F434859

General Info

Members Datasets Scaffolds Average Seq Length
401 189 802 151

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10063913|Ga0182008_100639132
Length 148
Sequence VRDKDEQLTQAQKEQLEAELAELEGPKRAEIVAAIKTARGFGDLSENFEYHAAKNEQGLLERRITILRDRLQRAVVVDEKAGGDVVRVGSHVKLERDDGEVMDVEISSVDGVSPDSPLGRAVIGAKAGDEIVVEAPKGAWKAKVVSIG

Samples

Sample ID Description Type Environment
1 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
45 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
50 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
51 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
52 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
53 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
82 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
83 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
84 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
85 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
86 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
87 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
90 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
91 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
92 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
93 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
94 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
95 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
96 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
97 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
98 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
100 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
101 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
102 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
103 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
113 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
114 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
115 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
116 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
117 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
118 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
119 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
120 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
121 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
122 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
123 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
124 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
125 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
126 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
127 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
130 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
131 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
134 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
135 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
136 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
140 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
141 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
144 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
145 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
146 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
147 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
148 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
149 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
150 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
153 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
154 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
159 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
160 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
171 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
172 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
173 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
174 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
175 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
176 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
179 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
183 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
184 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
185 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
186 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
188 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
189 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.76
Metatranscriptomes 5.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.24
Rhizosphere 92.77
Stem 0
Stem Tuber 0
Unclassified 7.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182008_10063913 3300014497 Bacteria 1812
2 rootH2_10103514 3300003320 Bacteria 1787
3 Ga0058862_11792424 3300004803 Bacteria 692
4 Ga0070683_100059841 3300005329 Bacteria 3539
5 Ga0070683_100275841 3300005329 Unclassified 1600
6 Ga0070683_100362391 3300005329 Bacteria 1381
7 Ga0070683_100790130 3300005329 Bacteria 910
8 Ga0070680_100021330 3300005336 Bacteria 5146
9 Ga0070680_100055799 3300005336 Bacteria 3228
10 Ga0070680_100111893 3300005336 Bacteria 2273
11 Ga0070680_101974935 3300005336 Bacteria 505
12 Ga0070682_100112287 3300005337 Bacteria 1818
13 Ga0070682_100141311 3300005337 Bacteria 1641
14 Ga0070682_100431132 3300005337 Bacteria 1005
15 Ga0070660_100041872 3300005339 Bacteria 3493
16 Ga0070660_100064983 3300005339 Bacteria 2839
17 Ga0070661_100164955 3300005344 Bacteria 1679
18 Ga0070661_100252466 3300005344 Bacteria 1361
19 Ga0070661_100313024 3300005344 Unclassified 1225
20 Ga0070661_100694687 3300005344 Bacteria 829
21 Ga0070659_100015189 3300005366 Bacteria 5761
22 Ga0070659_100134466 3300005366 Bacteria 2010
23 Ga0070714_100085672 3300005435 Bacteria 2752
24 Ga0070714_100102351 3300005435 Bacteria 2525
25 Ga0070714_100324480 3300005435 Bacteria 1440
26 Ga0070710_10320411 3300005437 Bacteria 1017
27 Ga0070711_100010530 3300005439 Bacteria 5726
28 Ga0070711_100254069 3300005439 Bacteria 1380
29 Ga0070711_100703926 3300005439 Bacteria 851
30 Ga0070681_10002771 3300005458 Bacteria 16179
31 Ga0070681_10003201 3300005458 Bacteria 15251
32 Ga0070681_10148406 3300005458 Bacteria 2272
33 Ga0070681_10199045 3300005458 Bacteria 1922
34 Ga0070681_10366733 3300005458 Unclassified 1350
35 Ga0070698_100373663 3300005471 Bacteria 1358
36 Ga0070679_100009914 3300005530 Bacteria 9016
37 Ga0070679_100026954 3300005530 Bacteria 5650
38 Ga0070679_100186976 3300005530 Bacteria 2041
39 Ga0070679_100937167 3300005530 Bacteria 809
40 Ga0070684_100043832 3300005535 Bacteria 3865
41 Ga0068853_100371681 3300005539 Bacteria 1334
42 Ga0068853_100622917 3300005539 Bacteria 1026
43 Ga0068853_101162503 3300005539 Unclassified 745
44 Ga0070696_100047554 3300005546 Bacteria 2977
45 Ga0070693_100143237 3300005547 Bacteria 1507
46 Ga0068855_100034274 3300005563 Bacteria 6056
47 Ga0068855_100159256 3300005563 Bacteria 2563
48 Ga0068855_100268451 3300005563 Bacteria 1898
49 Ga0068855_100322661 3300005563 Bacteria 1707
50 Ga0068855_100503677 3300005563 Unclassified 1315
51 Ga0068857_100079270 3300005577 Bacteria 2932
52 Ga0068854_100810306 3300005578 Bacteria 817
53 Ga0068856_100147959 3300005614 Bacteria 2356
54 Ga0068856_100259881 3300005614 Bacteria 1752
55 Ga0068856_100332167 3300005614 Unclassified 1538
56 Ga0068852_100069691 3300005616 Bacteria 3083
57 Ga0068852_100176956 3300005616 Bacteria 2004
58 Ga0070712_100717114 3300006175 Bacteria 854
59 Ga0070712_100754608 3300006175 Unclassified 833
60 Ga0075433_10792678 3300006852 Unclassified 828
61 Ga0105240_10138007 3300009093 Bacteria 2918
62 Ga0105240_10256312 3300009093 Bacteria 2020
63 Ga0105240_10352251 3300009093 Bacteria 1670
64 Ga0105245_10697878 3300009098 Bacteria 1048
65 Ga0105245_10825994 3300009098 Bacteria 966
66 Ga0114129_10740502 3300009147 Bacteria 1259
67 Ga0105241_10454208 3300009174 Bacteria 1134
68 Ga0105241_11725555 3300009174 Bacteria 609
69 Ga0105237_10009059 3300009545 Bacteria 10696
70 Ga0105238_10142706 3300009551 Bacteria 2371
71 Ga0105238_10300264 3300009551 Bacteria 1589
72 Ga0105239_10325454 3300010375 Bacteria 1734
73 Ga0105239_10475750 3300010375 Unclassified 1419
74 Ga0105239_10872397 3300010375 Bacteria 1032
75 Ga0157373_10094718 3300013100 Unclassified 2102
76 Ga0157371_10076164 3300013102 Bacteria 2376
77 Ga0157370_10020768 3300013104 Bacteria 6553
78 Ga0157370_10049950 3300013104 Bacteria 4000
79 Ga0157370_10138270 3300013104 Bacteria 2269
80 Ga0157370_10187452 3300013104 Bacteria 1920
81 Ga0157370_10580038 3300013104 Unclassified 1027
82 Ga0157369_10011094 3300013105 Bacteria 10252
83 Ga0157369_10038163 3300013105 Bacteria 5253
84 Ga0157369_10094311 3300013105 Bacteria 3194
85 Ga0157369_10218013 3300013105 Bacteria 1998
86 Ga0157369_10273201 3300013105 Bacteria 1761
87 Ga0157369_10678090 3300013105 Bacteria 1062
88 Ga0157374_10239781 3300013296 Unclassified 1783
89 Ga0157374_10430017 3300013296 Bacteria 1320
90 Ga0157374_10791668 3300013296 Bacteria 964
91 Ga0157372_10111108 3300013307 Bacteria 3140
92 Ga0157372_10289293 3300013307 Bacteria 1906
93 Ga0157372_10328499 3300013307 Unclassified 1781
94 Ga0157380_11169581 3300014326 Bacteria 811
95 Ga0197907_10399879 3300020069 Unclassified 2506
96 Ga0197907_11065326 3300020069 Bacteria 798
97 Ga0206356_10258789 3300020070 Bacteria 5753
98 Ga0206356_11359727 3300020070 Bacteria 742
99 Ga0206349_1878909 3300020075 Bacteria 775
100 Ga0206355_1274499 3300020076 Bacteria 701
101 Ga0206352_11230441 3300020078 Bacteria 679
102 Ga0206350_10950338 3300020080 Bacteria 624
103 Ga0206354_10914309 3300020081 Bacteria 2429
104 Ga0206353_10276316 3300020082 Bacteria 856
105 Ga0206353_11191474 3300020082 Bacteria 1403
106 Ga0206353_11237054 3300020082 Unclassified 884
107 Ga0206353_11967712 3300020082 Bacteria 2413
108 Ga0154015_1023601 3300020610 Bacteria 700
109 Ga0213873_10000086 3300021358 Bacteria 19214
110 Ga0213876_10154881 3300021384 Bacteria 1219
111 Ga0213876_10261177 3300021384 Bacteria 920
112 Ga0213875_10000325 3300021388 Bacteria 45288
113 Ga0213875_10098349 3300021388 Bacteria 1365
114 Ga0224712_10014931 3300022467 Bacteria 2515
115 Ga0224712_10050794 3300022467 Bacteria 1612
116 Ga0224712_10218402 3300022467 Bacteria 872
117 Ga0224712_10269827 3300022467 Bacteria 790
118 Ga0207647_10313167 3300025904 Bacteria 892
119 Ga0207707_10006826 3300025912 Bacteria 9957
120 Ga0207707_10029821 3300025912 Bacteria 4771
121 Ga0207707_10196813 3300025912 Bacteria 1758
122 Ga0207695_10211840 3300025913 Bacteria 1848
123 Ga0207695_10269961 3300025913 Bacteria 1597
124 Ga0207671_10141351 3300025914 Unclassified 1855
125 Ga0207671_10158198 3300025914 Bacteria 1753
126 Ga0207693_10395753 3300025915 Bacteria 1080
127 Ga0207663_10196585 3300025916 Bacteria 1452
128 Ga0207660_10055176 3300025917 Bacteria 2838
129 Ga0207657_10002304 3300025919 Bacteria 20689
130 Ga0207657_10003843 3300025919 Bacteria 15950
131 Ga0207657_10039896 3300025919 Bacteria 4166
132 Ga0207649_10281870 3300025920 Bacteria 1208
133 Ga0207649_10827330 3300025920 Bacteria 724
134 Ga0207652_10012970 3300025921 Bacteria 6743
135 Ga0207652_10098017 3300025921 Bacteria 2585
136 Ga0207652_10139229 3300025921 Bacteria 2169
137 Ga0207646_10131226 3300025922 Bacteria 2255
138 Ga0207694_10086896 3300025924 Bacteria 2462
139 Ga0207694_10224342 3300025924 Bacteria 1533
140 Ga0207687_10422640 3300025927 Bacteria 1100
141 Ga0207700_10591094 3300025928 Bacteria 987
142 Ga0207664_10339678 3300025929 Bacteria 1328
143 Ga0207664_10470738 3300025929 Bacteria 1123
144 Ga0207690_10071912 3300025932 Bacteria 2387
145 Ga0207690_10630500 3300025932 Unclassified 877
146 Ga0207686_11707454 3300025934 Bacteria 521
147 Ga0207661_10137281 3300025944 Bacteria 2101
148 Ga0207661_10398693 3300025944 Bacteria 1247
149 Ga0207661_10567805 3300025944 Bacteria 1040
150 Ga0207667_10156289 3300025949 Bacteria 2346
151 Ga0207667_10272299 3300025949 Bacteria 1731
152 Ga0207667_10390100 3300025949 Bacteria 1418
153 Ga0207667_10678859 3300025949 Bacteria 1034
154 Ga0207667_10983631 3300025949 Unclassified 832
155 Ga0207640_10051039 3300025981 Bacteria 2687
156 Ga0207639_10281921 3300026041 Bacteria 1462
157 Ga0207639_10954419 3300026041 Unclassified 802
158 Ga0207639_11176649 3300026041 Bacteria 719
159 Ga0207702_10887214 3300026078 Unclassified 883
160 Ga0207702_10963175 3300026078 Unclassified 846
161 Ga0207674_10035362 3300026116 Bacteria 5213
162 Ga0207674_10184684 3300026116 Bacteria 2036
163 Ga0207698_10053277 3300026142 Bacteria 3105
164 Ga0207698_10228110 3300026142 Bacteria 1688
165 Ga0268266_11376720 3300028379 Bacteria 681
166 Ga0265318_10096798 3300028577 Bacteria 1086
167 Ga0265338_10034600 3300028800 Bacteria 4879
168 Ga0265338_10088555 3300028800 Bacteria 2568
169 Ga0265338_10393662 3300028800 Bacteria 989
170 Ga0265320_10234757 3300031240 Bacteria 815
171 Ga0265327_10052999 3300031251 Bacteria 2108
172 Ga0265327_10107062 3300031251 Bacteria 1341
173 Ga0265327_10132185 3300031251 Bacteria 1173
174 Ga0265313_10101115 3300031595 Bacteria 1280
175 Ga0265313_10138223 3300031595 Bacteria 1050
176 Ga0265314_10067399 3300031711 Bacteria 2411
177 Ga0265342_10337046 3300031712 Unclassified 788
178 Ga0265342_10398953 3300031712 Bacteria 710
179 Ga0307405_10289950 3300031731 Bacteria 1236
180 Ga0307409_100463472 3300031995 Bacteria 1226
181 Ga0307409_100681531 3300031995 Bacteria 1025
182 Ga0307416_100130326 3300032002 Bacteria 2262
183 Ga0307416_100523245 3300032002 Bacteria 1255
184 Ga0307415_100338673 3300032126 Bacteria 1261
185 Ga0373923_0074765 3300035111 Bacteria 1461
186 Ga0373936_0005255 3300035113 Bacteria 4869
187 Ga0373945_0001949 3300035116 Bacteria 6409
188 Ga0373953_0320825 3300035117 Bacteria 677
189 Ga0373956_0054224 3300035119 Bacteria 1806
190 Ga0373943_0007949 3300035170 Bacteria 4761
191 Ga0373943_0009612 3300035170 Bacteria 4335
192 Ga0373946_0058529 3300035171 Bacteria 1633
193 Ga0373924_0047089 3300035410 Bacteria 1779
194 Ga0373935_0142474 3300035692 Bacteria 1620
195 Ga0373927_0006464 3300035695 Bacteria 7984
196 Ga0373927_0156374 3300035695 Bacteria 1493
197 Ga0373933_0236061 3300035724 Bacteria 1175
198 Ga0373947_0017190 3300035725 Bacteria 4159
199 Ga0373937_0023359 3300036401 Bacteria 5567
200 Ga0265778_024049 3300036457 Bacteria 764
201 Ga0373925_0114092 3300037068 Bacteria 2090
202 Ga0395899_0038855 3300037312 Bacteria 3563
203 Ga0395899_0364436 3300037312 Bacteria 964
204 Ga0395900_0016957 3300037418 Bacteria 7434
205 Ga0395900_0187918 3300037418 Bacteria 2096
206 Ga0395900_0449573 3300037418 Bacteria 1245
207 Ga0395900_0706709 3300037418 Bacteria 941
208 Ga0395898_0011843 3300037466 Bacteria 9035
209 Ga0395905_0067007 3300037471 Bacteria 3362
210 Ga0436364_0329774 3300037853 Bacteria 1767
211 Ga0436364_0546584 3300037853 Bacteria 8035
212 Ga0436364_1130831 3300037853 Bacteria 43198
213 Ga0395901_0009145 3300038443 Bacteria 10035
214 Ga0395901_0011327 3300038443 Bacteria 9035
215 Ga0436365_0590264 3300039437 Bacteria 1230
216 Ga0436365_0607256 3300039437 Bacteria 1775
217 Ga0436365_0766371 3300039437 Bacteria 937
218 Ga0436365_1364532 3300039437 Bacteria 797
219 Ga0436365_1699597 3300039437 Bacteria 1555
220 Ga0436365_1926389 3300039437 Bacteria 3801
221 Ga0436360_1036167 3300039438 Bacteria 1352
222 Ga0436363_0604331 3300039450 Bacteria 944
223 Ga0436363_0717546 3300039450 Bacteria 1456
224 Ga0436362_0218630 3300039453 Bacteria 40774
225 Ga0436362_1124595 3300039453 Bacteria 1011
226 Ga0439448_0138215 3300042005 Bacteria 842
227 Ga0466965_0023175 3300044683 Bacteria 2997
228 Ga0466965_0230852 3300044683 Bacteria 988
229 Ga0466966_0001468 3300044684 Bacteria 15176
230 Ga0466966_0002668 3300044684 Bacteria 11689
231 Ga0466966_0011245 3300044684 Bacteria 5939
232 Ga0466966_0385577 3300044684 Bacteria 842
233 Ga0466961_0020976 3300044693 Bacteria 4204
234 Ga0466961_0023227 3300044693 Bacteria 3989
235 Ga0466961_0032137 3300044693 Bacteria 3372
236 Ga0466961_0333671 3300044693 Bacteria 924
237 Ga0466963_0000187 3300044694 Bacteria 25866
238 Ga0466963_0003880 3300044694 Bacteria 8635
239 Ga0466963_0011122 3300044694 Bacteria 5473
240 Ga0466963_0011679 3300044694 Bacteria 5352
241 Ga0466963_0027820 3300044694 Bacteria 3625
242 Ga0466963_0049631 3300044694 Bacteria 2776
243 Ga0466963_0057214 3300044694 Bacteria 2596
244 Ga0466963_0082830 3300044694 Bacteria 2175
245 Ga0466963_0336821 3300044694 Bacteria 1062
246 Ga0466964_0017490 3300044706 Bacteria 2744
247 Ga0466964_0058906 3300044706 Bacteria 1593
248 Ga0466964_0147542 3300044706 Bacteria 1087
249 Ga0466964_0241477 3300044706 Bacteria 886
250 Ga0466971_0007354 3300044719 Bacteria 4792
251 Ga0466971_0053449 3300044719 Bacteria 1820
252 Ga0466968_0000575 3300044735 Bacteria 12525
253 Ga0466968_0126532 3300044735 Bacteria 1160
254 Ga0466968_0154179 3300044735 Bacteria 1057
255 Ga0466968_0185643 3300044735 Bacteria 969
256 Ga0466970_0029159 3300044765 Bacteria 2904
257 Ga0466970_0074505 3300044765 Bacteria 1827
258 Ga0466970_0095472 3300044765 Bacteria 1616
259 Ga0466970_0259129 3300044765 Bacteria 975
260 Ga0466957_0001489 3300044842 Bacteria 12286
261 Ga0466957_0002545 3300044842 Bacteria 9808
262 Ga0466957_0170916 3300044842 Bacteria 1416
263 Ga0466957_0267891 3300044842 Bacteria 1140
264 Ga0466957_0305801 3300044842 Bacteria 1069
265 Ga0466957_0461721 3300044842 Bacteria 876
266 Ga0466960_0152736 3300044901 Bacteria 1234
267 Ga0466959_0019365 3300045049 Bacteria 5005
268 Ga0466959_0060112 3300045049 Bacteria 2765
269 Ga0466959_0069738 3300045049 Bacteria 2546
270 Ga0466959_0132060 3300045049 Bacteria 1769
271 Ga0466959_0135130 3300045049 Bacteria 1746
272 Ga0466958_0000505 3300045836 Bacteria 16330
273 Ga0466958_0026918 3300045836 Bacteria 3400
274 Ga0466958_0057845 3300045836 Bacteria 2356
275 Ga0466967_0001253 3300045976 Bacteria 14365
276 Ga0466967_0001654 3300045976 Bacteria 13202
277 Ga0466967_0003188 3300045976 Bacteria 10583
278 Ga0466967_0008347 3300045976 Bacteria 7579
279 Ga0466967_0017664 3300045976 Bacteria 5674
280 Ga0466967_0036302 3300045976 Bacteria 4206
281 Ga0466967_0036911 3300045976 Bacteria 4176
282 Ga0466967_0040236 3300045976 Bacteria 4023
283 Ga0466967_0043438 3300045976 Bacteria 3891
284 Ga0466967_0051968 3300045976 Bacteria 3594
285 Ga0466967_0061001 3300045976 Bacteria 3344
286 Ga0466967_0063691 3300045976 Bacteria 3277
287 Ga0466967_0086383 3300045976 Bacteria 2842
288 Ga0466967_0123106 3300045976 Bacteria 2399
289 Ga0466967_0172290 3300045976 Bacteria 2037
290 Ga0466967_0176361 3300045976 Bacteria 2013
291 Ga0466967_0335819 3300045976 Bacteria 1460
292 Ga0466967_0358830 3300045976 Bacteria 1412
293 Ga0466967_0380240 3300045976 Bacteria 1371
294 Ga0466967_0845142 3300045976 Bacteria 909
295 Ga0495592_0260346 3300046454 Bacteria 1143
296 Ga0495629_0300704 3300046459 Bacteria 1099
297 Ga0495651_0029903 3300046462 Bacteria 4247
298 Ga0495580_0445428 3300046472 Bacteria 869
299 Ga0495662_0152112 3300046476 Bacteria 1140
300 Ga0495664_0061573 3300046477 Unclassified 2234
301 Ga0495664_0075093 3300046477 Bacteria 2022
302 Ga0495664_0159821 3300046477 Bacteria 1367
303 Ga0495608_0009789 3300046511 Bacteria 6690
304 Ga0495608_0016196 3300046511 Bacteria 5157
305 Ga0495618_0095516 3300046514 Bacteria 1901
306 Ga0495618_0102753 3300046514 Bacteria 1829
307 Ga0495618_0197136 3300046514 Bacteria 1275
308 Ga0495628_0030516 3300046516 Bacteria 4364
309 Ga0495628_0166969 3300046516 Bacteria 1670
310 Ga0495630_0008240 3300046517 Bacteria 7486
311 Ga0495630_0116372 3300046517 Bacteria 2026
312 Ga0495630_0145692 3300046517 Bacteria 1801
313 Ga0495652_0036544 3300046529 Bacteria 4269
314 Ga0495652_0048020 3300046529 Bacteria 3660
315 Ga0495652_0631315 3300046529 Bacteria 727
316 Ga0495640_0020260 3300046533 Bacteria 4898
317 Ga0495587_0033822 3300046536 Bacteria 3084
318 Ga0495587_0319644 3300046536 Bacteria 867
319 Ga0495645_0263484 3300046543 Bacteria 1140
320 Ga0495645_0468768 3300046543 Bacteria 792
321 Ga0495667_0003696 3300046559 Bacteria 10289
322 Ga0495667_0146729 3300046559 Bacteria 1519
323 Ga0495634_0056680 3300046642 Bacteria 2617
324 Ga0495635_0758731 3300046663 Bacteria 627
325 Ga0495657_0009284 3300046675 Bacteria 7463
326 Ga0495657_0048412 3300046675 Bacteria 2868
327 Ga0495599_0015646 3300046678 Bacteria 4709
328 Ga0495623_0014932 3300046679 Bacteria 5021
329 Ga0495646_0070054 3300046680 Bacteria 2067
330 Ga0495646_0107593 3300046680 Bacteria 1591
331 Ga0495658_0076252 3300046683 Bacteria 1959
332 Ga0495658_0151034 3300046683 Bacteria 1427
333 Ga0495658_0159083 3300046683 Unclassified 1392
334 Ga0495613_0075903 3300046689 Bacteria 2447
335 Ga0495613_0638682 3300046689 Bacteria 705
336 Ga0495600_0011036 3300046809 Bacteria 5622
337 Ga0495600_0584070 3300046809 Bacteria 680
338 Ga0495581_0335640 3300047315 Bacteria 882
339 Ga0495581_0506802 3300047315 Bacteria 701
340 Ga0495604_0020477 3300047317 Bacteria 5283
341 Ga0495604_0076031 3300047317 Bacteria 2527
342 Ga0495674_0006882 3300047319 Bacteria 10877
343 Ga0495674_0013821 3300047319 Bacteria 7578
344 Ga0495674_0016707 3300047319 Bacteria 6847
345 Ga0495674_0485285 3300047319 Bacteria 990
346 Ga0495674_0525502 3300047319 Bacteria 944
347 Ga0495676_0120916 3300047321 Bacteria 1905
348 Ga0495680_0000973 3300047322 Bacteria 31826
349 Ga0495680_0007950 3300047322 Bacteria 9674
350 Ga0495680_0364445 3300047322 Bacteria 1004
351 Ga0495675_0002986 3300047444 Bacteria 10155
352 Ga0495684_0084116 3300047471 Bacteria 2414
353 Ga0495684_0144741 3300047471 Bacteria 1781
354 Ga0495614_0338564 3300048089 Bacteria 700
355 Ga0496101_0015150 3300048904 Bacteria 5190
356 Ga0496102_0897859 3300048905 Unclassified 808
357 Ga0496106_0462178 3300048909 Bacteria 1019
358 Ga0496107_0014656 3300048910 Bacteria 5488
359 Ga0496109_0406046 3300048912 Bacteria 1287
360 Ga0496112_0030323 3300048915 Bacteria 5233
361 Ga0496112_0527493 3300048915 Bacteria 1115
362 Ga0496112_1310243 3300048915 Bacteria 640
363 Ga0496114_0142772 3300048917 Bacteria 2074
364 Ga0496114_0703897 3300048917 Bacteria 886
365 Ga0496115_0007041 3300048918 Bacteria 8262
366 Ga0496115_0172087 3300048918 Bacteria 1791
367 Ga0496115_0211964 3300048918 Bacteria 1600
368 Ga0501040_0235311 3300049576 Bacteria 1305
369 Ga0501067_0000163 3300049583 Bacteria 37467
370 Ga0501067_0101645 3300049583 Bacteria 1597
371 Ga0501068_0017810 3300049584 Bacteria 4112
372 Ga0501069_0004585 3300049585 Bacteria 7146
373 Ga0501075_0244464 3300049591 Bacteria 1368
374 Ga0501076_0143020 3300049592 Bacteria 1944
375 Ga0501077_0027650 3300049593 Bacteria 3601
376 Ga0501079_0544922 3300049741 Bacteria 912
377 Ga0501080_0721156 3300049742 Bacteria 878
378 Ga0501081_0464521 3300049743 Unclassified 941
379 nmdc:mga05p37_724532_c2 3300050507 Bacteria 773
380 nmdc:mga0rr50_1005780_c1 3300050513 Unclassified 710
381 nmdc:mga0a205_1261138_c1 3300050515 Unclassified 587
382 Ga0495601_0185638 3300053077 Bacteria 1359
383 Ga0495601_0499821 3300053077 Unclassified 785
384 Ga0495601_0743236 3300053077 Bacteria 624
385 Ga0495612_0009626 3300053078 Bacteria 3914
386 Ga0495612_0153933 3300053078 Bacteria 1002
387 Ga0495619_0016160 3300053085 Bacteria 4724
388 Ga0495619_0187245 3300053085 Bacteria 1433
389 Ga0495619_0400126 3300053085 Bacteria 948
390 Ga0501084_0199756 3300054114 Bacteria 1687
391 Ga0501084_0246607 3300054114 Bacteria 1508
392 Ga0501084_1311003 3300054114 Bacteria 607
393 Ga0587114_065823 3300059655 Bacteria 646
394 Ga0501082_0235568 3300060353 Bacteria 1593
395 Ga0501082_0992609 3300060353 Bacteria 734
396 Ga0466962_0011159 3300061719 Bacteria 4325
397 Ga0466962_0016429 3300061719 Bacteria 3570
398 Ga0466962_0228218 3300061719 Bacteria 912
399 Ga0466962_0455179 3300061719 Unclassified 645
400 Ga0530510_0051540 3300061734 Bacteria 2974
401 Ga0530510_0899339 3300061734 Bacteria 676
402 Ga0182008_10063913
403 rootH2_10103514
404 Ga0058862_11792424
405 Ga0070683_100059841
406 Ga0070683_100275841
407 Ga0070683_100362391
408 Ga0070683_100790130
409 Ga0070680_100021330
410 Ga0070680_100055799
411 Ga0070680_100111893
412 Ga0070680_101974935
413 Ga0070682_100112287
414 Ga0070682_100141311
415 Ga0070682_100431132
416 Ga0070660_100041872
417 Ga0070660_100064983
418 Ga0070661_100164955
419 Ga0070661_100252466
420 Ga0070661_100313024
421 Ga0070661_100694687
422 Ga0070659_100015189
423 Ga0070659_100134466
424 Ga0070714_100085672
425 Ga0070714_100102351
426 Ga0070714_100324480
427 Ga0070710_10320411
428 Ga0070711_100010530
429 Ga0070711_100254069
430 Ga0070711_100703926
431 Ga0070681_10002771
432 Ga0070681_10003201
433 Ga0070681_10148406
434 Ga0070681_10199045
435 Ga0070681_10366733
436 Ga0070698_100373663
437 Ga0070679_100009914
438 Ga0070679_100026954
439 Ga0070679_100186976
440 Ga0070679_100937167
441 Ga0070684_100043832
442 Ga0068853_100371681
443 Ga0068853_100622917
444 Ga0068853_101162503
445 Ga0070696_100047554
446 Ga0070693_100143237
447 Ga0068855_100034274
448 Ga0068855_100159256
449 Ga0068855_100268451
450 Ga0068855_100322661
451 Ga0068855_100503677
452 Ga0068857_100079270
453 Ga0068854_100810306
454 Ga0068856_100147959
455 Ga0068856_100259881
456 Ga0068856_100332167
457 Ga0068852_100069691
458 Ga0068852_100176956
459 Ga0070712_100717114
460 Ga0070712_100754608
461 Ga0075433_10792678
462 Ga0105240_10138007
463 Ga0105240_10256312
464 Ga0105240_10352251
465 Ga0105245_10697878
466 Ga0105245_10825994
467 Ga0114129_10740502
468 Ga0105241_10454208
469 Ga0105241_11725555
470 Ga0105237_10009059
471 Ga0105238_10142706
472 Ga0105238_10300264
473 Ga0105239_10325454
474 Ga0105239_10475750
475 Ga0105239_10872397
476 Ga0157373_10094718
477 Ga0157371_10076164
478 Ga0157370_10020768
479 Ga0157370_10049950
480 Ga0157370_10138270
481 Ga0157370_10187452
482 Ga0157370_10580038
483 Ga0157369_10011094
484 Ga0157369_10038163
485 Ga0157369_10094311
486 Ga0157369_10218013
487 Ga0157369_10273201
488 Ga0157369_10678090
489 Ga0157374_10239781
490 Ga0157374_10430017
491 Ga0157374_10791668
492 Ga0157372_10111108
493 Ga0157372_10289293
494 Ga0157372_10328499
495 Ga0157380_11169581
496 Ga0197907_10399879
497 Ga0197907_11065326
498 Ga0206356_10258789
499 Ga0206356_11359727
500 Ga0206349_1878909
501 Ga0206355_1274499
502 Ga0206352_11230441
503 Ga0206350_10950338
504 Ga0206354_10914309
505 Ga0206353_10276316
506 Ga0206353_11191474
507 Ga0206353_11237054
508 Ga0206353_11967712
509 Ga0154015_1023601
510 Ga0213873_10000086
511 Ga0213876_10154881
512 Ga0213876_10261177
513 Ga0213875_10000325
514 Ga0213875_10098349
515 Ga0224712_10014931
516 Ga0224712_10050794
517 Ga0224712_10218402
518 Ga0224712_10269827
519 Ga0207647_10313167
520 Ga0207707_10006826
521 Ga0207707_10029821
522 Ga0207707_10196813
523 Ga0207695_10211840
524 Ga0207695_10269961
525 Ga0207671_10141351
526 Ga0207671_10158198
527 Ga0207693_10395753
528 Ga0207663_10196585
529 Ga0207660_10055176
530 Ga0207657_10002304
531 Ga0207657_10003843
532 Ga0207657_10039896
533 Ga0207649_10281870
534 Ga0207649_10827330
535 Ga0207652_10012970
536 Ga0207652_10098017
537 Ga0207652_10139229
538 Ga0207646_10131226
539 Ga0207694_10086896
540 Ga0207694_10224342
541 Ga0207687_10422640
542 Ga0207700_10591094
543 Ga0207664_10339678
544 Ga0207664_10470738
545 Ga0207690_10071912
546 Ga0207690_10630500
547 Ga0207686_11707454
548 Ga0207661_10137281
549 Ga0207661_10398693
550 Ga0207661_10567805
551 Ga0207667_10156289
552 Ga0207667_10272299
553 Ga0207667_10390100
554 Ga0207667_10678859
555 Ga0207667_10983631
556 Ga0207640_10051039
557 Ga0207639_10281921
558 Ga0207639_10954419
559 Ga0207639_11176649
560 Ga0207702_10887214
561 Ga0207702_10963175
562 Ga0207674_10035362
563 Ga0207674_10184684
564 Ga0207698_10053277
565 Ga0207698_10228110
566 Ga0268266_11376720
567 Ga0265318_10096798
568 Ga0265338_10034600
569 Ga0265338_10088555
570 Ga0265338_10393662
571 Ga0265320_10234757
572 Ga0265327_10052999
573 Ga0265327_10107062
574 Ga0265327_10132185
575 Ga0265313_10101115
576 Ga0265313_10138223
577 Ga0265314_10067399
578 Ga0265342_10337046
579 Ga0265342_10398953
580 Ga0307405_10289950
581 Ga0307409_100463472
582 Ga0307409_100681531
583 Ga0307416_100130326
584 Ga0307416_100523245
585 Ga0307415_100338673
586 Ga0373923_0074765
587 Ga0373936_0005255
588 Ga0373945_0001949
589 Ga0373953_0320825
590 Ga0373956_0054224
591 Ga0373943_0007949
592 Ga0373943_0009612
593 Ga0373946_0058529
594 Ga0373924_0047089
595 Ga0373935_0142474
596 Ga0373927_0006464
597 Ga0373927_0156374
598 Ga0373933_0236061
599 Ga0373947_0017190
600 Ga0373937_0023359
601 Ga0265778_024049
602 Ga0373925_0114092
603 Ga0395899_0038855
604 Ga0395899_0364436
605 Ga0395900_0016957
606 Ga0395900_0187918
607 Ga0395900_0449573
608 Ga0395900_0706709
609 Ga0395898_0011843
610 Ga0395905_0067007
611 Ga0436364_0329774
612 Ga0436364_0546584
613 Ga0436364_1130831
614 Ga0395901_0009145
615 Ga0395901_0011327
616 Ga0436365_0590264
617 Ga0436365_0607256
618 Ga0436365_0766371
619 Ga0436365_1364532
620 Ga0436365_1699597
621 Ga0436365_1926389
622 Ga0436360_1036167
623 Ga0436363_0604331
624 Ga0436363_0717546
625 Ga0436362_0218630
626 Ga0436362_1124595
627 Ga0439448_0138215
628 Ga0466965_0023175
629 Ga0466965_0230852
630 Ga0466966_0001468
631 Ga0466966_0002668
632 Ga0466966_0011245
633 Ga0466966_0385577
634 Ga0466961_0020976
635 Ga0466961_0023227
636 Ga0466961_0032137
637 Ga0466961_0333671
638 Ga0466963_0000187
639 Ga0466963_0003880
640 Ga0466963_0011122
641 Ga0466963_0011679
642 Ga0466963_0027820
643 Ga0466963_0049631
644 Ga0466963_0057214
645 Ga0466963_0082830
646 Ga0466963_0336821
647 Ga0466964_0017490
648 Ga0466964_0058906
649 Ga0466964_0147542
650 Ga0466964_0241477
651 Ga0466971_0007354
652 Ga0466971_0053449
653 Ga0466968_0000575
654 Ga0466968_0126532
655 Ga0466968_0154179
656 Ga0466968_0185643
657 Ga0466970_0029159
658 Ga0466970_0074505
659 Ga0466970_0095472
660 Ga0466970_0259129
661 Ga0466957_0001489
662 Ga0466957_0002545
663 Ga0466957_0170916
664 Ga0466957_0267891
665 Ga0466957_0305801
666 Ga0466957_0461721
667 Ga0466960_0152736
668 Ga0466959_0019365
669 Ga0466959_0060112
670 Ga0466959_0069738
671 Ga0466959_0132060
672 Ga0466959_0135130
673 Ga0466958_0000505
674 Ga0466958_0026918
675 Ga0466958_0057845
676 Ga0466967_0001253
677 Ga0466967_0001654
678 Ga0466967_0003188
679 Ga0466967_0008347
680 Ga0466967_0017664
681 Ga0466967_0036302
682 Ga0466967_0036911
683 Ga0466967_0040236
684 Ga0466967_0043438
685 Ga0466967_0051968
686 Ga0466967_0061001
687 Ga0466967_0063691
688 Ga0466967_0086383
689 Ga0466967_0123106
690 Ga0466967_0172290
691 Ga0466967_0176361
692 Ga0466967_0335819
693 Ga0466967_0358830
694 Ga0466967_0380240
695 Ga0466967_0845142
696 Ga0495592_0260346
697 Ga0495629_0300704
698 Ga0495651_0029903
699 Ga0495580_0445428
700 Ga0495662_0152112
701 Ga0495664_0061573
702 Ga0495664_0075093
703 Ga0495664_0159821
704 Ga0495608_0009789
705 Ga0495608_0016196
706 Ga0495618_0095516
707 Ga0495618_0102753
708 Ga0495618_0197136
709 Ga0495628_0030516
710 Ga0495628_0166969
711 Ga0495630_0008240
712 Ga0495630_0116372
713 Ga0495630_0145692
714 Ga0495652_0036544
715 Ga0495652_0048020
716 Ga0495652_0631315
717 Ga0495640_0020260
718 Ga0495587_0033822
719 Ga0495587_0319644
720 Ga0495645_0263484
721 Ga0495645_0468768
722 Ga0495667_0003696
723 Ga0495667_0146729
724 Ga0495634_0056680
725 Ga0495635_0758731
726 Ga0495657_0009284
727 Ga0495657_0048412
728 Ga0495599_0015646
729 Ga0495623_0014932
730 Ga0495646_0070054
731 Ga0495646_0107593
732 Ga0495658_0076252
733 Ga0495658_0151034
734 Ga0495658_0159083
735 Ga0495613_0075903
736 Ga0495613_0638682
737 Ga0495600_0011036
738 Ga0495600_0584070
739 Ga0495581_0335640
740 Ga0495581_0506802
741 Ga0495604_0020477
742 Ga0495604_0076031
743 Ga0495674_0006882
744 Ga0495674_0013821
745 Ga0495674_0016707
746 Ga0495674_0485285
747 Ga0495674_0525502
748 Ga0495676_0120916
749 Ga0495680_0000973
750 Ga0495680_0007950
751 Ga0495680_0364445
752 Ga0495675_0002986
753 Ga0495684_0084116
754 Ga0495684_0144741
755 Ga0495614_0338564
756 Ga0496101_0015150
757 Ga0496102_0897859
758 Ga0496106_0462178
759 Ga0496107_0014656
760 Ga0496109_0406046
761 Ga0496112_0030323
762 Ga0496112_0527493
763 Ga0496112_1310243
764 Ga0496114_0142772
765 Ga0496114_0703897
766 Ga0496115_0007041
767 Ga0496115_0172087
768 Ga0496115_0211964
769 Ga0501040_0235311
770 Ga0501067_0000163
771 Ga0501067_0101645
772 Ga0501068_0017810
773 Ga0501069_0004585
774 Ga0501075_0244464
775 Ga0501076_0143020
776 Ga0501077_0027650
777 Ga0501079_0544922
778 Ga0501080_0721156
779 Ga0501081_0464521
780 nmdc:mga05p37_724532_c2
781 nmdc:mga0rr50_1005780_c1
782 nmdc:mga0a205_1261138_c1
783 Ga0495601_0185638
784 Ga0495601_0499821
785 Ga0495601_0743236
786 Ga0495612_0009626
787 Ga0495612_0153933
788 Ga0495619_0016160
789 Ga0495619_0187245
790 Ga0495619_0400126
791 Ga0501084_0199756
792 Ga0501084_0246607
793 Ga0501084_1311003
794 Ga0587114_065823
795 Ga0501082_0235568
796 Ga0501082_0992609
797 Ga0466962_0011159
798 Ga0466962_0016429
799 Ga0466962_0228218
800 Ga0466962_0455179
801 Ga0530510_0051540
802 Ga0530510_0899339

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03449

GreA_GreB_N

Transcription elongation factor, N-terminal

6

76

0.98

PF01272

GreA_GreB

Transcription elongation factor, GreA/GreB, C-term

80

148

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ta8-assembly1.cif.gz_A crystal structure hp-nap from strain ys39 iron loaded (cocrystallization 5mm) 0.8909 16 73
3auy-assembly1.cif.gz_B crystal structure of rad50 bound to adp 0.8817 13 75
6e8g-assembly1.cif.gz_T cryoem reconstruction of ist1-chmp1b copolymer filament bound to ssdna at 2.9 angstrom resolution 0.8817 13 74
1wle-assembly1.cif.gz_A crystal structure of mammalian mitochondrial seryl-trna synthetase complexed with seryl-adenylate 0.881 14 74
5f7t-assembly4.cif.gz_L trim5 b-box2 and coiled-coil chimera 0.8807 13 74
ID Description Score Start End Superfamily
af_P9WMT9_4_78_1.10.287.180 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain 0.9865 7 79 1.10.287.180
af_Q2FXW7_4_78_1.10.287.180 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain 0.9678 8 79 1.10.287.180
af_P0A6W5_1_75_1.10.287.180 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain 0.9588 7 79 1.10.287.180
af_P9WMT9_4_78_1.10.287.180 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain 0.9481 7 79 1.10.287.180
1grjA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain 0.9446 7 79 1.10.287.180
ID Description Score Start End GO Terms
AF-A0A1H8XDF6-F1-model_v4 Transcription elongation factor, GreA/GreB, C-term 0.938 79 162 GO:0003677
GO:0003746
GO:0032784
GO:0070063
AF-A0A5C7J4Q7-F1-model_v4 Transcription elongation factor GreA/GreB N-terminal domain-containing protein 0.9269 9 84 GO:0003677
GO:0006354
GO:0032784
GO:0070063
AF-A0A7X6HAY2-F1-model_v4 deleted 0.9009 79 164
AF-A0A0G1XUT7-F1-model_v4 Transcription elongation factor GreA 0.8996 1 79 GO:0003677
GO:0003746
GO:0006354
GO:0032784
GO:0070063
AF-A0A7I7KKK0-F1-model_v4 deleted 0.8191 3 164

Map