F434758

General Info

Members Datasets Scaffolds Average Seq Length
401 201 401 260

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100180060|Ga0070671_1001800602
Length 260
Sequence MKVTLITGASSGIGEAFARKLAASEHDLVLIARSEKKLHELCDELMLKHKIFAHYVPIDLLEDGAIDRIVDETRKHNFEVDWLINNAGVGSMGDFAELDPEAEENIVKLNVLLLVSLTHEFLVGMRKRHSGTIINVSSAAGFQPIPYMATYAATKAFVTSFSEAIAEENKGHGIRVMALCPGPTETNFFTAAKIAEPFGLKGLQTADQVVSAALKGLRKGKSTVISGWANYAGAVLGKALPTSVTSRVIGSTLRDRIQEK

Samples

Sample ID Description Type Environment
1 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
153 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
154 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
155 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
158 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
159 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
160 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
176 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
177 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
178 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
179 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
180 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
181 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
182 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
183 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
184 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
185 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
186 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
187 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
188 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
189 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
190 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
191 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
198 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 2.49
Rhizosphere 96.76
Stem 0
Stem Tuber 0
Unclassified 0.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24034J26672_10000001 3300002239 Bacteria 1118280
2 rootL2_10261148 3300003322 Bacteria 1292
3 Ga0065704_10093763 3300005289 Unclassified 2579
4 Ga0065715_10092827 3300005293 Bacteria 4903
5 Ga0065715_10184736 3300005293 Bacteria 1453
6 Ga0065707_10004402 3300005295 Unclassified 4801
7 Ga0065707_10006887 3300005295 Unclassified 3208
8 Ga0065707_10022163 3300005295 Unclassified 1401
9 Ga0065707_10091392 3300005295 Bacteria 3955
10 Ga0070676_10271341 3300005328 Bacteria 1139
11 Ga0070690_100048194 3300005330 Unclassified 2712
12 Ga0070690_100267766 3300005330 Bacteria 1214
13 Ga0070670_100003356 3300005331 Bacteria 13262
14 Ga0070670_100230855 3300005331 Bacteria 1610
15 Ga0070670_100318388 3300005331 Unclassified 1362
16 Ga0070677_10003590 3300005333 Bacteria 5006
17 Ga0068869_100004484 3300005334 Bacteria 8682
18 Ga0068869_100007260 3300005334 Bacteria 7062
19 Ga0068869_100542377 3300005334 Bacteria 976
20 Ga0070680_100032758 3300005336 Bacteria 4184
21 Ga0068868_100501696 3300005338 Unclassified 1063
22 Ga0070689_100023120 3300005340 Bacteria 4650
23 Ga0070689_100050322 3300005340 Unclassified 3219
24 Ga0070661_100078133 3300005344 Bacteria 2441
25 Ga0070661_100354932 3300005344 Bacteria 1151
26 Ga0070668_100331634 3300005347 Bacteria 1283
27 Ga0070669_100006170 3300005353 Bacteria 8653
28 Ga0070675_100018113 3300005354 Bacteria 5606
29 Ga0070675_100163523 3300005354 Bacteria 1916
30 Ga0070675_100198414 3300005354 Bacteria 1741
31 Ga0070671_100048090 3300005355 Unclassified 3546
32 Ga0070671_100180060 3300005355 Bacteria 1789
33 Ga0070674_100063941 3300005356 Unclassified 2577
34 Ga0070674_100368278 3300005356 Unclassified 1165
35 Ga0070673_100056542 3300005364 Bacteria 3096
36 Ga0070673_100070572 3300005364 Bacteria 2804
37 Ga0070673_100110368 3300005364 Bacteria 2280
38 Ga0070673_100190794 3300005364 Unclassified 1760
39 Ga0070673_100340909 3300005364 Bacteria 1328
40 Ga0070673_100415834 3300005364 Bacteria 1205
41 Ga0070688_100223477 3300005365 Unclassified 1328
42 Ga0070659_100006617 3300005366 Bacteria 8374
43 Ga0070667_100023762 3300005367 Bacteria 5088
44 Ga0070667_100318057 3300005367 Bacteria 1404
45 Ga0070703_10000014 3300005406 Bacteria 89131
46 Ga0070701_10357175 3300005438 Bacteria 914
47 Ga0070705_100179995 3300005440 Unclassified 1431
48 Ga0070700_100038593 3300005441 Bacteria 2912
49 Ga0070694_100050550 3300005444 Bacteria 2803
50 Ga0070694_100072759 3300005444 Bacteria 2372
51 Ga0070694_100214809 3300005444 Bacteria 1440
52 Ga0070694_100343922 3300005444 Bacteria 1154
53 Ga0070694_100357641 3300005444 Bacteria 1133
54 Ga0070708_100001605 3300005445 Bacteria 17332
55 Ga0070708_100295336 3300005445 Bacteria 1526
56 Ga0070663_100096302 3300005455 Bacteria 2201
57 Ga0070678_100033849 3300005456 Bacteria 3552
58 Ga0070678_100489653 3300005456 Unclassified 1083
59 Ga0070681_10004724 3300005458 Bacteria 13043
60 Ga0068867_100237549 3300005459 Bacteria 1476
61 Ga0070706_100004535 3300005467 Bacteria 13364
62 Ga0070706_100013663 3300005467 Bacteria 7506
63 Ga0070706_100016810 3300005467 Bacteria 6759
64 Ga0070706_100312441 3300005467 Bacteria 1466
65 Ga0070707_100000252 3300005468 Bacteria 53706
66 Ga0070707_100026668 3300005468 Bacteria 5488
67 Ga0070707_100026801 3300005468 Bacteria 5475
68 Ga0070707_100254498 3300005468 Unclassified 1709
69 Ga0070707_100368177 3300005468 Bacteria 1396
70 Ga0070698_100002160 3300005471 Bacteria 21832
71 Ga0070698_100003710 3300005471 Bacteria 16767
72 Ga0070698_100016899 3300005471 Bacteria 7695
73 Ga0070698_100148702 3300005471 Unclassified 2291
74 Ga0070698_100727099 3300005471 Unclassified 935
75 Ga0070699_100000218 3300005518 Bacteria 57007
76 Ga0070699_100068935 3300005518 Bacteria 3073
77 Ga0070699_100143907 3300005518 Bacteria 2106
78 Ga0070679_100006660 3300005530 Bacteria 10772
79 Ga0070697_100000042 3300005536 Bacteria 94533
80 Ga0070697_100004471 3300005536 Bacteria 10755
81 Ga0070697_100032401 3300005536 Bacteria 4206
82 Ga0070697_100077009 3300005536 Bacteria 2743
83 Ga0070697_100109745 3300005536 Bacteria 2298
84 Ga0070697_100220904 3300005536 Unclassified 1615
85 Ga0070697_100592828 3300005536 Unclassified 974
86 Ga0068853_100029791 3300005539 Bacteria 4604
87 Ga0068853_100035505 3300005539 Bacteria 4235
88 Ga0070672_100061126 3300005543 Unclassified 2969
89 Ga0070672_100289393 3300005543 Unclassified 1387
90 Ga0070686_100014753 3300005544 Bacteria 4509
91 Ga0070686_100017182 3300005544 Bacteria 4223
92 Ga0070695_100039350 3300005545 Bacteria 2988
93 Ga0070695_100188512 3300005545 Bacteria 1466
94 Ga0070696_100031349 3300005546 Bacteria 3642
95 Ga0070696_100057042 3300005546 Bacteria 2725
96 Ga0070696_100187355 3300005546 Unclassified 1538
97 Ga0070696_100318318 3300005546 Bacteria 1196
98 Ga0070704_100008325 3300005549 Bacteria 6212
99 Ga0070704_100013107 3300005549 Bacteria 5135
100 Ga0070704_100081796 3300005549 Bacteria 2380
101 Ga0070704_100127804 3300005549 Bacteria 1964
102 Ga0070704_100268007 3300005549 Bacteria 1410
103 Ga0070704_100520486 3300005549 Bacteria 1035
104 Ga0070704_100521799 3300005549 Bacteria 1034
105 Ga0070664_100072277 3300005564 Bacteria 2958
106 Ga0070664_100135315 3300005564 Bacteria 2167
107 Ga0070664_100367246 3300005564 Bacteria 1311
108 Ga0068857_100007950 3300005577 Bacteria 9154
109 Ga0068854_100081290 3300005578 Unclassified 2393
110 Ga0068854_100119707 3300005578 Bacteria 1997
111 Ga0068856_100007562 3300005614 Bacteria 10600
112 Ga0068859_100008116 3300005617 Bacteria 10648
113 Ga0068859_100026173 3300005617 Bacteria 5851
114 Ga0068859_100212787 3300005617 Bacteria 2020
115 Ga0068859_100360002 3300005617 Unclassified 1550
116 Ga0068864_100049874 3300005618 Bacteria 3602
117 Ga0068864_100080075 3300005618 Bacteria 2861
118 Ga0068864_100349034 3300005618 Bacteria 1395
119 Ga0068864_100564037 3300005618 Bacteria 1102
120 Ga0068866_10085365 3300005718 Unclassified 1706
121 Ga0068861_100060256 3300005719 Unclassified 2908
122 Ga0068861_100078136 3300005719 Unclassified 2584
123 Ga0068861_100241661 3300005719 Bacteria 1536
124 Ga0068870_10039020 3300005840 Unclassified 2455
125 Ga0068870_10059568 3300005840 Bacteria 2047
126 Ga0068863_100125763 3300005841 Bacteria 2446
127 Ga0068858_100000005 3300005842 Bacteria 305830
128 Ga0068858_100047252 3300005842 Unclassified 3990
129 Ga0068858_100061408 3300005842 Unclassified 3474
130 Ga0068858_100063668 3300005842 Bacteria 3412
131 Ga0068858_100121835 3300005842 Bacteria 2439
132 Ga0068860_100113199 3300005843 Bacteria 2594
133 Ga0068860_100191002 3300005843 Bacteria 1982
134 Ga0068862_100129202 3300005844 Bacteria 2233
135 Ga0081539_10020194 3300005985 Bacteria 4518
136 Ga0070715_10000006 3300006163 Bacteria 216296
137 Ga0070716_100000001 3300006173 Bacteria 400668
138 Ga0070716_100337720 3300006173 Unclassified 1062
139 Ga0075428_100270579 3300006844 Bacteria 1828
140 Ga0075430_100130649 3300006846 Bacteria 2093
141 Ga0075433_10176143 3300006852 Bacteria 1903
142 Ga0075434_100024194 3300006871 Bacteria 5935
143 Ga0075434_100311785 3300006871 Bacteria 1594
144 Ga0075429_100008287 3300006880 Bacteria 9033
145 Ga0075429_100012065 3300006880 Bacteria 7489
146 Ga0068865_100087982 3300006881 Bacteria 2246
147 Ga0068865_100308488 3300006881 Bacteria 1269
148 Ga0075436_100000007 3300006914 Bacteria 288785
149 Ga0097620_100008116 3300006931 Bacteria 10648
150 Ga0097620_100026173 3300006931 Bacteria 5851
151 Ga0097620_100069577 3300006931 Bacteria 3555
152 Ga0097620_100119697 3300006931 Bacteria 2700
153 Ga0097620_100212793 3300006931 Bacteria 2020
154 Ga0097620_100359999 3300006931 Unclassified 1550
155 Ga0075435_100000578 3300007076 Bacteria 22437
156 Ga0099794_10005956 3300007265 Bacteria 4919
157 Ga0105245_10218093 3300009098 Bacteria 1839
158 Ga0105247_10000002 3300009101 Bacteria 724587
159 Ga0105247_10030949 3300009101 Unclassified 3246
160 Ga0105247_10066627 3300009101 Bacteria 2243
161 Ga0114129_10010759 3300009147 Bacteria 13040
162 Ga0114129_10087051 3300009147 Bacteria 4333
163 Ga0114129_10127723 3300009147 Bacteria 3494
164 Ga0114129_10167414 3300009147 Unclassified 2998
165 Ga0105243_10000037 3300009148 Bacteria 175237
166 Ga0105243_10000558 3300009148 Bacteria 37622
167 Ga0105243_10041081 3300009148 Bacteria 3616
168 Ga0105243_10080884 3300009148 Bacteria 2651
169 Ga0105243_10743024 3300009148 Unclassified 961
170 Ga0105241_10591119 3300009174 Unclassified 1002
171 Ga0105242_10000039 3300009176 Bacteria 88325
172 Ga0105242_10006195 3300009176 Bacteria 9216
173 Ga0105248_10010007 3300009177 Bacteria 10438
174 Ga0105248_10394824 3300009177 Bacteria 1557
175 Ga0105249_10075094 3300009553 Bacteria 3130
176 Ga0105249_10102500 3300009553 Bacteria 2694
177 Ga0105249_10131466 3300009553 Bacteria 2390
178 Ga0105249_10226592 3300009553 Bacteria 1842
179 Ga0105239_10204976 3300010375 Unclassified 2210
180 Ga0105246_10046625 3300011119 Unclassified 2957
181 Ga0157373_10073769 3300013100 Unclassified 2408
182 Ga0157378_10000077 3300013297 Bacteria 89664
183 Ga0157378_10008319 3300013297 Bacteria 9041
184 Ga0157378_10027485 3300013297 Bacteria 5020
185 Ga0157378_10139652 3300013297 Bacteria 2249
186 Ga0157378_10148759 3300013297 Unclassified 2181
187 Ga0157378_10287385 3300013297 Bacteria 1587
188 Ga0157378_10415777 3300013297 Bacteria 1328
189 Ga0157378_10825728 3300013297 Unclassified 954
190 Ga0163162_10001938 3300013306 Bacteria 19437
191 Ga0163162_10120212 3300013306 Bacteria 2730
192 Ga0163162_11053812 3300013306 Bacteria 920
193 Ga0157372_10062082 3300013307 Unclassified 4185
194 Ga0157372_10732905 3300013307 Bacteria 1149
195 Ga0157375_10002146 3300013308 Bacteria 17041
196 Ga0157375_10010184 3300013308 Bacteria 8276
197 Ga0157375_10102067 3300013308 Bacteria 2953
198 Ga0157375_10132092 3300013308 Bacteria 2617
199 Ga0163163_10018248 3300014325 Bacteria 6563
200 Ga0163163_10026391 3300014325 Bacteria 5552
201 Ga0163163_10177374 3300014325 Bacteria 2178
202 Ga0163163_10316801 3300014325 Bacteria 1613
203 Ga0157380_10024418 3300014326 Unclassified 4576
204 Ga0157380_10027170 3300014326 Bacteria 4351
205 Ga0157377_10060967 3300014745 Bacteria 2154
206 Ga0157379_10159442 3300014968 Bacteria 2036
207 Ga0163161_10034856 3300017792 Bacteria 3600
208 Ga0163161_10040616 3300017792 Bacteria 3342
209 Ga0163161_10431540 3300017792 Bacteria 1062
210 Ga0207672_1000003 3300025223 Bacteria 30087
211 Ga0207653_10000307 3300025885 Bacteria 27669
212 Ga0207682_10033604 3300025893 Bacteria 2066
213 Ga0207642_10008717 3300025899 Bacteria 3496
214 Ga0207710_10000002 3300025900 Bacteria 1251998
215 Ga0207710_10052936 3300025900 Unclassified 1826
216 Ga0207685_10000010 3300025905 Bacteria 216792
217 Ga0207645_10253082 3300025907 Bacteria 1166
218 Ga0207643_10052625 3300025908 Unclassified 2313
219 Ga0207643_10097151 3300025908 Bacteria 1723
220 Ga0207684_10014067 3300025910 Bacteria 6909
221 Ga0207684_10017469 3300025910 Bacteria 6154
222 Ga0207684_10026642 3300025910 Bacteria 4928
223 Ga0207684_10206167 3300025910 Unclassified 1696
224 Ga0207707_10203298 3300025912 Bacteria 1727
225 Ga0207707_10304578 3300025912 Bacteria 1377
226 Ga0207671_10044320 3300025914 Bacteria 3290
227 Ga0207662_10161242 3300025918 Bacteria 1433
228 Ga0207649_10194153 3300025920 Bacteria 1430
229 Ga0207652_10065814 3300025921 Bacteria 3139
230 Ga0207646_10000399 3300025922 Bacteria 58192
231 Ga0207646_10011902 3300025922 Bacteria 8392
232 Ga0207646_10088337 3300025922 Bacteria 2773
233 Ga0207646_10137402 3300025922 Bacteria 2201
234 Ga0207681_10014619 3300025923 Bacteria 4884
235 Ga0207650_10011807 3300025925 Bacteria 6023
236 Ga0207650_10145956 3300025925 Bacteria 1863
237 Ga0207650_10226224 3300025925 Bacteria 1507
238 Ga0207659_10230784 3300025926 Bacteria 1493
239 Ga0207644_10004637 3300025931 Bacteria 8934
240 Ga0207644_10022679 3300025931 Bacteria 4291
241 Ga0207644_10048074 3300025931 Bacteria 3048
242 Ga0207644_10266832 3300025931 Unclassified 1370
243 Ga0207644_10287890 3300025931 Bacteria 1320
244 Ga0207686_10000003 3300025934 Bacteria 376934
245 Ga0207686_10003637 3300025934 Bacteria 8261
246 Ga0207686_10078125 3300025934 Bacteria 2151
247 Ga0207686_10263600 3300025934 Unclassified 1264
248 Ga0207709_10000017 3300025935 Bacteria 470753
249 Ga0207709_10000325 3300025935 Bacteria 51529
250 Ga0207709_10387038 3300025935 Bacteria 1066
251 Ga0207670_10171061 3300025936 Bacteria 1629
252 Ga0207669_10052058 3300025937 Unclassified 2457
253 Ga0207704_10298049 3300025938 Bacteria 1234
254 Ga0207665_10000016 3300025939 Bacteria 132853
255 Ga0207665_10254070 3300025939 Bacteria 1300
256 Ga0207691_10024852 3300025940 Bacteria 5631
257 Ga0207691_10046001 3300025940 Bacteria 4012
258 Ga0207691_10162205 3300025940 Unclassified 1960
259 Ga0207711_10081501 3300025941 Bacteria 2828
260 Ga0207711_10172843 3300025941 Bacteria 1961
261 Ga0207711_10179354 3300025941 Unclassified 1925
262 Ga0207711_10276380 3300025941 Bacteria 1546
263 Ga0207689_10004093 3300025942 Bacteria 13262
264 Ga0207689_10011709 3300025942 Bacteria 7516
265 Ga0207689_10092523 3300025942 Bacteria 2484
266 Ga0207689_10099832 3300025942 Unclassified 2385
267 Ga0207689_10302024 3300025942 Bacteria 1327
268 Ga0207679_10109768 3300025945 Bacteria 2175
269 Ga0207679_10167259 3300025945 Unclassified 1807
270 Ga0207651_10052872 3300025960 Bacteria 2772
271 Ga0207651_10670869 3300025960 Bacteria 911
272 Ga0207712_10026731 3300025961 Unclassified 3848
273 Ga0207712_10068859 3300025961 Bacteria 2538
274 Ga0207668_10133030 3300025972 Bacteria 1902
275 Ga0207640_10092405 3300025981 Unclassified 2099
276 Ga0207703_10059166 3300026035 Bacteria 3130
277 Ga0207703_10110559 3300026035 Unclassified 2344
278 Ga0207703_10496510 3300026035 Bacteria 1145
279 Ga0207639_10084898 3300026041 Bacteria 2516
280 Ga0207639_10292202 3300026041 Bacteria 1437
281 Ga0207678_10011896 3300026067 Bacteria 7641
282 Ga0207708_10039181 3300026075 Bacteria 3610
283 Ga0207708_10255697 3300026075 Bacteria 1413
284 Ga0207702_10007258 3300026078 Bacteria 9478
285 Ga0207641_10019331 3300026088 Bacteria 5590
286 Ga0207641_10041766 3300026088 Bacteria 3845
287 Ga0207641_10150722 3300026088 Unclassified 2106
288 Ga0207641_10196562 3300026088 Bacteria 1857
289 Ga0207648_10200398 3300026089 Bacteria 1770
290 Ga0207648_10200691 3300026089 Bacteria 1769
291 Ga0207676_10038833 3300026095 Bacteria 3637
292 Ga0207676_10043381 3300026095 Bacteria 3462
293 Ga0207676_10099224 3300026095 Bacteria 2410
294 Ga0207676_10321686 3300026095 Bacteria 1420
295 Ga0207675_100002593 3300026118 Bacteria 17895
296 Ga0207675_100018145 3300026118 Bacteria 6560
297 Ga0207675_100026932 3300026118 Bacteria 5352
298 Ga0207683_10194871 3300026121 Bacteria 1840
299 Ga0209588_1003965 3300027671 Bacteria 4141
300 Ga0268265_10043949 3300028380 Unclassified 3324
301 Ga0268264_10025325 3300028381 Bacteria 4847
302 Ga0268264_10148243 3300028381 Bacteria 2100
303 Ga0307408_100140041 3300031548 Unclassified 1898
304 Ga0307408_100153576 3300031548 Bacteria 1820
305 Ga0307405_10147475 3300031731 Bacteria 1650
306 Ga0307405_10254442 3300031731 Bacteria 1308
307 Ga0307413_10000302 3300031824 Bacteria 15226
308 Ga0307413_10008243 3300031824 Bacteria 4905
309 Ga0307413_10101164 3300031824 Bacteria 1905
310 Ga0307413_10281927 3300031824 Bacteria 1250
311 Ga0307410_10001237 3300031852 Bacteria 11351
312 Ga0307410_10021348 3300031852 Unclassified 3981
313 Ga0307406_10084189 3300031901 Bacteria 2123
314 Ga0307406_10142866 3300031901 Unclassified 1697
315 Ga0307406_10377363 3300031901 Bacteria 1117
316 Ga0307407_10000900 3300031903 Bacteria 10032
317 Ga0307407_10033607 3300031903 Unclassified 2800
318 Ga0307407_10383549 3300031903 Bacteria 1004
319 Ga0307412_10019869 3300031911 Unclassified 4078
320 Ga0307409_100031610 3300031995 Unclassified 3824
321 Ga0307409_100052026 3300031995 Bacteria 3138
322 Ga0307409_100107406 3300031995 Unclassified 2332
323 Ga0307409_100152653 3300031995 Bacteria 2008
324 Ga0307409_100465359 3300031995 Bacteria 1223
325 Ga0307416_100049823 3300032002 Unclassified 3333
326 Ga0307416_100064892 3300032002 Unclassified 2998
327 Ga0307414_10024891 3300032004 Bacteria 3824
328 Ga0307414_10050354 3300032004 Bacteria 2885
329 Ga0307411_10007947 3300032005 Bacteria 5454
330 Ga0307411_10163348 3300032005 Bacteria 1671
331 Ga0307411_10328412 3300032005 Bacteria 1238
332 Ga0307415_100006161 3300032126 Bacteria 6438
333 Ga0307415_100035195 3300032126 Unclassified 3269
334 Ga0307415_100060439 3300032126 Unclassified 2619
335 Ga0307415_100119485 3300032126 Bacteria 1973
336 Ga0307415_100157784 3300032126 Bacteria 1754
337 Ga0395900_0786372 3300037418 Bacteria 880
338 Ga0436365_0381643 3300039437 Bacteria 2037
339 Ga0439462_0008306 3300042015 Bacteria 2614
340 Ga0439446_0016042 3300042156 Bacteria 2084
341 Ga0439434_0026847 3300042435 Bacteria 1739
342 Ga0453683_0060694 3300044673 Bacteria 2364
343 Ga0453683_0303553 3300044673 Unclassified 1021
344 Ga0451576_0633006 3300045051 Unclassified 1124
345 Ga0495610_0090680 3300046512 Unclassified 1386
346 Ga0495632_0012582 3300046519 Bacteria 4873
347 Ga0495598_0017554 3300046537 Bacteria 1847
348 Ga0495656_0105664 3300046615 Bacteria 1309
349 Ga0495668_0001177 3300046616 Bacteria 26638
350 Ga0495613_0336710 3300046689 Bacteria 1039
351 Ga0495680_0357919 3300047322 Bacteria 1015
352 Ga0495684_0071558 3300047471 Bacteria 2635
353 Ga0495615_0039826 3300048090 Bacteria 1167
354 Ga0496100_0175415 3300048903 Bacteria 1547
355 Ga0496103_0052123 3300048906 Bacteria 2534
356 Ga0496104_0017496 3300048907 Bacteria 6529
357 Ga0496105_0186309 3300048908 Bacteria 1698
358 Ga0496107_0283167 3300048910 Unclassified 1234
359 Ga0496109_0094131 3300048912 Bacteria 2773
360 Ga0496109_0236756 3300048912 Bacteria 1718
361 Ga0496111_0180173 3300048914 Bacteria 1571
362 Ga0496113_0050409 3300048916 Bacteria 3104
363 Ga0496114_0134386 3300048917 Bacteria 2138
364 Ga0501297_002375 3300049520 Bacteria 1817
365 Ga0501298_000179 3300049521 Bacteria 7895
366 Ga0501301_004421 3300049524 Bacteria 998
367 Ga0501072_0009726 3300049588 Bacteria 7313
368 Ga0501198_002051 3300049649 Bacteria 2683
369 Ga0501202_003659 3300049652 Bacteria 2648
370 Ga0501209_055681 3300049656 Bacteria 1091
371 Ga0501217_030072 3300049661 Bacteria 1331
372 Ga0501223_011433 3300049663 Bacteria 1782
373 Ga0501223_013894 3300049663 Bacteria 1600
374 Ga0501233_011367 3300049668 Bacteria 1769
375 Ga0501235_002056 3300049669 Bacteria 4321
376 Ga0501248_009945 3300049678 Bacteria 837
377 Ga0501221_015527 3300049704 Bacteria 1430
378 Ga0501225_0027266 3300049705 Bacteria 1571
379 Ga0501270_004239 3300049767 Bacteria 1599
380 Ga0501271_001968 3300049768 Bacteria 1799
381 Ga0501276_004777 3300049773 Bacteria 1026
382 nmdc:mga05p37_108575_c1 3300050507 Bacteria 3413
383 nmdc:mga05p37_27340_c1 3300050507 Bacteria 4958
384 nmdc:mga05p37_49608_c1 3300050507 Bacteria 5163
385 nmdc:mga05p37_730077_c1 3300050507 Bacteria 1095
386 nmdc:mga05p37_87893_c1 3300050507 Bacteria 3831
387 nmdc:mga09592_81174_c1 3300050508 Bacteria 2763
388 nmdc:mga06r32_83030_c1 3300050510 Bacteria 3122
389 nmdc:mga08y16_28299_c1 3300050511 Bacteria 5908
390 nmdc:mga08y16_96170_c1 3300050511 Unclassified 3084
391 nmdc:mga0n895_145241_c1 3300050512 Bacteria 2401
392 nmdc:mga0n895_79822_c1 3300050512 Bacteria 3259
393 nmdc:mga0rr50_220354_c1 3300050513 Unclassified 1566
394 nmdc:mga0rr50_437_c1 3300050513 Bacteria 22424
395 nmdc:mga08x19_70_c1 3300050514 Bacteria 98848
396 nmdc:mga0a205_133800_c1 3300050515 Bacteria 2380
397 nmdc:mga0a205_176022_c1 3300050515 Unclassified 2035
398 nmdc:mga0a205_18527_c1 3300050515 Bacteria 6547
399 nmdc:mga0a205_23267_c1 3300050515 Bacteria 5875
400 Ga0500616_0002361 3300053153 Bacteria 15868
401 Ga0501082_0070767 3300060353 Bacteria 3004

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006173 Ga0070716_100337720 Ga0070716_1003377202 244
2 3300005331 Ga0070670_100003356 Ga0070670_1000033562 256
3 3300005340 Ga0070689_100050322 Ga0070689_1000503222 256
4 3300005353 Ga0070669_100006170 Ga0070669_1000061704 256
5 3300005364 Ga0070673_100340909 Ga0070673_1003409092 256
6 3300005536 Ga0070697_100077009 Ga0070697_1000770092 256
7 3300005536 Ga0070697_100220904 Ga0070697_1002209042 256
8 3300005539 Ga0068853_100029791 Ga0068853_1000297915 256
9 3300005564 Ga0070664_100367246 Ga0070664_1003672462 256
10 3300005614 Ga0068856_100007562 Ga0068856_1000075628 256
11 3300005618 Ga0068864_100049874 Ga0068864_1000498741 256
12 3300005618 Ga0068864_100564037 Ga0068864_1005640372 256
13 3300005985 Ga0081539_10020194 Ga0081539_100201945 256
14 3300006871 Ga0075434_100024194 Ga0075434_1000241947 256
15 3300009147 Ga0114129_10010759 Ga0114129_1001075910 256
16 3300009174 Ga0105241_10591119 Ga0105241_105911191 256
17 3300009553 Ga0105249_10226592 Ga0105249_102265922 256
18 3300013297 Ga0157378_10825728 Ga0157378_108257281 256
19 3300013307 Ga0157372_10062082 Ga0157372_100620822 256
20 3300014325 Ga0163163_10177374 Ga0163163_101773742 256
21 3300025914 Ga0207671_10044320 Ga0207671_100443202 256
22 3300025923 Ga0207681_10014619 Ga0207681_100146192 256
23 3300025925 Ga0207650_10011807 Ga0207650_100118077 256
24 3300025931 Ga0207644_10022679 Ga0207644_100226795 256
25 3300025961 Ga0207712_10068859 Ga0207712_100688593 256
26 3300026041 Ga0207639_10292202 Ga0207639_102922021 256
27 3300026078 Ga0207702_10007258 Ga0207702_100072585 256
28 3300026089 Ga0207648_10200398 Ga0207648_102003982 256
29 3300026095 Ga0207676_10038833 Ga0207676_100388333 256
30 3300031731 Ga0307405_10254442 Ga0307405_102544422 256
31 3300031824 Ga0307413_10101164 Ga0307413_101011642 256
32 3300031995 Ga0307409_100152653 Ga0307409_1001526532 256
33 3300032004 Ga0307414_10050354 Ga0307414_100503543 256
34 3300032005 Ga0307411_10328412 Ga0307411_103284122 256
35 3300032126 Ga0307415_100157784 Ga0307415_1001577842 256
36 3300037418 Ga0395900_0786372 Ga0395900_0786372_56_829 256
37 3300048906 Ga0496103_0052123 Ga0496103_0052123_1159_1932 256
38 3300048907 Ga0496104_0017496 Ga0496104_0017496_665_1438 256
39 3300048910 Ga0496107_0283167 Ga0496107_0283167_19_792 256
40 3300048912 Ga0496109_0236756 Ga0496109_0236756_563_1336 256
41 3300048916 Ga0496113_0050409 Ga0496113_0050409_654_1427 256
42 3300049656 Ga0501209_055681 Ga0501209_055681_176_949 256
43 3300049663 Ga0501223_013894 Ga0501223_013894_58_831 256
44 3300049704 Ga0501221_015527 Ga0501221_015527_63_836 256
45 3300050507 nmdc:mga05p37_108575_c1 nmdc:mga05p37_108575_c1_172_945 256
46 3300050512 nmdc:mga0n895_79822_c1 nmdc:mga0n895_79822_c1_1930_2703 256
47 3300050515 nmdc:mga0a205_133800_c1 nmdc:mga0a205_133800_c1_26_799 256
48 3300050515 nmdc:mga0a205_18527_c1 nmdc:mga0a205_18527_c1_3481_4254 256
49 3300060353 Ga0501082_0070767 Ga0501082_0070767_2144_2917 256
50 3300005336 Ga0070680_100032758 Ga0070680_1000327584 257
51 3300005344 Ga0070661_100078133 Ga0070661_1000781331 257
52 3300005364 Ga0070673_100110368 Ga0070673_1001103682 257
53 3300005366 Ga0070659_100006617 Ga0070659_1000066179 257
54 3300005445 Ga0070708_100001605 Ga0070708_1000016053 257
55 3300005455 Ga0070663_100096302 Ga0070663_1000963022 257
56 3300005458 Ga0070681_10004724 Ga0070681_100047245 257
57 3300005467 Ga0070706_100013663 Ga0070706_1000136633 257
58 3300005467 Ga0070706_100312441 Ga0070706_1003124411 257
59 3300005468 Ga0070707_100026668 Ga0070707_1000266684 257
60 3300005471 Ga0070698_100002160 Ga0070698_1000021609 257
61 3300005518 Ga0070699_100000218 Ga0070699_10000021839 257
62 3300005530 Ga0070679_100006660 Ga0070679_1000066603 257
63 3300005536 Ga0070697_100000042 Ga0070697_1000000428 257
64 3300005536 Ga0070697_100004471 Ga0070697_1000044716 257
65 3300005536 Ga0070697_100592828 Ga0070697_1005928282 257
66 3300005539 Ga0068853_100035505 Ga0068853_1000355053 257
67 3300005543 Ga0070672_100289393 Ga0070672_1002893932 257
68 3300005546 Ga0070696_100057042 Ga0070696_1000570422 257
69 3300005546 Ga0070696_100318318 Ga0070696_1003183181 257
70 3300005549 Ga0070704_100521799 Ga0070704_1005217991 257
71 3300005577 Ga0068857_100007950 Ga0068857_1000079507 257
72 3300005578 Ga0068854_100081290 Ga0068854_1000812902 257
73 3300005617 Ga0068859_100026173 Ga0068859_1000261732 257
74 3300005719 Ga0068861_100078136 Ga0068861_1000781362 257
75 3300005840 Ga0068870_10039020 Ga0068870_100390202 257
76 3300005843 Ga0068860_100191002 Ga0068860_1001910022 257
77 3300006844 Ga0075428_100270579 Ga0075428_1002705792 257
78 3300006846 Ga0075430_100130649 Ga0075430_1001306492 257
79 3300006852 Ga0075433_10176143 Ga0075433_101761432 257
80 3300006871 Ga0075434_100311785 Ga0075434_1003117852 257
81 3300006880 Ga0075429_100008287 Ga0075429_1000082874 257
82 3300006931 Ga0097620_100026173 Ga0097620_1000261732 257
83 3300006931 Ga0097620_100119697 Ga0097620_1001196972 257
84 3300009147 Ga0114129_10087051 Ga0114129_100870513 257
85 3300009147 Ga0114129_10127723 Ga0114129_101277232 257
86 3300009147 Ga0114129_10167414 Ga0114129_101674142 257
87 3300009177 Ga0105248_10010007 Ga0105248_100100074 257
88 3300013297 Ga0157378_10008319 Ga0157378_100083196 257
89 3300013306 Ga0163162_10001938 Ga0163162_1000193811 257
90 3300013308 Ga0157375_10102067 Ga0157375_101020671 257
91 3300014325 Ga0163163_10018248 Ga0163163_100182483 257
92 3300014325 Ga0163163_10316801 Ga0163163_103168012 257
93 3300014326 Ga0157380_10027170 Ga0157380_100271703 257
94 3300014968 Ga0157379_10159442 Ga0157379_101594422 257
95 3300025908 Ga0207643_10052625 Ga0207643_100526252 257
96 3300025910 Ga0207684_10026642 Ga0207684_100266422 257
97 3300025912 Ga0207707_10304578 Ga0207707_103045781 257
98 3300025921 Ga0207652_10065814 Ga0207652_100658143 257
99 3300025922 Ga0207646_10088337 Ga0207646_100883372 257
100 3300025940 Ga0207691_10162205 Ga0207691_101622052 257
101 3300025942 Ga0207689_10092523 Ga0207689_100925232 257
102 3300025942 Ga0207689_10099832 Ga0207689_100998322 257
103 3300025981 Ga0207640_10092405 Ga0207640_100924052 257
104 3300026041 Ga0207639_10084898 Ga0207639_100848983 257
105 3300026118 Ga0207675_100018145 Ga0207675_1000181456 257
106 3300028381 Ga0268264_10148243 Ga0268264_101482432 257
107 3300031901 Ga0307406_10377363 Ga0307406_103773632 257
108 3300046512 Ga0495610_0090680 Ga0495610_0090680_22_798 257
109 3300048914 Ga0496111_0180173 Ga0496111_0180173_45_821 257
110 3300050507 nmdc:mga05p37_730077_c1 nmdc:mga05p37_730077_c1_283_1059 257
111 3300050507 nmdc:mga05p37_87893_c1 nmdc:mga05p37_87893_c1_2303_3079 257
112 3300050508 nmdc:mga09592_81174_c1 nmdc:mga09592_81174_c1_403_1179 257
113 3300050510 nmdc:mga06r32_83030_c1 nmdc:mga06r32_83030_c1_1716_2492 257
114 3300050512 nmdc:mga0n895_145241_c1 nmdc:mga0n895_145241_c1_198_974 257
115 3300050515 nmdc:mga0a205_23267_c1 nmdc:mga0a205_23267_c1_5078_5854 257
116 3300005295 Ga0065707_10022163 Ga0065707_100221632 258
117 3300005330 Ga0070690_100267766 Ga0070690_1002677662 258
118 3300005354 Ga0070675_100163523 Ga0070675_1001635232 258
119 3300005355 Ga0070671_100180060 Ga0070671_1001800602 258
120 3300005364 Ga0070673_100415834 Ga0070673_1004158342 258
121 3300005406 Ga0070703_10000014 Ga0070703_1000001465 258
122 3300005440 Ga0070705_100179995 Ga0070705_1001799952 258
123 3300005444 Ga0070694_100050550 Ga0070694_1000505502 258
124 3300005444 Ga0070694_100343922 Ga0070694_1003439221 258
125 3300005467 Ga0070706_100016810 Ga0070706_1000168103 258
126 3300005468 Ga0070707_100026801 Ga0070707_1000268012 258
127 3300005471 Ga0070698_100003710 Ga0070698_1000037108 258
128 3300005471 Ga0070698_100016899 Ga0070698_1000168994 258
129 3300005471 Ga0070698_100148702 Ga0070698_1001487023 258
130 3300005518 Ga0070699_100068935 Ga0070699_1000689352 258
131 3300005518 Ga0070699_100143907 Ga0070699_1001439072 258
132 3300005536 Ga0070697_100109745 Ga0070697_1001097452 258
133 3300005549 Ga0070704_100081796 Ga0070704_1000817962 258
134 3300005564 Ga0070664_100135315 Ga0070664_1001353152 258
135 3300005578 Ga0068854_100119707 Ga0068854_1001197072 258
136 3300005617 Ga0068859_100008116 Ga0068859_1000081163 258
137 3300005618 Ga0068864_100349034 Ga0068864_1003490342 258
138 3300005844 Ga0068862_100129202 Ga0068862_1001292022 258
139 3300006880 Ga0075429_100012065 Ga0075429_1000120656 258
140 3300006914 Ga0075436_100000007 Ga0075436_100000007250 258
141 3300006931 Ga0097620_100008116 Ga0097620_1000081163 258
142 3300007076 Ga0075435_100000578 Ga0075435_10000057813 258
143 3300009148 Ga0105243_10000037 Ga0105243_1000003792 258
144 3300009176 Ga0105242_10000039 Ga0105242_1000003960 258
145 3300013100 Ga0157373_10073769 Ga0157373_100737691 258
146 3300013306 Ga0163162_10120212 Ga0163162_101202124 258
147 3300013307 Ga0157372_10732905 Ga0157372_107329052 258
148 3300014745 Ga0157377_10060967 Ga0157377_100609672 258
149 3300017792 Ga0163161_10431540 Ga0163161_104315402 258
150 3300025885 Ga0207653_10000307 Ga0207653_1000030712 258
151 3300025910 Ga0207684_10014067 Ga0207684_100140675 258
152 3300025912 Ga0207707_10203298 Ga0207707_102032982 258
153 3300025918 Ga0207662_10161242 Ga0207662_101612422 258
154 3300025920 Ga0207649_10194153 Ga0207649_101941532 258
155 3300025922 Ga0207646_10011902 Ga0207646_100119024 258
156 3300025922 Ga0207646_10137402 Ga0207646_101374022 258
157 3300025934 Ga0207686_10000003 Ga0207686_10000003279 258
158 3300025934 Ga0207686_10263600 Ga0207686_102636002 258
159 3300025935 Ga0207709_10000017 Ga0207709_10000017338 258
160 3300025940 Ga0207691_10024852 Ga0207691_100248524 258
161 3300025941 Ga0207711_10172843 Ga0207711_101728432 258
162 3300025945 Ga0207679_10109768 Ga0207679_101097683 258
163 3300025960 Ga0207651_10670869 Ga0207651_106708691 258
164 3300026075 Ga0207708_10039181 Ga0207708_100391814 258
165 3300026088 Ga0207641_10196562 Ga0207641_101965622 258
166 3300026095 Ga0207676_10321686 Ga0207676_103216862 258
167 3300031548 Ga0307408_100140041 Ga0307408_1001400412 258
168 3300031824 Ga0307413_10000302 Ga0307413_100003025 258
169 3300031852 Ga0307410_10021348 Ga0307410_100213486 258
170 3300031901 Ga0307406_10142866 Ga0307406_101428662 258
171 3300031903 Ga0307407_10033607 Ga0307407_100336073 258
172 3300031911 Ga0307412_10019869 Ga0307412_100198693 258
173 3300031995 Ga0307409_100031610 Ga0307409_1000316103 258
174 3300032002 Ga0307416_100049823 Ga0307416_1000498233 258
175 3300032005 Ga0307411_10007947 Ga0307411_100079475 258
176 3300032126 Ga0307415_100035195 Ga0307415_1000351953 258
177 3300046537 Ga0495598_0017554 Ga0495598_0017554_261_1040 258
178 3300046615 Ga0495656_0105664 Ga0495656_0105664_298_1077 258
179 3300046616 Ga0495668_0001177 Ga0495668_0001177_5915_6697 258
180 3300046689 Ga0495613_0336710 Ga0495613_0336710_236_1015 258
181 3300047322 Ga0495680_0357919 Ga0495680_0357919_160_939 258
182 3300047471 Ga0495684_0071558 Ga0495684_0071558_1768_2547 258
183 3300048090 Ga0495615_0039826 Ga0495615_0039826_120_899 258
184 3300049588 Ga0501072_0009726 Ga0501072_0009726_5345_6127 258
185 3300049652 Ga0501202_003659 Ga0501202_003659_237_1019 258
186 3300050511 nmdc:mga08y16_28299_c1 nmdc:mga08y16_28299_c1_3665_4444 258
187 3300050513 nmdc:mga0rr50_437_c1 nmdc:mga0rr50_437_c1_11236_12015 258
188 3300050514 nmdc:mga08x19_70_c1 nmdc:mga08x19_70_c1_73578_74357 258
189 3300053153 Ga0500616_0002361 Ga0500616_0002361_3095_3874 258
190 3300003322 rootL2_10261148 rootL2_102611481 259
191 3300005289 Ga0065704_10093763 Ga0065704_100937632 259
192 3300005293 Ga0065715_10092827 Ga0065715_100928272 259
193 3300005295 Ga0065707_10004402 Ga0065707_100044023 259
194 3300005330 Ga0070690_100048194 Ga0070690_1000481942 259
195 3300005331 Ga0070670_100318388 Ga0070670_1003183882 259
196 3300005334 Ga0068869_100004484 Ga0068869_1000044845 259
197 3300005334 Ga0068869_100542377 Ga0068869_1005423771 259
198 3300005338 Ga0068868_100501696 Ga0068868_1005016961 259
199 3300005340 Ga0070689_100023120 Ga0070689_1000231202 259
200 3300005344 Ga0070661_100354932 Ga0070661_1003549321 259
201 3300005354 Ga0070675_100018113 Ga0070675_1000181135 259
202 3300005355 Ga0070671_100048090 Ga0070671_1000480902 259
203 3300005356 Ga0070674_100063941 Ga0070674_1000639412 259
204 3300005356 Ga0070674_100368278 Ga0070674_1003682781 259
205 3300005364 Ga0070673_100190794 Ga0070673_1001907942 259
206 3300005365 Ga0070688_100223477 Ga0070688_1002234772 259
207 3300005367 Ga0070667_100023762 Ga0070667_1000237627 259
208 3300005441 Ga0070700_100038593 Ga0070700_1000385932 259
209 3300005444 Ga0070694_100072759 Ga0070694_1000727593 259
210 3300005444 Ga0070694_100357641 Ga0070694_1003576411 259
211 3300005445 Ga0070708_100295336 Ga0070708_1002953362 259
212 3300005467 Ga0070706_100004535 Ga0070706_1000045353 259
213 3300005468 Ga0070707_100254498 Ga0070707_1002544982 259
214 3300005468 Ga0070707_100368177 Ga0070707_1003681771 259
215 3300005471 Ga0070698_100727099 Ga0070698_1007270991 259
216 3300005536 Ga0070697_100032401 Ga0070697_1000324012 259
217 3300005543 Ga0070672_100061126 Ga0070672_1000611261 259
218 3300005544 Ga0070686_100017182 Ga0070686_1000171823 259
219 3300005545 Ga0070695_100039350 Ga0070695_1000393502 259
220 3300005545 Ga0070695_100188512 Ga0070695_1001885122 259
221 3300005546 Ga0070696_100031349 Ga0070696_1000313492 259
222 3300005546 Ga0070696_100187355 Ga0070696_1001873551 259
223 3300005549 Ga0070704_100127804 Ga0070704_1001278041 259
224 3300005549 Ga0070704_100268007 Ga0070704_1002680072 259
225 3300005549 Ga0070704_100520486 Ga0070704_1005204862 259
226 3300005564 Ga0070664_100072277 Ga0070664_1000722773 259
227 3300005617 Ga0068859_100212787 Ga0068859_1002127873 259
228 3300005617 Ga0068859_100360002 Ga0068859_1003600022 259
229 3300005618 Ga0068864_100080075 Ga0068864_1000800754 259
230 3300005718 Ga0068866_10085365 Ga0068866_100853652 259
231 3300005842 Ga0068858_100047252 Ga0068858_1000472522 259
232 3300005842 Ga0068858_100061408 Ga0068858_1000614083 259
233 3300005843 Ga0068860_100113199 Ga0068860_1001131994 259
234 3300006163 Ga0070715_10000006 Ga0070715_1000000620 259
235 3300006173 Ga0070716_100000001 Ga0070716_10000000129 259
236 3300006881 Ga0068865_100087982 Ga0068865_1000879823 259
237 3300006931 Ga0097620_100069577 Ga0097620_1000695773 259
238 3300006931 Ga0097620_100212793 Ga0097620_1002127933 259
239 3300006931 Ga0097620_100359999 Ga0097620_1003599991 259
240 3300007265 Ga0099794_10005956 Ga0099794_100059563 259
241 3300009098 Ga0105245_10218093 Ga0105245_102180932 259
242 3300009101 Ga0105247_10030949 Ga0105247_100309494 259
243 3300009101 Ga0105247_10066627 Ga0105247_100666273 259
244 3300009148 Ga0105243_10080884 Ga0105243_100808842 259
245 3300009148 Ga0105243_10743024 Ga0105243_107430241 259
246 3300010375 Ga0105239_10204976 Ga0105239_102049762 259
247 3300011119 Ga0105246_10046625 Ga0105246_100466252 259
248 3300013297 Ga0157378_10027485 Ga0157378_100274853 259
249 3300013297 Ga0157378_10415777 Ga0157378_104157772 259
250 3300013306 Ga0163162_11053812 Ga0163162_110538122 259
251 3300013308 Ga0157375_10010184 Ga0157375_1001018411 259
252 3300014325 Ga0163163_10026391 Ga0163163_100263914 259
253 3300017792 Ga0163161_10040616 Ga0163161_100406163 259
254 3300025899 Ga0207642_10008717 Ga0207642_100087173 259
255 3300025900 Ga0207710_10052936 Ga0207710_100529362 259
256 3300025905 Ga0207685_10000010 Ga0207685_10000010169 259
257 3300025910 Ga0207684_10017469 Ga0207684_100174693 259
258 3300025910 Ga0207684_10206167 Ga0207684_102061672 259
259 3300025931 Ga0207644_10266832 Ga0207644_102668322 259
260 3300025934 Ga0207686_10078125 Ga0207686_100781253 259
261 3300025935 Ga0207709_10387038 Ga0207709_103870381 259
262 3300025937 Ga0207669_10052058 Ga0207669_100520582 259
263 3300025939 Ga0207665_10000016 Ga0207665_1000001626 259
264 3300025939 Ga0207665_10254070 Ga0207665_102540701 259
265 3300025940 Ga0207691_10046001 Ga0207691_100460013 259
266 3300025941 Ga0207711_10179354 Ga0207711_101793543 259
267 3300025942 Ga0207689_10004093 Ga0207689_1000409313 259
268 3300025942 Ga0207689_10302024 Ga0207689_103020242 259
269 3300025945 Ga0207679_10167259 Ga0207679_101672593 259
270 3300025972 Ga0207668_10133030 Ga0207668_101330302 259
271 3300026035 Ga0207703_10110559 Ga0207703_101105591 259
272 3300026035 Ga0207703_10496510 Ga0207703_104965101 259
273 3300026088 Ga0207641_10019331 Ga0207641_100193316 259
274 3300026088 Ga0207641_10150722 Ga0207641_101507223 259
275 3300026095 Ga0207676_10043381 Ga0207676_100433814 259
276 3300026095 Ga0207676_10099224 Ga0207676_100992243 259
277 3300027671 Ga0209588_1003965 Ga0209588_10039651 259
278 3300028380 Ga0268265_10043949 Ga0268265_100439494 259
279 3300028381 Ga0268264_10025325 Ga0268264_100253254 259
280 3300031548 Ga0307408_100153576 Ga0307408_1001535763 259
281 3300031901 Ga0307406_10084189 Ga0307406_100841893 259
282 3300031995 Ga0307409_100052026 Ga0307409_1000520263 259
283 3300032005 Ga0307411_10163348 Ga0307411_101633481 259
284 3300032126 Ga0307415_100119485 Ga0307415_1001194852 259
285 3300044673 Ga0453683_0060694 Ga0453683_0060694_1091_1873 259
286 3300044673 Ga0453683_0303553 Ga0453683_0303553_181_966 259
287 3300045051 Ga0451576_0633006 Ga0451576_0633006_202_984 259
288 3300048908 Ga0496105_0186309 Ga0496105_0186309_545_1330 259
289 3300048912 Ga0496109_0094131 Ga0496109_0094131_1299_2084 259
290 3300048917 Ga0496114_0134386 Ga0496114_0134386_523_1308 259
291 3300050513 nmdc:mga0rr50_220354_c1 nmdc:mga0rr50_220354_c1_643_1428 259
292 3300005293 Ga0065715_10184736 Ga0065715_101847362 260
293 3300005295 Ga0065707_10091392 Ga0065707_100913923 260
294 3300005331 Ga0070670_100230855 Ga0070670_1002308552 260
295 3300005334 Ga0068869_100007260 Ga0068869_1000072609 260
296 3300005354 Ga0070675_100198414 Ga0070675_1001984143 260
297 3300005364 Ga0070673_100056542 Ga0070673_1000565422 260
298 3300005367 Ga0070667_100318057 Ga0070667_1003180572 260
299 3300005438 Ga0070701_10357175 Ga0070701_103571751 260
300 3300005444 Ga0070694_100214809 Ga0070694_1002148092 260
301 3300005456 Ga0070678_100489653 Ga0070678_1004896531 260
302 3300005544 Ga0070686_100014753 Ga0070686_1000147532 260
303 3300005549 Ga0070704_100013107 Ga0070704_1000131073 260
304 3300005719 Ga0068861_100241661 Ga0068861_1002416612 260
305 3300005841 Ga0068863_100125763 Ga0068863_1001257633 260
306 3300005842 Ga0068858_100063668 Ga0068858_1000636682 260
307 3300005842 Ga0068858_100121835 Ga0068858_1001218353 260
308 3300009148 Ga0105243_10000558 Ga0105243_1000055824 260
309 3300009148 Ga0105243_10041081 Ga0105243_100410812 260
310 3300009176 Ga0105242_10006195 Ga0105242_100061954 260
311 3300009177 Ga0105248_10394824 Ga0105248_103948242 260
312 3300009553 Ga0105249_10075094 Ga0105249_100750942 260
313 3300009553 Ga0105249_10102500 Ga0105249_101025004 260
314 3300009553 Ga0105249_10131466 Ga0105249_101314663 260
315 3300013297 Ga0157378_10000077 Ga0157378_1000007712 260
316 3300013297 Ga0157378_10287385 Ga0157378_102873852 260
317 3300013308 Ga0157375_10002146 Ga0157375_100021464 260
318 3300025925 Ga0207650_10145956 Ga0207650_101459562 260
319 3300025925 Ga0207650_10226224 Ga0207650_102262242 260
320 3300025931 Ga0207644_10048074 Ga0207644_100480742 260
321 3300025934 Ga0207686_10003637 Ga0207686_100036374 260
322 3300025935 Ga0207709_10000325 Ga0207709_1000032515 260
323 3300025936 Ga0207670_10171061 Ga0207670_101710612 260
324 3300025941 Ga0207711_10276380 Ga0207711_102763802 260
325 3300025942 Ga0207689_10011709 Ga0207689_1001170910 260
326 3300025960 Ga0207651_10052872 Ga0207651_100528723 260
327 3300025961 Ga0207712_10026731 Ga0207712_100267312 260
328 3300026035 Ga0207703_10059166 Ga0207703_100591662 260
329 3300026067 Ga0207678_10011896 Ga0207678_100118968 260
330 3300026088 Ga0207641_10041766 Ga0207641_100417663 260
331 3300026118 Ga0207675_100026932 Ga0207675_1000269324 260
332 3300031731 Ga0307405_10147475 Ga0307405_101474752 260
333 3300031824 Ga0307413_10008243 Ga0307413_100082433 260
334 3300031824 Ga0307413_10281927 Ga0307413_102819272 260
335 3300031852 Ga0307410_10001237 Ga0307410_100012376 260
336 3300031903 Ga0307407_10000900 Ga0307407_100009007 260
337 3300031903 Ga0307407_10383549 Ga0307407_103835491 260
338 3300031995 Ga0307409_100107406 Ga0307409_1001074062 260
339 3300031995 Ga0307409_100465359 Ga0307409_1004653591 260
340 3300032002 Ga0307416_100064892 Ga0307416_1000648922 260
341 3300032004 Ga0307414_10024891 Ga0307414_100248914 260
342 3300032126 Ga0307415_100006161 Ga0307415_1000061619 260
343 3300042435 Ga0439434_0026847 Ga0439434_0026847_93_878 260
344 3300048903 Ga0496100_0175415 Ga0496100_0175415_334_1116 260
345 3300050507 nmdc:mga05p37_49608_c1 nmdc:mga05p37_49608_c1_2207_2989 260
346 3300002239 JGI24034J26672_10000001 JGI24034J26672_10000001508 261
347 3300005295 Ga0065707_10006887 Ga0065707_100068873 261
348 3300005328 Ga0070676_10271341 Ga0070676_102713412 261
349 3300005333 Ga0070677_10003590 Ga0070677_100035902 261
350 3300005347 Ga0070668_100331634 Ga0070668_1003316341 261
351 3300005364 Ga0070673_100070572 Ga0070673_1000705724 261
352 3300005456 Ga0070678_100033849 Ga0070678_1000338492 261
353 3300005459 Ga0068867_100237549 Ga0068867_1002375492 261
354 3300005468 Ga0070707_100000252 Ga0070707_10000025236 261
355 3300005549 Ga0070704_100008325 Ga0070704_1000083256 261
356 3300005719 Ga0068861_100060256 Ga0068861_1000602563 261
357 3300005840 Ga0068870_10059568 Ga0068870_100595682 261
358 3300005842 Ga0068858_100000005 Ga0068858_100000005234 261
359 3300006881 Ga0068865_100308488 Ga0068865_1003084882 261
360 3300009101 Ga0105247_10000002 Ga0105247_10000002480 261
361 3300013297 Ga0157378_10139652 Ga0157378_101396522 261
362 3300013297 Ga0157378_10148759 Ga0157378_101487593 261
363 3300013308 Ga0157375_10132092 Ga0157375_101320923 261
364 3300014326 Ga0157380_10024418 Ga0157380_100244185 261
365 3300017792 Ga0163161_10034856 Ga0163161_100348563 261
366 3300025223 Ga0207672_1000003 Ga0207672_10000034 261
367 3300025893 Ga0207682_10033604 Ga0207682_100336042 261
368 3300025900 Ga0207710_10000002 Ga0207710_10000002480 261
369 3300025907 Ga0207645_10253082 Ga0207645_102530822 261
370 3300025908 Ga0207643_10097151 Ga0207643_100971512 261
371 3300025922 Ga0207646_10000399 Ga0207646_1000039937 261
372 3300025926 Ga0207659_10230784 Ga0207659_102307841 261
373 3300025931 Ga0207644_10004637 Ga0207644_100046372 261
374 3300025931 Ga0207644_10287890 Ga0207644_102878902 261
375 3300025938 Ga0207704_10298049 Ga0207704_102980491 261
376 3300025941 Ga0207711_10081501 Ga0207711_100815013 261
377 3300026075 Ga0207708_10255697 Ga0207708_102556972 261
378 3300026089 Ga0207648_10200691 Ga0207648_102006912 261
379 3300026118 Ga0207675_100002593 Ga0207675_1000025933 261
380 3300026121 Ga0207683_10194871 Ga0207683_101948712 261
381 3300032126 Ga0307415_100060439 Ga0307415_1000604392 261
382 3300039437 Ga0436365_0381643 Ga0436365_0381643_163_963 261
383 3300042015 Ga0439462_0008306 Ga0439462_0008306_60_848 261
384 3300042156 Ga0439446_0016042 Ga0439446_0016042_701_1489 261
385 3300046519 Ga0495632_0012582 Ga0495632_0012582_2380_3180 261
386 3300049520 Ga0501297_002375 Ga0501297_002375_716_1507 261
387 3300049521 Ga0501298_000179 Ga0501298_000179_3541_4332 261
388 3300049524 Ga0501301_004421 Ga0501301_004421_153_944 261
389 3300049649 Ga0501198_002051 Ga0501198_002051_902_1693 261
390 3300049661 Ga0501217_030072 Ga0501217_030072_481_1272 261
391 3300049663 Ga0501223_011433 Ga0501223_011433_90_881 261
392 3300049668 Ga0501233_011367 Ga0501233_011367_894_1685 261
393 3300049669 Ga0501235_002056 Ga0501235_002056_1266_2057 261
394 3300049678 Ga0501248_009945 Ga0501248_009945_32_823 261
395 3300049705 Ga0501225_0027266 Ga0501225_0027266_652_1443 261
396 3300049767 Ga0501270_004239 Ga0501270_004239_376_1167 261
397 3300049768 Ga0501271_001968 Ga0501271_001968_363_1154 261
398 3300049773 Ga0501276_004777 Ga0501276_004777_92_883 261
399 3300050507 nmdc:mga05p37_27340_c1 nmdc:mga05p37_27340_c1_2757_3554 261
400 3300050511 nmdc:mga08y16_96170_c1 nmdc:mga08y16_96170_c1_195_998 261
401 3300050515 nmdc:mga0a205_176022_c1 nmdc:mga0a205_176022_c1_420_1205 261

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

2

196

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

8

210

0.94

PF08659

KR

KR domain

3

185

0.85

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

4

227

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
7e28-assembly1.cif.gz_A crystal structure of sdr family nad(p)-dependent oxidoreductase from exiguobacterium 0.9414 2 224
7e24-assembly2.cif.gz_C crystal structure of sdr family nad(p)-dependent oxidoreductase from exiguobacterium 0.9406 1 224
7e28-assembly1.cif.gz_B crystal structure of sdr family nad(p)-dependent oxidoreductase from exiguobacterium 0.9402 1 224
7e3x-assembly1.cif.gz_B crystal structure of sdr family nad(p)-dependent oxidoreductase from exiguobacterium 0.94 1 224
8g9v-assembly1.cif.gz_B crystal structures of 17-beta-hydroxysteroid dehydrogenase 13 0.9251 2 248
ID Description Score Start End Superfamily
af_Q10782_3_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9541 2 242 3.40.50.720
af_P37058_44_264_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9274 2 218 3.40.50.720
af_Q53GQ0_49_275_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9266 4 222 3.40.50.720
af_I6YB11_7_265_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9258 4 238 3.40.50.720
af_Q8SX47_51_284_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9252 4 222 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2V9HL59-F1-model_v4 Oxidoreductase 0.9824 1 155 GO:0016491
GO:0030497
AF-A0A0P8XW79-F1-model_v4 Short chain dehydrogenase family protein 0.9787 2 252 GO:0016020
GO:0016491
AF-A0A7Z1Y790-F1-model_v4 deleted 0.9758 2 252
AF-A0A6A0IEQ4-F1-model_v4 SDR family oxidoreductase 0.9756 2 254 GO:0016491
GO:0030497
AF-A0A4Y9HFN9-F1-model_v4 deleted 0.9748 1 253

Feature Viewer

pLDDT pTM Quality
90.32 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map