F434795

General Info

Members Datasets Scaffolds Average Seq Length
401 225 802 228

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100169166|Ga0068855_1001691663
Length 254
Sequence MNPDITSRLNGVRERIAGAALRAGRPPSSVHLIAVSKTFPVDVVRAAAAAGQIDFGENKVQEGQAKILAAGTLPLRWHLIGHLQSNKAKKAAAVFDVIHSIDSIDLLRKVDAAAAEHRRTIDVLIQVDLASEPTKHGAPEADVPDIVDAARSCHSARLKGLMLLPPTVDDPADAAPYFAALRELRDGYVRLGVPASMLEQLSMGMSHDFEVAVEQGATWVRVGSAIFGPRSASPAGSGRRAGSDSSRNGVEKMK

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
147 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
159 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
160 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
161 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
162 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
164 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
165 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
177 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
178 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
179 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
180 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
181 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
184 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
185 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
186 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
187 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
188 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
189 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
190 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
191 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
192 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
193 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
196 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
197 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
211 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
216 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
220 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
221 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
222 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
224 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
225 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0.5
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.25
Nodule 0
Rhizoplane 4.24
Rhizosphere 94.51
Stem 0
Stem Tuber 0
Unclassified 8.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100169166 3300005563 Bacteria 2476
2 Ga0065712_10002053 3300005290 Bacteria 8574
3 Ga0070658_10001230 3300005327 Bacteria 21953
4 Ga0070658_10006376 3300005327 Bacteria 9560
5 Ga0070658_10051233 3300005327 Bacteria 3346
6 Ga0070658_10052350 3300005327 Bacteria 3310
7 Ga0070658_10071386 3300005327 Bacteria 2844
8 Ga0070658_10109218 3300005327 Unclassified 2290
9 Ga0070658_10269096 3300005327 Bacteria 1449
10 Ga0070676_10006336 3300005328 Bacteria 6321
11 Ga0070683_100004580 3300005329 Bacteria 11411
12 Ga0070683_100016824 3300005329 Bacteria 6452
13 Ga0070690_100054391 3300005330 Bacteria 2563
14 Ga0070690_100096978 3300005330 Bacteria 1949
15 Ga0070670_100021809 3300005331 Bacteria 5508
16 Ga0068869_100007773 3300005334 Bacteria 6877
17 Ga0070666_10031172 3300005335 Bacteria 3518
18 Ga0070666_10105551 3300005335 Bacteria 1946
19 Ga0070666_10333012 3300005335 Bacteria 1084
20 Ga0070680_100005779 3300005336 Bacteria 9390
21 Ga0070682_100506160 3300005337 Bacteria 937
22 Ga0068868_100199379 3300005338 Bacteria 1668
23 Ga0070660_100065255 3300005339 Bacteria 2833
24 Ga0070660_100644351 3300005339 Bacteria 887
25 Ga0070689_100227672 3300005340 Bacteria 1531
26 Ga0070691_10056408 3300005341 Bacteria 1883
27 Ga0070691_10218003 3300005341 Bacteria 1010
28 Ga0070661_100039735 3300005344 Unclassified 3429
29 Ga0070661_100072626 3300005344 Bacteria 2532
30 Ga0070661_100239174 3300005344 Unclassified 1397
31 Ga0070661_100354058 3300005344 Bacteria 1152
32 Ga0070692_10273861 3300005345 Bacteria 1020
33 Ga0070668_100017480 3300005347 Bacteria 5376
34 Ga0070669_100037179 3300005353 Bacteria 3531
35 Ga0070669_100038596 3300005353 Bacteria 3467
36 Ga0070669_100223380 3300005353 Bacteria 1490
37 Ga0070675_100021201 3300005354 Bacteria 5190
38 Ga0070675_100065204 3300005354 Bacteria 3011
39 Ga0070675_100526511 3300005354 Bacteria 1067
40 Ga0070675_100681150 3300005354 Bacteria 936
41 Ga0070671_100020021 3300005355 Bacteria 5451
42 Ga0070671_100114341 3300005355 Bacteria 2268
43 Ga0070671_100154363 3300005355 Bacteria 1939
44 Ga0070674_100056318 3300005356 Bacteria 2726
45 Ga0070674_100119706 3300005356 Bacteria 1948
46 Ga0070674_100550951 3300005356 Bacteria 968
47 Ga0070673_100004319 3300005364 Bacteria 8977
48 Ga0070673_100176205 3300005364 Bacteria 1828
49 Ga0070673_100198126 3300005364 Bacteria 1728
50 Ga0070673_100214544 3300005364 Bacteria 1663
51 Ga0070673_100292472 3300005364 Bacteria 1432
52 Ga0070688_100009805 3300005365 Bacteria 5263
53 Ga0070688_100020387 3300005365 Bacteria 3855
54 Ga0070688_100429953 3300005365 Bacteria 983
55 Ga0070659_100039505 3300005366 Bacteria 3684
56 Ga0070659_100081394 3300005366 Bacteria 2586
57 Ga0070659_100136359 3300005366 Bacteria 1996
58 Ga0070667_100047514 3300005367 Bacteria 3611
59 Ga0070667_100071326 3300005367 Bacteria 2958
60 Ga0070667_100148133 3300005367 Bacteria 2060
61 Ga0070667_100543372 3300005367 Bacteria 1067
62 Ga0070714_100057001 3300005435 Bacteria 3343
63 Ga0070714_100086242 3300005435 Bacteria 2744
64 Ga0070713_100128655 3300005436 Bacteria 2231
65 Ga0070713_100132435 3300005436 Bacteria 2200
66 Ga0070701_10310406 3300005438 Bacteria 972
67 Ga0070705_100024750 3300005440 Bacteria 3245
68 Ga0070700_100332779 3300005441 Bacteria 1120
69 Ga0070708_100465303 3300005445 Unclassified 1193
70 Ga0070678_100770458 3300005456 Unclassified 872
71 Ga0070681_10332226 3300005458 Bacteria 1430
72 Ga0068867_100009480 3300005459 Bacteria 6865
73 Ga0068867_100011119 3300005459 Bacteria 6349
74 Ga0070685_10008143 3300005466 Bacteria 5373
75 Ga0070706_100115926 3300005467 Bacteria 2494
76 Ga0070679_100017275 3300005530 Bacteria 6981
77 Ga0070679_100351427 3300005530 Bacteria 1422
78 Ga0070679_100373585 3300005530 Bacteria 1372
79 Ga0070679_100382634 3300005530 Bacteria 1354
80 Ga0070679_100647229 3300005530 Bacteria 1000
81 Ga0070684_100004941 3300005535 Bacteria 10176
82 Ga0070684_100048705 3300005535 Bacteria 3676
83 Ga0070684_100319614 3300005535 Bacteria 1426
84 Ga0068853_100113281 3300005539 Bacteria 2411
85 Ga0070672_100004266 3300005543 Bacteria 9345
86 Ga0070672_100047337 3300005543 Bacteria 3336
87 Ga0070672_100094562 3300005543 Bacteria 2416
88 Ga0070672_100152970 3300005543 Bacteria 1909
89 Ga0070672_100226735 3300005543 Unclassified 1568
90 Ga0070686_100073967 3300005544 Bacteria 2238
91 Ga0070686_100203695 3300005544 Bacteria 1420
92 Ga0070686_100408632 3300005544 Bacteria 1034
93 Ga0070695_100467310 3300005545 Bacteria 970
94 Ga0070696_100042723 3300005546 Unclassified 3133
95 Ga0070696_100138885 3300005546 Bacteria 1774
96 Ga0070693_100013523 3300005547 Bacteria 4159
97 Ga0070704_100051735 3300005549 Bacteria 2894
98 Ga0068855_100016469 3300005563 Bacteria 8889
99 Ga0068855_100235568 3300005563 Bacteria 2047
100 Ga0068855_100463296 3300005563 Bacteria 1382
101 Ga0068855_100530860 3300005563 Bacteria 1276
102 Ga0070664_100031908 3300005564 Bacteria 4405
103 Ga0070664_100078909 3300005564 Bacteria 2832
104 Ga0070664_100087381 3300005564 Bacteria 2695
105 Ga0070664_100387171 3300005564 Bacteria 1277
106 Ga0068857_100018350 3300005577 Bacteria 6138
107 Ga0068857_100148046 3300005577 Bacteria 2125
108 Ga0068854_100057055 3300005578 Bacteria 2816
109 Ga0068856_100022158 3300005614 Bacteria 6178
110 Ga0068856_100062143 3300005614 Bacteria 3689
111 Ga0068856_100419188 3300005614 Bacteria 1359
112 Ga0070702_100056735 3300005615 Bacteria 2263
113 Ga0068852_100011290 3300005616 Bacteria 6719
114 Ga0068852_100031333 3300005616 Bacteria 4387
115 Ga0068852_100182918 3300005616 Bacteria 1972
116 Ga0068852_100217065 3300005616 Bacteria 1817
117 Ga0068852_100252643 3300005616 Unclassified 1689
118 Ga0068859_100031725 3300005617 Bacteria 5306
119 Ga0068859_100203899 3300005617 Bacteria 2062
120 Ga0068864_100377983 3300005618 Bacteria 1342
121 Ga0068866_10068748 3300005718 Bacteria 1864
122 Ga0068861_100053544 3300005719 Bacteria 3071
123 Ga0068861_100342498 3300005719 Bacteria 1309
124 Ga0068851_10123851 3300005834 Bacteria 1392
125 Ga0068863_100346238 3300005841 Bacteria 1446
126 Ga0068860_100069139 3300005843 Bacteria 3356
127 Ga0068860_100269496 3300005843 Bacteria 1661
128 Ga0068862_100139014 3300005844 Bacteria 2155
129 Ga0068862_100141436 3300005844 Bacteria 2136
130 Ga0068862_100898054 3300005844 Bacteria 871
131 Ga0070717_10063797 3300006028 Unclassified 3059
132 Ga0075365_10005237 3300006038 Bacteria 6978
133 Ga0075364_10159389 3300006051 Bacteria 1523
134 Ga0097621_100418073 3300006237 Bacteria 1203
135 Ga0068871_100134529 3300006358 Bacteria 2099
136 Ga0075428_100413217 3300006844 Unclassified 1446
137 Ga0075433_10055844 3300006852 Bacteria 3448
138 Ga0075429_100129155 3300006880 Bacteria 2210
139 Ga0068865_100123382 3300006881 Bacteria 1930
140 Ga0075436_100030034 3300006914 Bacteria 3739
141 Ga0097620_100031726 3300006931 Bacteria 5306
142 Ga0097620_100203902 3300006931 Bacteria 2062
143 Ga0075435_100003225 3300007076 Bacteria 11045
144 Ga0075435_100126984 3300007076 Bacteria 2132
145 Ga0105240_10075490 3300009093 Bacteria 4158
146 Ga0111539_10064033 3300009094 Bacteria 4351
147 Ga0105245_10032354 3300009098 Bacteria 4630
148 Ga0105245_10041139 3300009098 Bacteria 4120
149 Ga0105245_10204497 3300009098 Bacteria 1898
150 Ga0105243_10013931 3300009148 Bacteria 6085
151 Ga0105242_10021175 3300009176 Bacteria 5103
152 Ga0105242_10021687 3300009176 Bacteria 5046
153 Ga0105242_10269571 3300009176 Bacteria 1541
154 Ga0105248_10012575 3300009177 Bacteria 9338
155 Ga0105248_10022507 3300009177 Bacteria 6991
156 Ga0105248_10046093 3300009177 Bacteria 4887
157 Ga0105248_10050971 3300009177 Bacteria 4644
158 Ga0105248_10074224 3300009177 Bacteria 3823
159 Ga0105248_10742374 3300009177 Bacteria 1107
160 Ga0105249_10245342 3300009553 Bacteria 1773
161 Ga0105239_10110062 3300010375 Bacteria 3053
162 Ga0157373_10298647 3300013100 Bacteria 1143
163 Ga0157371_10095999 3300013102 Bacteria 2101
164 Ga0157370_10034964 3300013104 Bacteria 4889
165 Ga0157370_10062525 3300013104 Bacteria 3530
166 Ga0157370_10634237 3300013104 Bacteria 977
167 Ga0157369_10061329 3300013105 Bacteria 4054
168 Ga0157369_10132261 3300013105 Bacteria 2643
169 Ga0157369_10315346 3300013105 Bacteria 1626
170 Ga0157378_10042203 3300013297 Bacteria 4048
171 Ga0157378_10050637 3300013297 Bacteria 3696
172 Ga0157378_10805425 3300013297 Bacteria 965
173 Ga0163162_10661919 3300013306 Unclassified 1167
174 Ga0157372_10010304 3300013307 Bacteria 9931
175 Ga0157372_10012913 3300013307 Bacteria 8904
176 Ga0157372_10192836 3300013307 Bacteria 2360
177 Ga0157372_10214744 3300013307 Bacteria 2229
178 Ga0157372_10347547 3300013307 Bacteria 1728
179 Ga0157375_10063611 3300013308 Bacteria 3671
180 Ga0157375_10070033 3300013308 Bacteria 3516
181 Ga0157375_11011198 3300013308 Bacteria 971
182 Ga0157375_11385626 3300013308 Bacteria 828
183 Ga0163163_10487646 3300014325 Bacteria 1294
184 Ga0157380_10325525 3300014326 Unclassified 1427
185 Ga0157380_11088014 3300014326 Bacteria 838
186 Ga0157376_10147090 3300014969 Bacteria 2120
187 Ga0157376_10450948 3300014969 Bacteria 1255
188 Ga0163161_10076790 3300017792 Bacteria 2452
189 Ga0206353_11972598 3300020082 Bacteria 2775
190 Ga0206353_12061870 3300020082 Bacteria 974
191 Ga0207656_10095789 3300025321 Bacteria 1354
192 Ga0207682_10005260 3300025893 Bacteria 5293
193 Ga0207688_10122909 3300025901 Bacteria 1516
194 Ga0207688_10258018 3300025901 Unclassified 1057
195 Ga0207647_10146513 3300025904 Bacteria 1381
196 Ga0207699_10005128 3300025906 Bacteria 6273
197 Ga0207645_10004471 3300025907 Bacteria 10345
198 Ga0207643_10013080 3300025908 Bacteria 4488
199 Ga0207705_10014712 3300025909 Bacteria 5626
200 Ga0207705_10019020 3300025909 Bacteria 4913
201 Ga0207705_10029311 3300025909 Bacteria 3923
202 Ga0207705_10177265 3300025909 Bacteria 1607
203 Ga0207705_10186527 3300025909 Bacteria 1567
204 Ga0207707_10285032 3300025912 Bacteria 1430
205 Ga0207707_10851450 3300025912 Bacteria 757
206 Ga0207660_10813132 3300025917 Unclassified 763
207 Ga0207662_10040063 3300025918 Bacteria 2752
208 Ga0207662_10070801 3300025918 Bacteria 2110
209 Ga0207657_10042882 3300025919 Bacteria 3989
210 Ga0207657_10286140 3300025919 Bacteria 1308
211 Ga0207657_10416837 3300025919 Bacteria 1056
212 Ga0207649_10040610 3300025920 Bacteria 2829
213 Ga0207649_10083181 3300025920 Bacteria 2077
214 Ga0207649_10122258 3300025920 Bacteria 1756
215 Ga0207649_10418817 3300025920 Bacteria 1005
216 Ga0207652_10138919 3300025921 Bacteria 2171
217 Ga0207652_10793454 3300025921 Bacteria 841
218 Ga0207681_10224664 3300025923 Bacteria 1454
219 Ga0207681_10285037 3300025923 Bacteria 1302
220 Ga0207650_10158102 3300025925 Bacteria 1794
221 Ga0207659_10072054 3300025926 Bacteria 2525
222 Ga0207659_10431356 3300025926 Bacteria 1107
223 Ga0207659_10461828 3300025926 Bacteria 1071
224 Ga0207687_10230964 3300025927 Bacteria 1461
225 Ga0207687_10268911 3300025927 Unclassified 1362
226 Ga0207700_10055353 3300025928 Bacteria 2982
227 Ga0207700_10068386 3300025928 Bacteria 2722
228 Ga0207700_10157722 3300025928 Bacteria 1882
229 Ga0207664_10058853 3300025929 Bacteria 3058
230 Ga0207644_10056177 3300025931 Bacteria 2840
231 Ga0207644_10113813 3300025931 Bacteria 2049
232 Ga0207690_10016000 3300025932 Bacteria 4558
233 Ga0207690_10095310 3300025932 Bacteria 2114
234 Ga0207690_10643849 3300025932 Bacteria 868
235 Ga0207706_10071921 3300025933 Bacteria 3042
236 Ga0207706_10090958 3300025933 Bacteria 2683
237 Ga0207706_10342588 3300025933 Unclassified 1300
238 Ga0207686_10017407 3300025934 Bacteria 4050
239 Ga0207686_10046270 3300025934 Bacteria 2682
240 Ga0207709_10044548 3300025935 Bacteria 2682
241 Ga0207670_10055539 3300025936 Bacteria 2677
242 Ga0207670_10705919 3300025936 Bacteria 835
243 Ga0207669_10051309 3300025937 Bacteria 2471
244 Ga0207669_10104715 3300025937 Bacteria 1880
245 Ga0207704_10065105 3300025938 Bacteria 2281
246 Ga0207691_10006396 3300025940 Bacteria 11377
247 Ga0207691_10010627 3300025940 Bacteria 8832
248 Ga0207691_10042313 3300025940 Bacteria 4200
249 Ga0207691_10056941 3300025940 Bacteria 3560
250 Ga0207691_10601502 3300025940 Unclassified 931
251 Ga0207711_10020480 3300025941 Bacteria 5515
252 Ga0207711_10056153 3300025941 Bacteria 3383
253 Ga0207689_10007122 3300025942 Bacteria 9833
254 Ga0207661_10018486 3300025944 Bacteria 5178
255 Ga0207661_10030645 3300025944 Bacteria 4146
256 Ga0207679_10014942 3300025945 Bacteria 5116
257 Ga0207679_10176189 3300025945 Bacteria 1765
258 Ga0207679_10299930 3300025945 Bacteria 1385
259 Ga0207679_10373149 3300025945 Bacteria 1249
260 Ga0207679_10768183 3300025945 Bacteria 877
261 Ga0207667_10084808 3300025949 Bacteria 3279
262 Ga0207667_10129407 3300025949 Bacteria 2600
263 Ga0207667_10187722 3300025949 Bacteria 2121
264 Ga0207651_10031205 3300025960 Bacteria 3403
265 Ga0207651_10244464 3300025960 Bacteria 1465
266 Ga0207712_10350570 3300025961 Bacteria 1227
267 Ga0207668_10013720 3300025972 Bacteria 4999
268 Ga0207668_10481655 3300025972 Bacteria 1064
269 Ga0207658_10066707 3300025986 Bacteria 2708
270 Ga0207658_10104773 3300025986 Bacteria 2223
271 Ga0207703_10059813 3300026035 Bacteria 3113
272 Ga0207703_10266327 3300026035 Bacteria 1551
273 Ga0207703_10371258 3300026035 Bacteria 1321
274 Ga0207639_10763930 3300026041 Bacteria 899
275 Ga0207708_10009414 3300026075 Bacteria 7233
276 Ga0207702_10334218 3300026078 Bacteria 1446
277 Ga0207702_10365635 3300026078 Bacteria 1384
278 Ga0207702_10498895 3300026078 Bacteria 1186
279 Ga0207641_10760303 3300026088 Bacteria 957
280 Ga0207648_10045014 3300026089 Bacteria 3872
281 Ga0207676_10155845 3300026095 Bacteria 1973
282 Ga0207674_10002460 3300026116 Bacteria 23376
283 Ga0207674_10026779 3300026116 Bacteria 6116
284 Ga0207675_100013501 3300026118 Bacteria 7622
285 Ga0207683_10118551 3300026121 Bacteria 2374
286 Ga0207683_10394138 3300026121 Bacteria 1273
287 Ga0207683_10676045 3300026121 Unclassified 957
288 Ga0207698_10009820 3300026142 Bacteria 6117
289 Ga0207698_10045354 3300026142 Bacteria 3311
290 Ga0207698_10217187 3300026142 Unclassified 1725
291 Ga0207698_10400756 3300026142 Bacteria 1311
292 Ga0207428_10032275 3300027907 Bacteria 4308
293 Ga0207428_10144187 3300027907 Bacteria 1816
294 Ga0268265_10884254 3300028380 Bacteria 876
295 Ga0268264_10370170 3300028381 Bacteria 1369
296 Ga0268264_10485813 3300028381 Bacteria 1202
297 Ga0265338_10238917 3300028800 Bacteria 1347
298 Ga0265338_10264929 3300028800 Bacteria 1262
299 Ga0316576_10059243 3300031727 Bacteria 2803
300 Ga0316576_10118588 3300031727 Bacteria 1987
301 Ga0307405_10002955 3300031731 Bacteria 7674
302 Ga0307405_10177202 3300031731 Bacteria 1527
303 Ga0307413_10158620 3300031824 Bacteria 1586
304 Ga0307410_10008779 3300031852 Bacteria 5629
305 Ga0307407_10524309 3300031903 Bacteria 872
306 Ga0307412_10033156 3300031911 Bacteria 3280
307 Ga0307409_100132706 3300031995 Bacteria 2131
308 Ga0307416_100071014 3300032002 Bacteria 2890
309 Ga0307416_100075054 3300032002 Bacteria 2828
310 Ga0307416_100324693 3300032002 Bacteria 1543
311 Ga0307414_10781155 3300032004 Bacteria 870
312 Ga0307411_10032558 3300032005 Bacteria 3223
313 Ga0307411_10074093 3300032005 Bacteria 2318
314 Ga0307415_100048340 3300032126 Bacteria 2870
315 Ga0307415_100366633 3300032126 Bacteria 1218
316 Ga0316583_10033332 3300032133 Bacteria 1830
317 Ga0373934_0025047 3300035086 Unclassified 2309
318 Ga0373944_0061644 3300035089 Bacteria 1204
319 Ga0373949_0007751 3300035090 Bacteria 2352
320 Ga0373923_0028108 3300035111 Bacteria 2248
321 Ga0373941_0036898 3300035115 Bacteria 1489
322 Ga0373941_0170861 3300035115 Unclassified 810
323 Ga0373953_0147126 3300035117 Bacteria 1009
324 Ga0373943_0002353 3300035170 Bacteria 8586
325 Ga0373955_0014845 3300035172 Bacteria 3801
326 Ga0373924_0002407 3300035410 Bacteria 6292
327 Ga0373931_0056439 3300035691 Bacteria 2104
328 Ga0373935_0005638 3300035692 Bacteria 7389
329 Ga0373935_0129127 3300035692 Bacteria 1697
330 Ga0373927_0128125 3300035695 Bacteria 1658
331 Ga0373927_0131048 3300035695 Bacteria 1638
332 Ga0373933_0007204 3300035724 Bacteria 6063
333 Ga0373933_0576405 3300035724 Bacteria 739
334 Ga0373947_0004304 3300035725 Bacteria 8362
335 Ga0373947_0028311 3300035725 Bacteria 3284
336 Ga0373937_0006538 3300036401 Bacteria 10067
337 Ga0373937_0188090 3300036401 Bacteria 1939
338 Ga0373937_0711441 3300036401 Unclassified 951
339 Ga0395905_0933736 3300037471 Bacteria 771
340 Ga0395901_0591670 3300038443 Bacteria 1120
341 Ga0439444_0024286 3300042437 Unclassified 1095
342 Ga0439464_0009979 3300042439 Bacteria 2504
343 Ga0439460_0007193 3300042461 Bacteria 2776
344 Ga0439460_0025151 3300042461 Bacteria 1656
345 Ga0451577_0239768 3300042876 Bacteria 1641
346 Ga0466963_0007080 3300044694 Bacteria 6680
347 Ga0453684_0000010 3300044712 Bacteria 1133422
348 Ga0451576_0304460 3300045051 Unclassified 1667
349 Ga0466967_0247099 3300045976 Bacteria 1703
350 Ga0495651_0210440 3300046462 Unclassified 1354
351 Ga0495664_0115937 3300046477 Bacteria 1619
352 Ga0495664_0187261 3300046477 Bacteria 1255
353 Ga0495620_0165894 3300046515 Unclassified 857
354 Ga0495628_0434064 3300046516 Unclassified 956
355 Ga0495587_0129427 3300046536 Bacteria 1443
356 Ga0495645_0422026 3300046543 Bacteria 846
357 Ga0495657_0148881 3300046675 Unclassified 1455
358 Ga0495613_0210029 3300046689 Unclassified 1369
359 Ga0495600_0070039 3300046809 Bacteria 2292
360 Ga0495581_0110066 3300047315 Bacteria 1602
361 Ga0495674_0053850 3300047319 Unclassified 3535
362 Ga0495675_0026316 3300047444 Unclassified 3709
363 Ga0495684_0143712 3300047471 Bacteria 1788
364 Ga0495684_0290112 3300047471 Bacteria 1178
365 Ga0496100_0089400 3300048903 Bacteria 2098
366 Ga0496101_0680788 3300048904 Bacteria 812
367 Ga0496102_0017513 3300048905 Bacteria 6275
368 Ga0496104_0587128 3300048907 Unclassified 1024
369 Ga0496106_0033571 3300048909 Bacteria 3829
370 Ga0496108_0096588 3300048911 Bacteria 2517
371 Ga0496109_0169147 3300048912 Bacteria 2050
372 Ga0496110_0018847 3300048913 Bacteria 5797
373 Ga0496110_0122969 3300048913 Bacteria 2340
374 Ga0496110_0742907 3300048913 Bacteria 884
375 Ga0496111_0012464 3300048914 Bacteria 5757
376 Ga0496112_0026758 3300048915 Bacteria 5557
377 Ga0496112_0060127 3300048915 Bacteria 3744
378 Ga0496112_0275292 3300048915 Bacteria 1631
379 Ga0496113_0040693 3300048916 Bacteria 3426
380 Ga0496114_0425319 3300048917 Bacteria 1177
381 Ga0496115_0166890 3300048918 Bacteria 1821
382 Ga0501299_039999 3300049522 Bacteria 938
383 Ga0501033_0143665 3300049570 Bacteria 1725
384 Ga0501038_0068199 3300049574 Bacteria 3024
385 Ga0501043_0199505 3300049579 Bacteria 1553
386 Ga0501035_0083461 3300049822 Bacteria 2819
387 Ga0501035_0385551 3300049822 Bacteria 1168
388 nmdc:mga0yw44_113694_c1 3300050492 Bacteria 1737
389 nmdc:mga09592_284810_c1 3300050508 Unclassified 1433
390 nmdc:mga08y16_342991_c1 3300050511 Bacteria 1535
391 nmdc:mga08y16_56010_c1 3300050511 Bacteria 4121
392 nmdc:mga0n895_160945_c1 3300050512 Bacteria 2276
393 nmdc:mga0n895_53881_c1 3300050512 Bacteria 3954
394 nmdc:mga0rr50_160612_c1 3300050513 Bacteria 1824
395 nmdc:mga08x19_198608_c1 3300050514 Bacteria 1374
396 nmdc:mga0a205_86576_c1 3300050515 Bacteria 2677
397 Ga0495595_0058774 3300053084 Bacteria 1796
398 Ga0495619_0075220 3300053085 Bacteria 2266
399 Ga0495619_0080085 3300053085 Bacteria 2198
400 Ga0500628_007318 3300053129 Bacteria 1890
401 Ga0500645_003287 3300053730 Bacteria 6656
402 Ga0068855_100169166
403 Ga0065712_10002053
404 Ga0070658_10001230
405 Ga0070658_10006376
406 Ga0070658_10051233
407 Ga0070658_10052350
408 Ga0070658_10071386
409 Ga0070658_10109218
410 Ga0070658_10269096
411 Ga0070676_10006336
412 Ga0070683_100004580
413 Ga0070683_100016824
414 Ga0070690_100054391
415 Ga0070690_100096978
416 Ga0070670_100021809
417 Ga0068869_100007773
418 Ga0070666_10031172
419 Ga0070666_10105551
420 Ga0070666_10333012
421 Ga0070680_100005779
422 Ga0070682_100506160
423 Ga0068868_100199379
424 Ga0070660_100065255
425 Ga0070660_100644351
426 Ga0070689_100227672
427 Ga0070691_10056408
428 Ga0070691_10218003
429 Ga0070661_100039735
430 Ga0070661_100072626
431 Ga0070661_100239174
432 Ga0070661_100354058
433 Ga0070692_10273861
434 Ga0070668_100017480
435 Ga0070669_100037179
436 Ga0070669_100038596
437 Ga0070669_100223380
438 Ga0070675_100021201
439 Ga0070675_100065204
440 Ga0070675_100526511
441 Ga0070675_100681150
442 Ga0070671_100020021
443 Ga0070671_100114341
444 Ga0070671_100154363
445 Ga0070674_100056318
446 Ga0070674_100119706
447 Ga0070674_100550951
448 Ga0070673_100004319
449 Ga0070673_100176205
450 Ga0070673_100198126
451 Ga0070673_100214544
452 Ga0070673_100292472
453 Ga0070688_100009805
454 Ga0070688_100020387
455 Ga0070688_100429953
456 Ga0070659_100039505
457 Ga0070659_100081394
458 Ga0070659_100136359
459 Ga0070667_100047514
460 Ga0070667_100071326
461 Ga0070667_100148133
462 Ga0070667_100543372
463 Ga0070714_100057001
464 Ga0070714_100086242
465 Ga0070713_100128655
466 Ga0070713_100132435
467 Ga0070701_10310406
468 Ga0070705_100024750
469 Ga0070700_100332779
470 Ga0070708_100465303
471 Ga0070678_100770458
472 Ga0070681_10332226
473 Ga0068867_100009480
474 Ga0068867_100011119
475 Ga0070685_10008143
476 Ga0070706_100115926
477 Ga0070679_100017275
478 Ga0070679_100351427
479 Ga0070679_100373585
480 Ga0070679_100382634
481 Ga0070679_100647229
482 Ga0070684_100004941
483 Ga0070684_100048705
484 Ga0070684_100319614
485 Ga0068853_100113281
486 Ga0070672_100004266
487 Ga0070672_100047337
488 Ga0070672_100094562
489 Ga0070672_100152970
490 Ga0070672_100226735
491 Ga0070686_100073967
492 Ga0070686_100203695
493 Ga0070686_100408632
494 Ga0070695_100467310
495 Ga0070696_100042723
496 Ga0070696_100138885
497 Ga0070693_100013523
498 Ga0070704_100051735
499 Ga0068855_100016469
500 Ga0068855_100235568
501 Ga0068855_100463296
502 Ga0068855_100530860
503 Ga0070664_100031908
504 Ga0070664_100078909
505 Ga0070664_100087381
506 Ga0070664_100387171
507 Ga0068857_100018350
508 Ga0068857_100148046
509 Ga0068854_100057055
510 Ga0068856_100022158
511 Ga0068856_100062143
512 Ga0068856_100419188
513 Ga0070702_100056735
514 Ga0068852_100011290
515 Ga0068852_100031333
516 Ga0068852_100182918
517 Ga0068852_100217065
518 Ga0068852_100252643
519 Ga0068859_100031725
520 Ga0068859_100203899
521 Ga0068864_100377983
522 Ga0068866_10068748
523 Ga0068861_100053544
524 Ga0068861_100342498
525 Ga0068851_10123851
526 Ga0068863_100346238
527 Ga0068860_100069139
528 Ga0068860_100269496
529 Ga0068862_100139014
530 Ga0068862_100141436
531 Ga0068862_100898054
532 Ga0070717_10063797
533 Ga0075365_10005237
534 Ga0075364_10159389
535 Ga0097621_100418073
536 Ga0068871_100134529
537 Ga0075428_100413217
538 Ga0075433_10055844
539 Ga0075429_100129155
540 Ga0068865_100123382
541 Ga0075436_100030034
542 Ga0097620_100031726
543 Ga0097620_100203902
544 Ga0075435_100003225
545 Ga0075435_100126984
546 Ga0105240_10075490
547 Ga0111539_10064033
548 Ga0105245_10032354
549 Ga0105245_10041139
550 Ga0105245_10204497
551 Ga0105243_10013931
552 Ga0105242_10021175
553 Ga0105242_10021687
554 Ga0105242_10269571
555 Ga0105248_10012575
556 Ga0105248_10022507
557 Ga0105248_10046093
558 Ga0105248_10050971
559 Ga0105248_10074224
560 Ga0105248_10742374
561 Ga0105249_10245342
562 Ga0105239_10110062
563 Ga0157373_10298647
564 Ga0157371_10095999
565 Ga0157370_10034964
566 Ga0157370_10062525
567 Ga0157370_10634237
568 Ga0157369_10061329
569 Ga0157369_10132261
570 Ga0157369_10315346
571 Ga0157378_10042203
572 Ga0157378_10050637
573 Ga0157378_10805425
574 Ga0163162_10661919
575 Ga0157372_10010304
576 Ga0157372_10012913
577 Ga0157372_10192836
578 Ga0157372_10214744
579 Ga0157372_10347547
580 Ga0157375_10063611
581 Ga0157375_10070033
582 Ga0157375_11011198
583 Ga0157375_11385626
584 Ga0163163_10487646
585 Ga0157380_10325525
586 Ga0157380_11088014
587 Ga0157376_10147090
588 Ga0157376_10450948
589 Ga0163161_10076790
590 Ga0206353_11972598
591 Ga0206353_12061870
592 Ga0207656_10095789
593 Ga0207682_10005260
594 Ga0207688_10122909
595 Ga0207688_10258018
596 Ga0207647_10146513
597 Ga0207699_10005128
598 Ga0207645_10004471
599 Ga0207643_10013080
600 Ga0207705_10014712
601 Ga0207705_10019020
602 Ga0207705_10029311
603 Ga0207705_10177265
604 Ga0207705_10186527
605 Ga0207707_10285032
606 Ga0207707_10851450
607 Ga0207660_10813132
608 Ga0207662_10040063
609 Ga0207662_10070801
610 Ga0207657_10042882
611 Ga0207657_10286140
612 Ga0207657_10416837
613 Ga0207649_10040610
614 Ga0207649_10083181
615 Ga0207649_10122258
616 Ga0207649_10418817
617 Ga0207652_10138919
618 Ga0207652_10793454
619 Ga0207681_10224664
620 Ga0207681_10285037
621 Ga0207650_10158102
622 Ga0207659_10072054
623 Ga0207659_10431356
624 Ga0207659_10461828
625 Ga0207687_10230964
626 Ga0207687_10268911
627 Ga0207700_10055353
628 Ga0207700_10068386
629 Ga0207700_10157722
630 Ga0207664_10058853
631 Ga0207644_10056177
632 Ga0207644_10113813
633 Ga0207690_10016000
634 Ga0207690_10095310
635 Ga0207690_10643849
636 Ga0207706_10071921
637 Ga0207706_10090958
638 Ga0207706_10342588
639 Ga0207686_10017407
640 Ga0207686_10046270
641 Ga0207709_10044548
642 Ga0207670_10055539
643 Ga0207670_10705919
644 Ga0207669_10051309
645 Ga0207669_10104715
646 Ga0207704_10065105
647 Ga0207691_10006396
648 Ga0207691_10010627
649 Ga0207691_10042313
650 Ga0207691_10056941
651 Ga0207691_10601502
652 Ga0207711_10020480
653 Ga0207711_10056153
654 Ga0207689_10007122
655 Ga0207661_10018486
656 Ga0207661_10030645
657 Ga0207679_10014942
658 Ga0207679_10176189
659 Ga0207679_10299930
660 Ga0207679_10373149
661 Ga0207679_10768183
662 Ga0207667_10084808
663 Ga0207667_10129407
664 Ga0207667_10187722
665 Ga0207651_10031205
666 Ga0207651_10244464
667 Ga0207712_10350570
668 Ga0207668_10013720
669 Ga0207668_10481655
670 Ga0207658_10066707
671 Ga0207658_10104773
672 Ga0207703_10059813
673 Ga0207703_10266327
674 Ga0207703_10371258
675 Ga0207639_10763930
676 Ga0207708_10009414
677 Ga0207702_10334218
678 Ga0207702_10365635
679 Ga0207702_10498895
680 Ga0207641_10760303
681 Ga0207648_10045014
682 Ga0207676_10155845
683 Ga0207674_10002460
684 Ga0207674_10026779
685 Ga0207675_100013501
686 Ga0207683_10118551
687 Ga0207683_10394138
688 Ga0207683_10676045
689 Ga0207698_10009820
690 Ga0207698_10045354
691 Ga0207698_10217187
692 Ga0207698_10400756
693 Ga0207428_10032275
694 Ga0207428_10144187
695 Ga0268265_10884254
696 Ga0268264_10370170
697 Ga0268264_10485813
698 Ga0265338_10238917
699 Ga0265338_10264929
700 Ga0316576_10059243
701 Ga0316576_10118588
702 Ga0307405_10002955
703 Ga0307405_10177202
704 Ga0307413_10158620
705 Ga0307410_10008779
706 Ga0307407_10524309
707 Ga0307412_10033156
708 Ga0307409_100132706
709 Ga0307416_100071014
710 Ga0307416_100075054
711 Ga0307416_100324693
712 Ga0307414_10781155
713 Ga0307411_10032558
714 Ga0307411_10074093
715 Ga0307415_100048340
716 Ga0307415_100366633
717 Ga0316583_10033332
718 Ga0373934_0025047
719 Ga0373944_0061644
720 Ga0373949_0007751
721 Ga0373923_0028108
722 Ga0373941_0036898
723 Ga0373941_0170861
724 Ga0373953_0147126
725 Ga0373943_0002353
726 Ga0373955_0014845
727 Ga0373924_0002407
728 Ga0373931_0056439
729 Ga0373935_0005638
730 Ga0373935_0129127
731 Ga0373927_0128125
732 Ga0373927_0131048
733 Ga0373933_0007204
734 Ga0373933_0576405
735 Ga0373947_0004304
736 Ga0373947_0028311
737 Ga0373937_0006538
738 Ga0373937_0188090
739 Ga0373937_0711441
740 Ga0395905_0933736
741 Ga0395901_0591670
742 Ga0439444_0024286
743 Ga0439464_0009979
744 Ga0439460_0007193
745 Ga0439460_0025151
746 Ga0451577_0239768
747 Ga0466963_0007080
748 Ga0453684_0000010
749 Ga0451576_0304460
750 Ga0466967_0247099
751 Ga0495651_0210440
752 Ga0495664_0115937
753 Ga0495664_0187261
754 Ga0495620_0165894
755 Ga0495628_0434064
756 Ga0495587_0129427
757 Ga0495645_0422026
758 Ga0495657_0148881
759 Ga0495613_0210029
760 Ga0495600_0070039
761 Ga0495581_0110066
762 Ga0495674_0053850
763 Ga0495675_0026316
764 Ga0495684_0143712
765 Ga0495684_0290112
766 Ga0496100_0089400
767 Ga0496101_0680788
768 Ga0496102_0017513
769 Ga0496104_0587128
770 Ga0496106_0033571
771 Ga0496108_0096588
772 Ga0496109_0169147
773 Ga0496110_0018847
774 Ga0496110_0122969
775 Ga0496110_0742907
776 Ga0496111_0012464
777 Ga0496112_0026758
778 Ga0496112_0060127
779 Ga0496112_0275292
780 Ga0496113_0040693
781 Ga0496114_0425319
782 Ga0496115_0166890
783 Ga0501299_039999
784 Ga0501033_0143665
785 Ga0501038_0068199
786 Ga0501043_0199505
787 Ga0501035_0083461
788 Ga0501035_0385551
789 nmdc:mga0yw44_113694_c1
790 nmdc:mga09592_284810_c1
791 nmdc:mga08y16_342991_c1
792 nmdc:mga08y16_56010_c1
793 nmdc:mga0n895_160945_c1
794 nmdc:mga0n895_53881_c1
795 nmdc:mga0rr50_160612_c1
796 nmdc:mga08x19_198608_c1
797 nmdc:mga0a205_86576_c1
798 Ga0495595_0058774
799 Ga0495619_0075220
800 Ga0495619_0080085
801 Ga0500628_007318
802 Ga0500645_003287

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01168

Ala_racemase_N

Alanine racemase, N-terminal domain

9

231

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7uat-assembly1.cif.gz_A the crystal structure of the k36a mutant of e. coli yggs in complex with plp 0.9396 7 230
7uax-assembly1.cif.gz_A the crystal structure of the k36a/k38a double mutant of e. coli yggs in complex with plp 0.9396 7 229
7ubp-assembly1.cif.gz_A the crystal structure of the k36a/k137a double mutant of e. coli yggs in complex with plp 0.9395 7 230
1w8g-assembly1.cif.gz_A crystal structure of e. coli k-12 yggs 0.939 7 230
7ub8-assembly2.cif.gz_B the crystal structure of the k38a/k137a/k233a/k234a quadruple mutant of e. coli yggs in complex with plp 0.9379 7 229
ID Description Score Start End Superfamily
1w8gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.939 7 230 3.20.20.10
af_Q1ZXI6_1_255_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.928 3 233 3.20.20.10
1w8gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9269 7 230 3.20.20.10
af_Q9Z2Y8_11_258_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9265 7 233 3.20.20.10
5nm8B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9212 7 229 3.20.20.10
ID Description Score Start End GO Terms
AF-A0A7W1P783-F1-model_v4 Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) 0.9932 4 233 GO:0030170
AF-A0A7W1DSL4-F1-model_v4 YggS family pyridoxal phosphate-dependent enzyme 0.9918 20 223 GO:0030170
AF-A0A2E5H148-F1-model_v4 Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) 0.9916 7 232 GO:0030170
AF-A0A1F2SYJ0-F1-model_v4 YggS family pyridoxal phosphate enzyme 0.9883 7 230 GO:0030170
AF-A0A2V8C186-F1-model_v4 YggS family pyridoxal phosphate-dependent enzyme 0.9849 1 214 GO:0030170

Map