682_1006895811 138
2 3300005544 Ga0070686_101055297 Ga0070686_1010552972 138
3 3300009148 Ga0105243_10886890 Ga0105243_108868902 138
4 3300013307 Ga0157372_12194567 Ga0157372_121945671 138
5 3300048903 Ga0496100_0368610 Ga0496100_0368610_219_710 138
6 3300048904 Ga0496101_0009135 Ga0496101_0009135_4976_5467 138
7 3300048905 Ga0496102_0164199 Ga0496102_0164199_445_936 138
8 3300048906 Ga0496103_0035568 Ga0496103_0035568_891_1382 138
9 3300048909 Ga0496106_0144574 Ga0496106_0144574_1107_1598 138
10 3300048910 Ga0496107_0008412 Ga0496107_0008412_6179_6670 138
11 3300048911 Ga0496108_0332453 Ga0496108_0332453_541_1032 138
12 3300048912 Ga0496109_0078553 Ga0496109_0078553_366_857 138
13 3300048917 Ga0496114_0122861 Ga0496114_0122861_138_629 138
14 3300048918 Ga0496115_0288891 Ga0496115_0288891_16_507 138
15 3300009553 Ga0105249_10133403 Ga0105249_101334034 140
16 3300044694 Ga0466963_1214196 Ga0466963_1214196_43_468 140
17 3300044706 Ga0466964_0426033 Ga0466964_0426033_51_476 140
18 3300045976 Ga0466967_0374464 Ga0466967_0374464_12_437 140
19 3300045976 Ga0466967_0669682 Ga0466967_0669682_590_1015 140
20 3300046675 Ga0495657_0288120 Ga0495657_0288120_58_549 140
21 3300047471 Ga0495684_0472726 Ga0495684_0472726_25_516 140
22 3300048915 Ga0496112_0449291 Ga0496112_0449291_528_1019 140
23 3300048916 Ga0496113_0332545 Ga0496113_0332545_536_1027 140
24 3300048916 Ga0496113_1489561 Ga0496113_1489561_70_492 140
25 3300049591 Ga0501075_0627408 Ga0501075_0627408_11_436 140
26 3300053085 Ga0495619_0010703 Ga0495619_0010703_719_1210 140
27 3300048912 Ga0496109_0607378 Ga0496109_0607378_459_953 143
28 3300049591 Ga0501075_0718299 Ga0501075_0718299_287_724 145
29 3300013297 Ga0157378_11366770 Ga0157378_113667702 146
30 3300013308 Ga0157375_10770562 Ga0157375_107705622 146
31 3300026078 Ga0207702_10996587 Ga0207702_109965872 146
32 3300048904 Ga0496101_0061827 Ga0496101_0061827_1565_2062 146
33 3300048912 Ga0496109_0231014 Ga0496109_0231014_206_703 146
34 3300048917 Ga0496114_0774515 Ga0496114_0774515_110_607 146
35 3300032005 Ga0307411_10044566 Ga0307411_100445664 147
36 3300041491 Ga0451833_0948827 Ga0451833_0948827_156_695 147
37 3300048912 Ga0496109_0437186 Ga0496109_0437186_39_506 147
38 3300049583 Ga0501067_0064758 Ga0501067_0064758_74_517 147
39 3300049661 Ga0501217_125811 Ga0501217_125811_75_545 147
40 3300044694 Ga0466963_0230263 Ga0466963_0230263_502_999 148
41 3300005354 Ga0070675_100925905 Ga0070675_1009259052 149
42 3300026121 Ga0207683_10449217 Ga0207683_104492172 149
43 3300048917 Ga0496114_0238204 Ga0496114_0238204_233_736 149
44 3300048917 Ga0496114_0618065 Ga0496114_0618065_124_648 149
45 3300005535 Ga0070684_100420903 Ga0070684_1004209032 150
46 3300014745 Ga0157377_11039819 Ga0157377_110398191 150
47 3300032126 Ga0307415_100455892 Ga0307415_1004558922 150
48 3300053155 Ga0500620_312458 Ga0500620_312458_42_494 150
49 iso_pu_bacteria 2795385470 2795783143 151
50 3300017792 Ga0163161_10360801 Ga0163161_103608012 152
51 3300053104 Ga0500556_0001934 Ga0500556_0001934_3049_3519 152
52 3300048909 Ga0496106_0075942 Ga0496106_0075942_659_1156 153
53 3300005937 Ga0081455_10644245 Ga0081455_106442452 154
54 3300044684 Ga0466966_0031355 Ga0466966_0031355_1892_2389 154
55 3300044693 Ga0466961_0061756 Ga0466961_0061756_1564_2061 154
56 3300044719 Ga0466971_0054494 Ga0466971_0054494_451_948 154
57 3300045049 Ga0466959_0045104 Ga0466959_0045104_1757_2254 154
58 3300048904 Ga0496101_0034512 Ga0496101_0034512_2077_2610 154
59 3300048905 Ga0496102_0010967 Ga0496102_0010967_1800_2333 154
60 3300048908 Ga0496105_0007027 Ga0496105_0007027_5667_6200 154
61 3300048912 Ga0496109_0235614 Ga0496109_0235614_994_1527 154
62 3300048917 Ga0496114_0010211 Ga0496114_0010211_4701_5234 154
63 3300061734 Ga0530510_0417122 Ga0530510_0417122_402_950 154
64 iso_pu_bacteria 8056060235 8056063776 154
65 3300003578 Ga0006562J51391_1111915 Ga0006562J51391_11119159 155
66 3300003578 Ga0006562J51391_1111917 Ga0006562J51391_111191714 155
67 3300005842 Ga0068858_100000096 Ga0068858_10000009629 155
68 3300009545 Ga0105237_10000688 Ga0105237_1000068834 155
69 3300009551 Ga0105238_10006337 Ga0105238_100063374 155
70 3300010375 Ga0105239_10420727 Ga0105239_104207273 155
71 3300026035 Ga0207703_10000156 Ga0207703_1000015669 155
72 3300050492 nmdc:mga0yw44_80438_c1 nmdc:mga0yw44_80438_c1_1551_2021 155
73 3300061734 Ga0530510_0642309 Ga0530510_0642309_53_550 155
74 iso_pu_bacteria 2643221561 2643825462 155
75 iso_pu_bacteria 2643221696 2644531458 155
76 3300005329 Ga0070683_100980812 Ga0070683_1009808122 156
77 3300005466 Ga0070685_10262603 Ga0070685_102626031 156
78 3300006051 Ga0075364_10439841 Ga0075364_104398412 156
79 3300025944 Ga0207661_10146840 Ga0207661_101468401 156
80 3300041512 Ga0451853_1753908 Ga0451853_1753908_766_1269 156
81 iso_pu_bacteria 2643221615 2644089706 156
82 iso_pu_bacteria 2643221657 2644319551 156
83 3300005338 Ga0068868_100257291 Ga0068868_1002572912 157
84 3300005339 Ga0070660_100001482 Ga0070660_10000148213 157
85 3300005366 Ga0070659_100012665 Ga0070659_1000126651 157
86 3300005563 Ga0068855_100813477 Ga0068855_1008134772 157
87 3300009098 Ga0105245_10396797 Ga0105245_103967972 157
88 3300009101 Ga0105247_10217982 Ga0105247_102179822 157
89 3300009176 Ga0105242_10795165 Ga0105242_107951651 157
90 3300009177 Ga0105248_10000713 Ga0105248_1000071333 157
91 3300009553 Ga0105249_11357629 Ga0105249_113576292 157
92 3300011119 Ga0105246_10074753 Ga0105246_100747532 157
93 3300013296 Ga0157374_11302627 Ga0157374_113026272 157
94 3300013308 Ga0157375_10925264 Ga0157375_109252641 157
95 3300013308 Ga0157375_12284646 Ga0157375_122846462 157
96 3300025919 Ga0207657_10007618 Ga0207657_100076189 157
97 3300025932 Ga0207690_10634293 Ga0207690_106342932 157
98 3300025949 Ga0207667_10852153 Ga0207667_108521532 157
99 3300026088 Ga0207641_10151123 Ga0207641_101511233 157
100 3300026142 Ga0207698_11406284 Ga0207698_114062842 157
101 3300031911 Ga0307412_10402982 Ga0307412_104029822 157
102 3300044693 Ga0466961_0418584 Ga0466961_0418584_93_596 157
103 3300044694 Ga0466963_0082556 Ga0466963_0082556_503_979 157
104 3300045049 Ga0466959_0147627 Ga0466959_0147627_981_1484 157
105 3300045976 Ga0466967_0031186 Ga0466967_0031186_924_1400 157
106 3300046455 Ga0495603_0333814 Ga0495603_0333814_140_616 157
107 3300046477 Ga0495664_0039428 Ga0495664_0039428_1785_2261 157
108 3300046663 Ga0495635_0101159 Ga0495635_0101159_421_912 157
109 3300048088 Ga0495602_0287384 Ga0495602_0287384_538_1062 157
110 3300048904 Ga0496101_0831042 Ga0496101_0831042_40_567 157
111 3300048905 Ga0496102_0182697 Ga0496102_0182697_1271_1798 157
112 3300048905 Ga0496102_0455627 Ga0496102_0455627_16_492 157
113 3300048907 Ga0496104_0388301 Ga0496104_0388301_343_870 157
114 3300048908 Ga0496105_0013575 Ga0496105_0013575_2992_3519 157
115 3300048912 Ga0496109_1335217 Ga0496109_1335217_126_602 157
116 3300048917 Ga0496114_0003085 Ga0496114_0003085_4418_4945 157
117 3300048918 Ga0496115_0070473 Ga0496115_0070473_348_875 157
118 3300049585 Ga0501069_0018043 Ga0501069_0018043_336_809 157
119 3300049586 Ga0501070_0011977 Ga0501070_0011977_4310_4783 157
120 3300049590 Ga0501074_0034672 Ga0501074_0034672_250_723 157
121 3300050492 nmdc:mga0yw44_36679_c1 nmdc:mga0yw44_36679_c1_2184_2660 157
122 3300053083 Ga0495655_0133815 Ga0495655_0133815_175_648 157
123 3300006038 Ga0075365_10115466 Ga0075365_101154662 158
124 3300025944 Ga0207661_10330175 Ga0207661_103301752 158
125 3300032126 Ga0307415_101507159 Ga0307415_1015071592 158
126 3300046477 Ga0495664_0924344 Ga0495664_0924344_12_488 158
127 3300049571 Ga0501034_0476530 Ga0501034_0476530_129_608 158
128 3300049578 Ga0501042_0964605 Ga0501042_0964605_26_517 158
129 3300050492 nmdc:mga0yw44_972463_c1 nmdc:mga0yw44_972463_c1_47_523 158
130 3300060353 Ga0501082_1138415 Ga0501082_1138415_71_562 158
131 3300061734 Ga0530510_0256143 Ga0530510_0256143_777_1268 158
132 iso_pu_bacteria 2643221679 2644447122 158
133 3300005356 Ga0070674_101558105 Ga0070674_1015581051 159
134 3300005366 Ga0070659_100556620 Ga0070659_1005566201 159
135 3300005441 Ga0070700_100765195 Ga0070700_1007651951 159
136 3300005616 Ga0068852_100265368 Ga0068852_1002653682 159
137 3300006358 Ga0068871_101499534 Ga0068871_1014995341 159
138 3300006844 Ga0075428_100596553 Ga0075428_1005965532 159
139 3300009551 Ga0105238_10866514 Ga0105238_108665142 159
140 3300017792 Ga0163161_10740794 Ga0163161_107407942 159
141 3300025924 Ga0207694_10707478 Ga0207694_107074782 159
142 3300025944 Ga0207661_10220304 Ga0207661_102203042 159
143 3300026142 Ga0207698_10080609 Ga0207698_100806093 159
144 3300032004 Ga0307414_10986913 Ga0307414_109869132 159
145 3300032005 Ga0307411_10472680 Ga0307411_104726802 159
146 3300038443 Ga0395901_0059059 Ga0395901_0059059_2348_2863 159
147 3300038443 Ga0395901_0292089 Ga0395901_0292089_562_1074 159
148 3300046681 Ga0495647_0452493 Ga0495647_0452493_51_563 159
149 3300048913 Ga0496110_0516266 Ga0496110_0516266_244_747 159
150 3300049577 Ga0501041_0129387 Ga0501041_0129387_899_1393 159
151 3300049585 Ga0501069_0036146 Ga0501069_0036146_702_1250 159
152 3300049824 Ga0501045_0583035 Ga0501045_0583035_215_706 159
153 3300005329 Ga0070683_100536174 Ga0070683_1005361742 160
154 3300005337 Ga0070682_100834287 Ga0070682_1008342871 160
155 3300005535 Ga0070684_100571844 Ga0070684_1005718442 160
156 3300025937 Ga0207669_10459227 Ga0207669_104592272 160
157 3300026095 Ga0207676_10159992 Ga0207676_101599922 160
158 3300031995 Ga0307409_100192192 Ga0307409_1001921922 160
159 3300031995 Ga0307409_100626600 Ga0307409_1006266002 160
160 3300032126 Ga0307415_100084456 Ga0307415_1000844564 160
161 3300032126 Ga0307415_100323620 Ga0307415_1003236202 160
162 3300041507 Ga0451851_0299830 Ga0451851_0299830_21_533 160
163 3300042876 Ga0451577_0222110 Ga0451577_0222110_684_1196 160
164 3300044712 Ga0453684_1457997 Ga0453684_1457997_105_620 160
165 3300044901 Ga0466960_0404937 Ga0466960_0404937_144_629 160
166 3300045051 Ga0451576_0123697 Ga0451576_0123697_1435_1947 160
167 3300045976 Ga0466967_0038045 Ga0466967_0038045_297_824 160
168 3300048909 Ga0496106_1188106 Ga0496106_1188106_32_514 160
169 3300048916 Ga0496113_1178969 Ga0496113_1178969_57_581 160
170 3300049568 Ga0501031_0032528 Ga0501031_0032528_747_1232 160
171 3300049571 Ga0501034_0066583 Ga0501034_0066583_1546_2049 160
172 3300049575 Ga0501039_0188375 Ga0501039_0188375_74_559 160
173 3300049579 Ga0501043_0583648 Ga0501043_0583648_146_649 160
174 3300049585 Ga0501069_0150248 Ga0501069_0150248_813_1316 160
175 3300049586 Ga0501070_0003400 Ga0501070_0003400_2382_2885 160
176 3300049586 Ga0501070_0415020 Ga0501070_0415020_531_1013 160
177 3300049587 Ga0501071_0000493 Ga0501071_0000493_1365_1868 160
178 3300049587 Ga0501071_0039710 Ga0501071_0039710_1088_1573 160
179 3300049588 Ga0501072_0081388 Ga0501072_0081388_353_838 160
180 3300049591 Ga0501075_0081759 Ga0501075_0081759_1943_2428 160
181 3300049824 Ga0501045_0516136 Ga0501045_0516136_317_859 160
182 3300054114 Ga0501084_0244358 Ga0501084_0244358_515_1057 160
183 3300061734 Ga0530510_0359358 Ga0530510_0359358_552_1037 160
184 3300009101 Ga0105247_10141056 Ga0105247_101410562 161
185 3300013307 Ga0157372_10372264 Ga0157372_103722642 161
186 3300014968 Ga0157379_11941400 Ga0157379_119414001 161
187 3300025919 Ga0207657_10213435 Ga0207657_102134352 161
188 3300031731 Ga0307405_10227399 Ga0307405_102273992 161
189 3300031852 Ga0307410_10195742 Ga0307410_101957422 161
190 3300031852 Ga0307410_10264358 Ga0307410_102643581 161
191 3300031911 Ga0307412_10102668 Ga0307412_101026683 161
192 3300031995 Ga0307409_100048526 Ga0307409_1000485263 161
193 3300032002 Ga0307416_100557138 Ga0307416_1005571382 161
194 3300032126 Ga0307415_100010735 Ga0307415_1000107356 161
195 3300048917 Ga0496114_0370190 Ga0496114_0370190_699_1217 161
196 3300049568 Ga0501031_0030554 Ga0501031_0030554_1450_1950 161
197 3300049582 Ga0501048_0193355 Ga0501048_0193355_789_1289 161
198 3300005343 Ga0070687_100790906 Ga0070687_1007909062 162
199 3300009094 Ga0111539_11512581 Ga0111539_115125812 162
200 3300014326 Ga0157380_10442206 Ga0157380_104422062 162
201 3300026118 Ga0207675_100011002 Ga0207675_10001100210 162
202 3300031731 Ga0307405_10063688 Ga0307405_100636884 162
203 3300031824 Ga0307413_10158105 Ga0307413_101581052 162
204 3300031852 Ga0307410_10427079 Ga0307410_104270792 162
205 3300031995 Ga0307409_100051262 Ga0307409_1000512624 162
206 3300031995 Ga0307409_100075795 Ga0307409_1000757952 162
207 3300032002 Ga0307416_100454692 Ga0307416_1004546922 162
208 3300032002 Ga0307416_100568794 Ga0307416_1005687942 162
209 3300032002 Ga0307416_100738345 Ga0307416_1007383452 162
210 3300041405 Ga0439438_028223 Ga0439438_028223_87_626 162
211 3300041997 Ga0439431_0042149 Ga0439431_0042149_378_917 162
212 3300042156 Ga0439446_0003731 Ga0439446_0003731_2726_3265 162
213 3300042435 Ga0439434_0008552 Ga0439434_0008552_89_628 162
214 3300044901 Ga0466960_0001472 Ga0466960_0001472_7586_8074 162
215 3300045976 Ga0466967_0059306 Ga0466967_0059306_1230_1718 162
216 3300046459 Ga0495629_0197537 Ga0495629_0197537_166_654 162
217 3300046461 Ga0495641_0068333 Ga0495641_0068333_216_704 162
218 3300046473 Ga0495582_0036981 Ga0495582_0036981_570_1058 162
219 3300048912 Ga0496109_0176225 Ga0496109_0176225_1426_1914 162
220 3300049514 Ga0501291_038684 Ga0501291_038684_131_619 162
221 3300049568 Ga0501031_0038386 Ga0501031_0038386_1272_1766 162
222 3300049569 Ga0501032_0071898 Ga0501032_0071898_1356_1850 162
223 3300049570 Ga0501033_0150990 Ga0501033_0150990_603_1097 162
224 3300049572 Ga0501036_0002673 Ga0501036_0002673_9681_10175 162
225 3300049574 Ga0501038_0096075 Ga0501038_0096075_837_1331 162
226 3300049575 Ga0501039_0039828 Ga0501039_0039828_1233_1727 162
227 3300049576 Ga0501040_0050843 Ga0501040_0050843_1383_1877 162
228 3300049577 Ga0501041_0026626 Ga0501041_0026626_1104_1598 162
229 3300049578 Ga0501042_0006535 Ga0501042_0006535_1080_1574 162
230 3300049578 Ga0501042_0340884 Ga0501042_0340884_359_868 162
231 3300049580 Ga0501046_0085625 Ga0501046_0085625_1820_2314 162
232 3300049582 Ga0501048_0032155 Ga0501048_0032155_2304_2798 162
233 3300049582 Ga0501048_0076842 Ga0501048_0076842_1688_2197 162
234 3300049584 Ga0501068_0281988 Ga0501068_0281988_531_1025 162
235 3300049584 Ga0501068_0489004 Ga0501068_0489004_240_767 162
236 3300049585 Ga0501069_0092220 Ga0501069_0092220_42_536 162
237 3300049586 Ga0501070_0277278 Ga0501070_0277278_121_615 162
238 3300049587 Ga0501071_0004571 Ga0501071_0004571_5709_6203 162
239 3300049587 Ga0501071_0917703 Ga0501071_0917703_35_529 162
240 3300049588 Ga0501072_0131544 Ga0501072_0131544_1239_1733 162
241 3300049589 Ga0501073_0123714 Ga0501073_0123714_1280_1774 162
242 3300049591 Ga0501075_0079421 Ga0501075_0079421_909_1403 162
243 3300049593 Ga0501077_0144653 Ga0501077_0144653_691_1185 162
244 3300049593 Ga0501077_0340282 Ga0501077_0340282_101_595 162
245 3300049656 Ga0501209_104451 Ga0501209_104451_253_759 162
246 3300049706 Ga0501229_040821 Ga0501229_040821_141_629 162
247 3300049741 Ga0501079_0048457 Ga0501079_0048457_1164_1658 162
248 3300049742 Ga0501080_0188954 Ga0501080_0188954_1279_1773 162
249 3300049822 Ga0501035_0033679 Ga0501035_0033679_619_1113 162
250 3300054114 Ga0501084_0008229 Ga0501084_0008229_7188_7682 162
251 3300060353 Ga0501082_0101926 Ga0501082_0101926_1165_1659 162
252 3300060353 Ga0501082_0913505 Ga0501082_0913505_47_556 162
253 3300061734 Ga0530510_0168579 Ga0530510_0168579_673_1167 162
254 3300006195 Ga0075366_10258637 Ga0075366_102586371 163
255 3300044694 Ga0466963_0199686 Ga0466963_0199686_129_623 163
256 3300045976 Ga0466967_0711552 Ga0466967_0711552_20_511 163
257 3300049585 Ga0501069_0022664 Ga0501069_0022664_851_1342 163
258 3300049586 Ga0501070_0231386 Ga0501070_0231386_294_785 163
259 3300050493 nmdc:mga0k408_122693_c1 nmdc:mga0k408_122693_c1_136_654 163
260 3300050511 nmdc:mga08y16_633128_c1 nmdc:mga08y16_633128_c1_341_859 163
261 3300005327 Ga0070658_10224393 Ga0070658_102243932 164
262 3300005616 Ga0068852_100016940 Ga0068852_1000169407 164
263 3300005834 Ga0068851_10000008 Ga0068851_10000008178 164
264 3300009093 Ga0105240_10294970 Ga0105240_102949702 164
265 3300014968 Ga0157379_10055035 Ga0157379_100550354 164
266 3300025254 Ga0209148_1018783 Ga0209148_10187832 164
267 3300025321 Ga0207656_10000005 Ga0207656_10000005179 164
268 3300025909 Ga0207705_10005614 Ga0207705_100056144 164
269 3300025914 Ga0207671_10000016 Ga0207671_10000016281 164
270 3300025924 Ga0207694_10000196 Ga0207694_1000019640 164
271 3300025941 Ga0207711_10002484 Ga0207711_1000248416 164
272 3300025949 Ga0207667_10091497 Ga0207667_100914973 164
273 3300026023 Ga0207677_10314955 Ga0207677_103149552 164
274 3300026116 Ga0207674_10000405 Ga0207674_1000040542 164
275 3300026142 Ga0207698_10062453 Ga0207698_100624535 164
276 3300031901 Ga0307406_10163997 Ga0307406_101639972 164
277 3300031903 Ga0307407_10320140 Ga0307407_103201402 164
278 3300031995 Ga0307409_100153240 Ga0307409_1001532402 164
279 3300032002 Ga0307416_100525287 Ga0307416_1005252872 164
280 3300032004 Ga0307414_11647762 Ga0307414_116477622 164
281 3300044842 Ga0466957_0818450 Ga0466957_0818450_65_562 164
282 3300045976 Ga0466967_0008587 Ga0466967_0008587_4885_5382 164
283 3300045976 Ga0466967_0174842 Ga0466967_0174842_230_727 164
284 3300048929 Ga0496126_0222974 Ga0496126_0222974_251_754 164
285 3300005329 Ga0070683_100229961 Ga0070683_1002299612 165
286 3300009101 Ga0105247_10162148 Ga0105247_101621482 165
287 3300011119 Ga0105246_11090750 Ga0105246_110907502 165
288 3300025938 Ga0207704_10559507 Ga0207704_105595072 165
289 3300025944 Ga0207661_10045532 Ga0207661_100455324 165
290 3300026067 Ga0207678_10512493 Ga0207678_105124932 165
291 3300046455 Ga0495603_0136249 Ga0495603_0136249_102_599 165
292 3300046499 Ga0495594_0549735 Ga0495594_0549735_125_622 165
293 3300048910 Ga0496107_0181511 Ga0496107_0181511_286_789 165
294 3300048917 Ga0496114_0726127 Ga0496114_0726127_234_737 165
295 3300005458 Ga0070681_10898700 Ga0070681_108987001 166
296 3300005548 Ga0070665_100000865 Ga0070665_10000086521 166
297 3300014969 Ga0157376_10286175 Ga0157376_102861752 166
298 3300025901 Ga0207688_10057408 Ga0207688_100574082 166
299 3300025921 Ga0207652_10204530 Ga0207652_102045302 166
300 3300025938 Ga0207704_10448327 Ga0207704_104483273 166
301 3300028379 Ga0268266_10001168 Ga0268266_1000116831 166
302 3300037466 Ga0395898_0091037 Ga0395898_0091037_1336_1839 166
303 3300005329 Ga0070683_100005477 Ga0070683_1000054771 167
304 3300005366 Ga0070659_100064662 Ga0070659_1000646623 167
305 3300005367 Ga0070667_100297389 Ga0070667_1002973892 167
306 3300005456 Ga0070678_100058101 Ga0070678_1000581011 167
307 3300005718 Ga0068866_10067374 Ga0068866_100673744 167
308 3300006881 Ga0068865_100090578 Ga0068865_1000905783 167
309 3300011119 Ga0105246_10003879 Ga0105246_100038799 167
310 3300013105 Ga0157369_10218588 Ga0157369_102185884 167
311 3300013308 Ga0157375_11357882 Ga0157375_113578822 167
312 3300014968 Ga0157379_10383687 Ga0157379_103836871 167
313 3300025899 Ga0207642_10572771 Ga0207642_105727711 167
314 3300025901 Ga0207688_10114442 Ga0207688_101144422 167
315 3300025904 Ga0207647_10034671 Ga0207647_100346714 167
316 3300025932 Ga0207690_10067939 Ga0207690_100679392 167
317 3300025933 Ga0207706_10557498 Ga0207706_105574982 167
318 3300025938 Ga0207704_10328115 Ga0207704_103281152 167
319 3300025944 Ga0207661_10011900 Ga0207661_100119002 167
320 3300026121 Ga0207683_10073636 Ga0207683_100736364 167
321 3300048905 Ga0496102_0036573 Ga0496102_0036573_1250_1753 167
322 3300048909 Ga0496106_0873189 Ga0496106_0873189_130_633 167
323 3300048912 Ga0496109_0011804 Ga0496109_0011804_3234_3737 167
324 3300048913 Ga0496110_0111004 Ga0496110_0111004_1472_1975 167
325 3300048914 Ga0496111_0014076 Ga0496111_0014076_390_893 167
326 3300002067 JGI24735J21928_10024918 JGI24735J21928_100249182 168
327 3300005339 Ga0070660_100150940 Ga0070660_1001509402 168
328 3300005341 Ga0070691_10750141 Ga0070691_107501411 168
329 3300005343 Ga0070687_100083035 Ga0070687_1000830352 168
330 3300005458 Ga0070681_10261995 Ga0070681_102619953 168
331 3300005530 Ga0070679_100020128 Ga0070679_1000201286 168
332 3300005530 Ga0070679_100528231 Ga0070679_1005282312 168
333 3300005535 Ga0070684_100019709 Ga0070684_1000197092 168
334 3300005548 Ga0070665_100922940 Ga0070665_1009229401 168
335 3300005563 Ga0068855_100627253 Ga0068855_1006272532 168
336 3300005577 Ga0068857_100039063 Ga0068857_1000390634 168
337 3300005614 Ga0068856_100038638 Ga0068856_1000386385 168
338 3300005615 Ga0070702_100046343 Ga0070702_1000463433 168
339 3300005616 Ga0068852_100110231 Ga0068852_1001102313 168
340 3300005618 Ga0068864_100974528 Ga0068864_1009745282 168
341 3300005844 Ga0068862_100087322 Ga0068862_1000873222 168
342 3300006237 Ga0097621_101156606 Ga0097621_1011566062 168
343 3300009098 Ga0105245_10004166 Ga0105245_1000416611 168
344 3300009148 Ga0105243_10115319 Ga0105243_101153193 168
345 3300009177 Ga0105248_10016623 Ga0105248_100166235 168
346 3300009545 Ga0105237_10696238 Ga0105237_106962382 168
347 3300010375 Ga0105239_10003785 Ga0105239_1000378513 168
348 3300013102 Ga0157371_10272020 Ga0157371_102720202 168
349 3300013104 Ga0157370_10540997 Ga0157370_105409972 168
350 3300013306 Ga0163162_10046206 Ga0163162_100462062 168
351 3300013307 Ga0157372_10022310 Ga0157372_100223104 168
352 3300014325 Ga0163163_10551174 Ga0163163_105511742 168
353 3300025904 Ga0207647_10012942 Ga0207647_100129428 168
354 3300025912 Ga0207707_10139837 Ga0207707_101398374 168
355 3300025918 Ga0207662_10107305 Ga0207662_101073052 168
356 3300025919 Ga0207657_10140063 Ga0207657_101400632 168
357 3300025921 Ga0207652_10055237 Ga0207652_100552372 168
358 3300025921 Ga0207652_10421606 Ga0207652_104216061 168
359 3300025941 Ga0207711_10438007 Ga0207711_104380072 168
360 3300025949 Ga0207667_10777415 Ga0207667_107774152 168
361 3300026078 Ga0207702_10121631 Ga0207702_101216314 168
362 3300026095 Ga0207676_10008379 Ga0207676_100083795 168
363 3300026116 Ga0207674_10009443 Ga0207674_1000944313 168
364 3300026142 Ga0207698_10083931 Ga0207698_100839312 168
365 3300028380 Ga0268265_10123790 Ga0268265_101237902 168
366 3300028381 Ga0268264_11224372 Ga0268264_112243722 168
367 3300041452 Ga0451793_1918891 Ga0451793_1918891_51_578 168
368 3300045051 Ga0451576_0170193 Ga0451576_0170193_102_608 168
369 3300048903 Ga0496100_0444826 Ga0496100_0444826_262_768 168
370 3300048906 Ga0496103_0140175 Ga0496103_0140175_119_625 168
371 3300049571 Ga0501034_0326928 Ga0501034_0326928_802_1311 168
372 3300049571 Ga0501034_0509335 Ga0501034_0509335_577_1086 168
373 3300049572 Ga0501036_0101747 Ga0501036_0101747_1570_2079 168
374 3300049575 Ga0501039_0164788 Ga0501039_0164788_675_1184 168
375 3300049583 Ga0501067_0001116 Ga0501067_0001116_1227_1736 168
376 3300049583 Ga0501067_0001853 Ga0501067_0001853_2852_3361 168
377 3300049584 Ga0501068_0066745 Ga0501068_0066745_423_932 168
378 3300049584 Ga0501068_0510016 Ga0501068_0510016_141_650 168
379 3300049585 Ga0501069_0081066 Ga0501069_0081066_406_915 168
380 3300049586 Ga0501070_0013917 Ga0501070_0013917_43_552 168
381 3300049586 Ga0501070_0115733 Ga0501070_0115733_260_769 168
382 3300049587 Ga0501071_0009400 Ga0501071_0009400_4828_5337 168
383 3300049587 Ga0501071_0070551 Ga0501071_0070551_776_1285 168
384 3300049588 Ga0501072_0011045 Ga0501072_0011045_3100_3609 168
385 3300049588 Ga0501072_0041168 Ga0501072_0041168_829_1338 168
386 3300049589 Ga0501073_0005484 Ga0501073_0005484_8685_9194 168
387 3300049589 Ga0501073_0049977 Ga0501073_0049977_1337_1846 168
388 3300049590 Ga0501074_0000838 Ga0501074_0000838_8375_8884 168
389 3300049590 Ga0501074_0005285 Ga0501074_0005285_3628_4137 168
390 3300049592 Ga0501076_0775410 Ga0501076_0775410_220_729 168
391 3300049593 Ga0501077_0010216 Ga0501077_0010216_440_949 168
392 3300049741 Ga0501079_0246957 Ga0501079_0246957_859_1368 168
393 3300049741 Ga0501079_0255993 Ga0501079_0255993_724_1233 168
394 3300049742 Ga0501080_0022437 Ga0501080_0022437_2071_2580 168
395 3300049742 Ga0501080_0225832 Ga0501080_0225832_62_571 168
396 3300049744 Ga0501083_0004571 Ga0501083_0004571_4742_5251 168
397 3300049744 Ga0501083_0078392 Ga0501083_0078392_1665_2174 168
398 3300049822 Ga0501035_0288015 Ga0501035_0288015_455_964 168
399 3300049823 Ga0501044_0457504 Ga0501044_0457504_646_1155 168
400 3300054114 Ga0501084_0017393 Ga0501084_0017393_2142_2651 168
401 3300060353 Ga0501082_0159112 Ga0501082_0159112_84_593 168

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF23451

139

189

0.94

PF01883

FeS_assembly_P

Iron-sulfur cluster assembly protein

33

100

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lno-assembly1.cif.gz_A crystal structure of domain of unknown function duf59 from bacillus anthracis 0.8943 7 105
3j04-assembly1.cif.gz_D em structure of the heavy meromyosin subfragment of chick smooth muscle myosin with regulatory light chain in phosphorylated state 0.8771 137 165
5zwx-assembly2.cif.gz_B crystal structure of raphanus sativus agdp1 agd12 in complex with an h3k9me2 peptide 0.8705 139 164
6ie4-assembly1.cif.gz_A crystal structure of adcp1 tandem agenet domain 1-2 in complex with h3k9me1 0.8622 139 165
3pnw-assembly7.cif.gz_U crystal structure of the tudor domain of human tdrd3 in complex with an anti-tdrd3 fab 0.8587 137 164
ID Description Score Start End Superfamily
af_P76080_10_106_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9237 12 105 3.30.300.130
af_Q54BG2_135_191_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.9123 137 164 2.30.30.140
af_Q2FZT0_1_88_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9021 22 110 3.30.300.130
4b9xA02 Mainly Beta;Roll;SH3 type barrels.; 0.8935 137 165 2.30.30.140
af_P76080_10_106_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.8881 12 105 3.30.300.130
ID Description Score Start End GO Terms
AF-A0A1C5D2S9-F1-model_v4 Ring-1,2-phenylacetyl-CoA epoxidase subunit PaaD 0.9677 8 110
AF-A0A2E0SYA7-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaJ 0.9593 15 101
AF-A0A4Q9HJA2-F1-model_v4 DUF59 domain-containing protein 0.9576 16 93
AF-A0A7Y1V914-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaJ 0.9484 13 112
AF-A0A136KDP2-F1-model_v4 Putative 1,2-phenylacetyl-CoA epoxidase, subunit D 0.9364 9 105

Feature Viewer

pLDDT pTM Quality
86.38 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map