F434667

General Info

Members Datasets Scaffolds Average Seq Length
400 212 800 285

Family's Representative Sequence

Representative Sequence 3300046809|Ga0495600_0056524|Ga0495600_0056524_528_1532
Length 334
Sequence MNIIRARHLGMCFGVRDAIDLAFGHAEAAPLTILGDLVHNPAVLDALRAKGIAVEAQPARVTTGTVMVTAHGASERALAATRALGLTVIEATCPLVRVAHRAILALVRDGYHPVIIGQPNHVEVRGLTEDLDEFDVVLDEQDLDALAGRPRIGVAAQTTQPLAKVRHLVDLIRRRFPESALKFMDTVCQPTKLRQSAAVDLARRSDVVIVIGGANSNNTRELVSTCSRHCARVHHVQSESDLRPEWFLEADTVGITAGTSTPDAVIDLVHDRISQMAKRRSSARAEPALEAERVLGQMQVHPVVIRPDGRDLGDDDAQVVPLERGDRRLAERQH

Samples

Sample ID Description Type Environment
1 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
124 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
125 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
134 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
135 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
137 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
144 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
145 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
146 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
147 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
148 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
151 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
152 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
153 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
154 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
155 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
158 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
159 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
163 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
166 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
167 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
170 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
171 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
186 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
187 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
188 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
189 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
190 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
194 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
195 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
196 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
197 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
198 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
199 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
200 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
205 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
208 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
209 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
210 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
212 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.75
Nodule 0
Rhizoplane 2.5
Rhizosphere 95.75
Stem 0
Stem Tuber 0
Unclassified 21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495600_0056524 3300046809 Bacteria 2564
2 Ga0065712_10002498 3300005290 Bacteria 7595
3 Ga0065712_10071943 3300005290 Unclassified 4976
4 Ga0065712_10077272 3300005290 Bacteria 3521
5 Ga0065712_10086573 3300005290 Bacteria 2628
6 Ga0065715_10029950 3300005293 Unclassified 1095
7 Ga0065715_10109026 3300005293 Bacteria 2688
8 Ga0065715_10152746 3300005293 Bacteria 1710
9 Ga0065715_10215697 3300005293 Bacteria 1259
10 Ga0065707_10149529 3300005295 Bacteria 1674
11 Ga0070658_10076105 3300005327 Bacteria 2753
12 Ga0070676_10063091 3300005328 Bacteria 2206
13 Ga0070690_100024298 3300005330 Bacteria 3726
14 Ga0070690_100025568 3300005330 Bacteria 3636
15 Ga0070690_100130646 3300005330 Unclassified 1696
16 Ga0070670_100007317 3300005331 Bacteria 9365
17 Ga0070670_100038722 3300005331 Bacteria 4099
18 Ga0068869_100310757 3300005334 Bacteria 1276
19 Ga0070666_10352014 3300005335 Unclassified 1054
20 Ga0068868_100256990 3300005338 Unclassified 1472
21 Ga0070689_100050010 3300005340 Bacteria 3228
22 Ga0070689_100062984 3300005340 Unclassified 2887
23 Ga0070689_100215249 3300005340 Unclassified 1574
24 Ga0070689_100326634 3300005340 Bacteria 1282
25 Ga0070689_100570298 3300005340 Unclassified 977
26 Ga0070691_10151324 3300005341 Unclassified 1190
27 Ga0070687_100001021 3300005343 Bacteria 9541
28 Ga0070687_100313779 3300005343 Bacteria 999
29 Ga0070669_100012781 3300005353 Bacteria 5961
30 Ga0070675_100009417 3300005354 Bacteria 7600
31 Ga0070675_100194173 3300005354 Unclassified 1760
32 Ga0070671_100015492 3300005355 Bacteria 6159
33 Ga0070671_100020192 3300005355 Bacteria 5430
34 Ga0070674_100022000 3300005356 Bacteria 4106
35 Ga0070674_100305861 3300005356 Bacteria 1269
36 Ga0070673_100025674 3300005364 Bacteria 4340
37 Ga0070688_100203013 3300005365 Bacteria 1388
38 Ga0070659_100487729 3300005366 Bacteria 1049
39 Ga0070667_100041865 3300005367 Unclassified 3841
40 Ga0070703_10063401 3300005406 Unclassified 1215
41 Ga0070713_100066228 3300005436 Bacteria 3037
42 Ga0070711_100015306 3300005439 Bacteria 4855
43 Ga0070700_100274472 3300005441 Archaea 1220
44 Ga0070694_100006531 3300005444 Bacteria 7081
45 Ga0070678_100293239 3300005456 Bacteria 1380
46 Ga0070678_100363257 3300005456 Unclassified 1248
47 Ga0070685_10014320 3300005466 Bacteria 4199
48 Ga0070707_100090277 3300005468 Bacteria 2966
49 Ga0070699_100026823 3300005518 Bacteria 4969
50 Ga0070672_100007256 3300005543 Bacteria 7509
51 Ga0070672_100097499 3300005543 Unclassified 2380
52 Ga0070672_100229381 3300005543 Bacteria 1559
53 Ga0070686_100000416 3300005544 Bacteria 26875
54 Ga0070686_100073128 3300005544 Unclassified 2250
55 Ga0070686_100128331 3300005544 Unclassified 1750
56 Ga0070695_100008777 3300005545 Bacteria 6006
57 Ga0070696_100013291 3300005546 Bacteria 5522
58 Ga0070696_100014444 3300005546 Bacteria 5296
59 Ga0070696_100016300 3300005546 Bacteria 5001
60 Ga0070665_100009511 3300005548 Bacteria 9829
61 Ga0070665_100313293 3300005548 Unclassified 1573
62 Ga0070704_100074598 3300005549 Unclassified 2475
63 Ga0070704_100142168 3300005549 Bacteria 1875
64 Ga0068854_100026733 3300005578 Bacteria 3969
65 Ga0070702_100107685 3300005615 Bacteria 1721
66 Ga0068852_100128589 3300005616 Bacteria 2330
67 Ga0068852_100464559 3300005616 Bacteria 1255
68 Ga0068859_100246625 3300005617 Bacteria 1876
69 Ga0068859_100311572 3300005617 Bacteria 1667
70 Ga0068859_100727783 3300005617 Bacteria 1082
71 Ga0068859_100845265 3300005617 Unclassified 1001
72 Ga0068864_100527508 3300005618 Unclassified 1139
73 Ga0068861_100113068 3300005719 Archaea 2178
74 Ga0068861_100322554 3300005719 Bacteria 1346
75 Ga0068861_100532153 3300005719 Bacteria 1068
76 Ga0068851_10170194 3300005834 Unclassified 1202
77 Ga0068863_100047824 3300005841 Bacteria 4057
78 Ga0068863_100204768 3300005841 Bacteria 1899
79 Ga0068858_100048295 3300005842 Unclassified 3944
80 Ga0068858_100361074 3300005842 Bacteria 1392
81 Ga0068858_100392876 3300005842 Unclassified 1332
82 Ga0068860_100029355 3300005843 Bacteria 5288
83 Ga0068860_100400724 3300005843 Bacteria 1357
84 Ga0068862_100161772 3300005844 Unclassified 1999
85 Ga0068862_100340656 3300005844 Bacteria 1389
86 Ga0081455_10050449 3300005937 Bacteria 3578
87 Ga0081538_10142605 3300005981 Unclassified 1101
88 Ga0070717_10042462 3300006028 Bacteria 3708
89 Ga0075368_10013191 3300006042 Bacteria 3032
90 Ga0075364_10023561 3300006051 Bacteria 3898
91 Ga0075367_10003105 3300006178 Bacteria 7809
92 Ga0097621_100004762 3300006237 Bacteria 9492
93 Ga0097621_100013139 3300006237 Bacteria 6159
94 Ga0075370_10028722 3300006353 Bacteria 3093
95 Ga0068871_100000687 3300006358 Bacteria 23018
96 Ga0068871_100004515 3300006358 Bacteria 9697
97 Ga0068871_100005904 3300006358 Bacteria 8612
98 Ga0075428_100021268 3300006844 Bacteria 7184
99 Ga0075428_100036168 3300006844 Bacteria 5440
100 Ga0075428_100289182 3300006844 Bacteria 1763
101 Ga0075428_100290295 3300006844 Bacteria 1759
102 Ga0075428_100427060 3300006844 Bacteria 1420
103 Ga0075430_100008965 3300006846 Bacteria 8451
104 Ga0075430_100042483 3300006846 Bacteria 3844
105 Ga0075430_100096587 3300006846 Bacteria 2469
106 Ga0075430_100145590 3300006846 Bacteria 1973
107 Ga0075431_100019876 3300006847 Bacteria 6857
108 Ga0075431_100031779 3300006847 Bacteria 5438
109 Ga0075431_100257840 3300006847 Unclassified 1770
110 Ga0075431_100583606 3300006847 Bacteria 1103
111 Ga0075431_100590678 3300006847 Unclassified 1095
112 Ga0075433_10017793 3300006852 Bacteria 5895
113 Ga0075433_10019458 3300006852 Bacteria 5657
114 Ga0075433_10153071 3300006852 Unclassified 2051
115 Ga0075434_100013873 3300006871 Bacteria 7686
116 Ga0075434_100088692 3300006871 Bacteria 3094
117 Ga0075434_100366399 3300006871 Unclassified 1462
118 Ga0075429_100004449 3300006880 Bacteria 12050
119 Ga0075429_100040627 3300006880 Bacteria 4051
120 Ga0075429_100057773 3300006880 Unclassified 3378
121 Ga0075429_100101829 3300006880 Bacteria 2507
122 Ga0068865_100001754 3300006881 Bacteria 12723
123 Ga0068865_100006608 3300006881 Bacteria 7092
124 Ga0068865_100159890 3300006881 Unclassified 1717
125 Ga0097620_100246617 3300006931 Bacteria 1876
126 Ga0097620_100311554 3300006931 Bacteria 1667
127 Ga0097620_100727868 3300006931 Bacteria 1082
128 Ga0097620_100845302 3300006931 Unclassified 1001
129 Ga0075435_100008645 3300007076 Bacteria 7320
130 Ga0105240_10100751 3300009093 Bacteria 3514
131 Ga0111539_10000702 3300009094 Bacteria 43366
132 Ga0111539_10001367 3300009094 Bacteria 32489
133 Ga0111539_10007550 3300009094 Bacteria 13900
134 Ga0111539_10048490 3300009094 Bacteria 5071
135 Ga0111539_10073471 3300009094 Bacteria 4032
136 Ga0111539_10074992 3300009094 Bacteria 3985
137 Ga0105245_10128375 3300009098 Bacteria 2375
138 Ga0105245_10145280 3300009098 Bacteria 2237
139 Ga0105245_10326172 3300009098 Unclassified 1514
140 Ga0114129_10023721 3300009147 Bacteria 8697
141 Ga0114129_10025374 3300009147 Bacteria 8398
142 Ga0114129_10038025 3300009147 Bacteria 6789
143 Ga0114129_10045636 3300009147 Bacteria 6159
144 Ga0114129_10068459 3300009147 Unclassified 4949
145 Ga0114129_10080026 3300009147 Bacteria 4543
146 Ga0114129_10095177 3300009147 Bacteria 4125
147 Ga0114129_10096017 3300009147 Bacteria 4104
148 Ga0114129_10170790 3300009147 Bacteria 2964
149 Ga0114129_10475205 3300009147 Unclassified 1636
150 Ga0105243_10026300 3300009148 Bacteria 4454
151 Ga0105241_10182619 3300009174 Bacteria 1741
152 Ga0105241_10239605 3300009174 Bacteria 1533
153 Ga0105242_10383935 3300009176 Unclassified 1306
154 Ga0105242_10681479 3300009176 Bacteria 1003
155 Ga0105248_10018525 3300009177 Bacteria 7696
156 Ga0105248_10024746 3300009177 Bacteria 6677
157 Ga0105248_10046756 3300009177 Bacteria 4852
158 Ga0105248_10089069 3300009177 Unclassified 3473
159 Ga0105248_10110758 3300009177 Unclassified 3096
160 Ga0105248_10125394 3300009177 Bacteria 2897
161 Ga0105248_10176640 3300009177 Bacteria 2406
162 Ga0105249_10111084 3300009553 Bacteria 2591
163 Ga0105239_10187570 3300010375 Bacteria 2314
164 Ga0157378_10028821 3300013297 Unclassified 4901
165 Ga0157378_10140841 3300013297 Bacteria 2239
166 Ga0157378_10749248 3300013297 Bacteria 999
167 Ga0163162_10025829 3300013306 Bacteria 5805
168 Ga0163162_10501124 3300013306 Bacteria 1345
169 Ga0163162_10507011 3300013306 Unclassified 1337
170 Ga0157375_10064667 3300013308 Bacteria 3643
171 Ga0157375_10349969 3300013308 Bacteria 1643
172 Ga0163163_10000048 3300014325 Bacteria 130746
173 Ga0163163_10037369 3300014325 Unclassified 4724
174 Ga0157380_10005731 3300014326 Bacteria 8694
175 Ga0157380_10128220 3300014326 Archaea 2160
176 Ga0157380_10150532 3300014326 Bacteria 2011
177 Ga0157380_10281805 3300014326 Bacteria 1521
178 Ga0157380_10446859 3300014326 Bacteria 1240
179 Ga0157379_10151909 3300014968 Bacteria 2089
180 Ga0157379_10261510 3300014968 Bacteria 1572
181 Ga0157376_10000975 3300014969 Bacteria 18667
182 Ga0157376_10177730 3300014969 Bacteria 1943
183 Ga0157376_10313742 3300014969 Bacteria 1488
184 Ga0163161_10051569 3300017792 Bacteria 2981
185 Ga0207697_10081820 3300025315 Bacteria 1361
186 Ga0207653_10101991 3300025885 Bacteria 1016
187 Ga0207688_10029401 3300025901 Bacteria 3025
188 Ga0207688_10070846 3300025901 Unclassified 1978
189 Ga0207680_10008374 3300025903 Bacteria 5071
190 Ga0207680_10074548 3300025903 Bacteria 2113
191 Ga0207654_10119009 3300025911 Bacteria 1655
192 Ga0207662_10003171 3300025918 Bacteria 8409
193 Ga0207662_10012474 3300025918 Bacteria 4733
194 Ga0207649_10093590 3300025920 Bacteria 1973
195 Ga0207646_10189875 3300025922 Bacteria 1855
196 Ga0207681_10010529 3300025923 Bacteria 5665
197 Ga0207650_10006413 3300025925 Bacteria 8015
198 Ga0207659_10012832 3300025926 Bacteria 5350
199 Ga0207659_10115496 3300025926 Bacteria 2048
200 Ga0207659_10454258 3300025926 Bacteria 1079
201 Ga0207700_10311263 3300025928 Bacteria 1362
202 Ga0207644_10267779 3300025931 Bacteria 1368
203 Ga0207706_10073672 3300025933 Bacteria 3003
204 Ga0207686_10008822 3300025934 Bacteria 5452
205 Ga0207686_10045421 3300025934 Bacteria 2702
206 Ga0207709_10064281 3300025935 Bacteria 2303
207 Ga0207670_10192905 3300025936 Bacteria 1542
208 Ga0207704_10005457 3300025938 Bacteria 5863
209 Ga0207704_10009140 3300025938 Bacteria 4767
210 Ga0207704_10131256 3300025938 Bacteria 1735
211 Ga0207691_10022789 3300025940 Bacteria 5904
212 Ga0207691_10022879 3300025940 Bacteria 5891
213 Ga0207691_10041990 3300025940 Bacteria 4219
214 Ga0207691_10045881 3300025940 Bacteria 4017
215 Ga0207691_10109421 3300025940 Unclassified 2458
216 Ga0207691_10145480 3300025940 Bacteria 2086
217 Ga0207691_10153058 3300025940 Bacteria 2027
218 Ga0207691_10223669 3300025940 Bacteria 1631
219 Ga0207711_10011717 3300025941 Bacteria 7283
220 Ga0207711_10016857 3300025941 Bacteria 6067
221 Ga0207711_10062467 3300025941 Bacteria 3212
222 Ga0207711_10062548 3300025941 Unclassified 3210
223 Ga0207711_10070412 3300025941 Bacteria 3033
224 Ga0207711_10302740 3300025941 Bacteria 1475
225 Ga0207711_10355129 3300025941 Bacteria 1357
226 Ga0207651_10040070 3300025960 Bacteria 3095
227 Ga0207651_10079274 3300025960 Unclassified 2359
228 Ga0207651_10245348 3300025960 Bacteria 1462
229 Ga0207712_10024333 3300025961 Bacteria 4008
230 Ga0207668_10223723 3300025972 Unclassified 1513
231 Ga0207640_10024043 3300025981 Bacteria 3670
232 Ga0207658_10244277 3300025986 Bacteria 1523
233 Ga0207703_10065377 3300026035 Bacteria 2989
234 Ga0207703_10066836 3300026035 Bacteria 2958
235 Ga0207703_10257118 3300026035 Unclassified 1577
236 Ga0207678_10163731 3300026067 Bacteria 1899
237 Ga0207708_10010517 3300026075 Bacteria 6869
238 Ga0207708_10015216 3300026075 Bacteria 5768
239 Ga0207708_10163895 3300026075 Archaea 1757
240 Ga0207708_10374921 3300026075 Bacteria 1172
241 Ga0207641_10003710 3300026088 Bacteria 13451
242 Ga0207641_10326220 3300026088 Unclassified 1457
243 Ga0207648_10167384 3300026089 Bacteria 1942
244 Ga0207676_10236401 3300026095 Unclassified 1636
245 Ga0207676_10301201 3300026095 Bacteria 1464
246 Ga0207675_100028171 3300026118 Bacteria 5230
247 Ga0207675_100219457 3300026118 Archaea 1832
248 Ga0207675_100370321 3300026118 Bacteria 1407
249 Ga0207683_10087840 3300026121 Bacteria 2765
250 Ga0207698_10101693 3300026142 Bacteria 2384
251 Ga0207428_10000395 3300027907 Bacteria 54490
252 Ga0207428_10002423 3300027907 Bacteria 18613
253 Ga0207428_10003862 3300027907 Bacteria 14367
254 Ga0207428_10390310 3300027907 Bacteria 1020
255 Ga0268266_10009887 3300028379 Bacteria 8386
256 Ga0268265_10386100 3300028380 Unclassified 1290
257 Ga0268264_10036902 3300028381 Unclassified 4027
258 Ga0268264_10234496 3300028381 Bacteria 1696
259 Ga0265338_10086277 3300028800 Unclassified 2613
260 Ga0265338_10161091 3300028800 Bacteria 1733
261 Ga0265338_10243449 3300028800 Bacteria 1331
262 Ga0265339_10009757 3300031249 Bacteria 6001
263 Ga0265316_10141583 3300031344 Bacteria 1806
264 Ga0307408_100021708 3300031548 Bacteria 4349
265 Ga0307408_100023278 3300031548 Bacteria 4217
266 Ga0265314_10000020 3300031711 Bacteria 307052
267 Ga0307410_10037609 3300031852 Bacteria 3163
268 Ga0307410_10326914 3300031852 Unclassified 1218
269 Ga0307412_10207664 3300031911 Unclassified 1492
270 Ga0307412_10446082 3300031911 Unclassified 1065
271 Ga0307409_100012880 3300031995 Bacteria 5352
272 Ga0307409_100129019 3300031995 Bacteria 2157
273 Ga0307409_100442002 3300031995 Bacteria 1253
274 Ga0307416_100036452 3300032002 Bacteria 3772
275 Ga0307416_100061302 3300032002 Bacteria 3069
276 Ga0307411_10509630 3300032005 Unclassified 1019
277 Ga0373944_0073053 3300035089 Unclassified 1121
278 Ga0373932_0049977 3300035112 Bacteria 1238
279 Ga0373936_0082446 3300035113 Bacteria 1340
280 Ga0373941_0031533 3300035115 Bacteria 1580
281 Ga0373941_0032042 3300035115 Bacteria 1571
282 Ga0373924_0006490 3300035410 Bacteria 4191
283 Ga0373935_0055583 3300035692 Bacteria 2522
284 Ga0373947_0067951 3300035725 Bacteria 2178
285 Ga0373937_0025857 3300036401 Bacteria 5301
286 Ga0373925_0011349 3300037068 Bacteria 6465
287 Ga0395905_0660541 3300037471 Bacteria 947
288 Ga0439433_0018773 3300041999 Archaea 1540
289 Ga0439449_0077890 3300042007 Archaea 1222
290 Ga0439446_0006119 3300042156 Unclassified 3125
291 Ga0451577_0024130 3300042876 Bacteria 5533
292 Ga0453684_0052169 3300044712 Bacteria 5352
293 Ga0495592_0057174 3300046454 Bacteria 2880
294 Ga0495592_0133801 3300046454 Bacteria 1731
295 Ga0495580_0033913 3300046472 Bacteria 3676
296 Ga0495639_0028606 3300046475 Bacteria 2470
297 Ga0495639_0087721 3300046475 Bacteria 1456
298 Ga0495608_0004948 3300046511 Bacteria 9542
299 Ga0495628_0110474 3300046516 Bacteria 2115
300 Ga0495628_0124705 3300046516 Bacteria 1974
301 Ga0495630_0013161 3300046517 Bacteria 6014
302 Ga0495630_0202539 3300046517 Bacteria 1515
303 Ga0495665_0116621 3300046531 Unclassified 1399
304 Ga0495640_0252906 3300046533 Archaea 1103
305 Ga0495587_0110888 3300046536 Unclassified 1576
306 Ga0495621_0094267 3300046539 Bacteria 1132
307 Ga0495645_0001717 3300046543 Bacteria 14876
308 Ga0495667_0052287 3300046559 Unclassified 2692
309 Ga0495635_0060461 3300046663 Bacteria 2604
310 Ga0495599_0084239 3300046678 Unclassified 1985
311 Ga0495647_0116706 3300046681 Bacteria 1119
312 Ga0495658_0050416 3300046683 Unclassified 2355
313 Ga0495613_0002935 3300046689 Bacteria 12771
314 Ga0495581_0184143 3300047315 Unclassified 1222
315 Ga0495604_0032282 3300047317 Bacteria 4152
316 Ga0495636_0108227 3300047318 Bacteria 1221
317 Ga0495674_0066023 3300047319 Bacteria 3141
318 Ga0495680_0070574 3300047322 Unclassified 2663
319 Ga0495680_0312595 3300047322 Bacteria 1101
320 Ga0495675_0034509 3300047444 Unclassified 3230
321 Ga0495684_0008920 3300047471 Bacteria 7747
322 Ga0495684_0045109 3300047471 Bacteria 3374
323 Ga0496103_0186660 3300048906 Bacteria 1333
324 Ga0496104_0210435 3300048907 Bacteria 1856
325 Ga0496105_0363017 3300048908 Bacteria 1155
326 Ga0496107_0046596 3300048910 Unclassified 3120
327 Ga0496109_0462778 3300048912 Bacteria 1198
328 Ga0496110_0227969 3300048913 Bacteria 1694
329 Ga0496110_0481931 3300048913 Unclassified 1130
330 Ga0496112_0074435 3300048915 Bacteria 3358
331 Ga0496112_0267827 3300048915 Bacteria 1657
332 Ga0496113_0161090 3300048916 Unclassified 1774
333 Ga0501034_0007874 3300049571 Bacteria 11325
334 Ga0501038_0107378 3300049574 Bacteria 2316
335 Ga0501040_0056007 3300049576 Bacteria 2705
336 Ga0501040_0060181 3300049576 Unclassified 2610
337 Ga0501041_0286771 3300049577 Unclassified 1036
338 Ga0501042_0424123 3300049578 Bacteria 964
339 Ga0501068_0108324 3300049584 Unclassified 1726
340 Ga0501068_0157446 3300049584 Bacteria 1431
341 Ga0501071_0381184 3300049587 Bacteria 1075
342 Ga0501072_0141664 3300049588 Bacteria 1917
343 Ga0501073_0025892 3300049589 Bacteria 4203
344 Ga0501073_0089984 3300049589 Bacteria 2134
345 Ga0501075_0071986 3300049591 Bacteria 2613
346 Ga0501076_0056990 3300049592 Bacteria 3102
347 Ga0501079_0063913 3300049741 Bacteria 2839
348 Ga0501079_0086592 3300049741 Unclassified 2425
349 Ga0501079_0110789 3300049741 Bacteria 2133
350 Ga0501080_0231491 3300049742 Bacteria 1689
351 Ga0501081_0122396 3300049743 Bacteria 1854
352 Ga0501081_0340261 3300049743 Bacteria 1105
353 nmdc:mga03n38_69810_c1 3300050490 Bacteria 1623
354 nmdc:mga0yw44_11323_c1 3300050492 Bacteria 4598
355 nmdc:mga06z11_44908_c1 3300050494 Bacteria 2231
356 nmdc:mga05p37_1443_c1 3300050507 Bacteria 27640
357 nmdc:mga05p37_156484_c1 3300050507 Unclassified 2785
358 nmdc:mga05p37_184909_c1 3300050507 Bacteria 2534
359 nmdc:mga05p37_32330_c1 3300050507 Bacteria 6398
360 nmdc:mga05p37_326960_c1 3300050507 Bacteria 1813
361 nmdc:mga05p37_37091_c2 3300050507 Bacteria 2377
362 nmdc:mga05p37_430379_c1 3300050507 Unclassified 1533
363 nmdc:mga05p37_663227_c1 3300050507 Bacteria 1166
364 nmdc:mga05p37_68468_c1 3300050507 Bacteria 4365
365 nmdc:mga05p37_78218_c1 3300050507 Unclassified 4072
366 nmdc:mga09592_106098_c1 3300050508 Bacteria 2409
367 nmdc:mga09592_161173_c1 3300050508 Bacteria 1938
368 nmdc:mga09592_20416_c1 3300050508 Bacteria 5447
369 nmdc:mga0qj67_41703_c1 3300050509 Bacteria 3611
370 nmdc:mga0qj67_79762_c1 3300050509 Bacteria 2622
371 nmdc:mga0qj67_9704_c1 3300050509 Bacteria 7170
372 nmdc:mga06r32_153351_c1 3300050510 Unclassified 2283
373 nmdc:mga06r32_33709_c1 3300050510 Bacteria 4824
374 nmdc:mga06r32_497615_c1 3300050510 Unclassified 1196
375 nmdc:mga06r32_525744_c1 3300050510 Bacteria 1158
376 nmdc:mga06r32_66670_c1 3300050510 Unclassified 3474
377 nmdc:mga06r32_86434_c1 3300050510 Bacteria 3058
378 nmdc:mga08y16_125746_c1 3300050511 Bacteria 2667
379 nmdc:mga08y16_190970_c1 3300050511 Bacteria 2124
380 nmdc:mga08y16_414089_c1 3300050511 Bacteria 1378
381 nmdc:mga08y16_4202_c1 3300050511 Bacteria 15033
382 nmdc:mga08y16_622_c1 3300050511 Bacteria 33116
383 nmdc:mga08y16_72503_c1 3300050511 Bacteria 3588
384 nmdc:mga0rr50_186199_c1 3300050513 Bacteria 1699
385 nmdc:mga0rr50_316128_c1 3300050513 Bacteria 1308
386 nmdc:mga0rr50_403052_c1 3300050513 Bacteria 1155
387 nmdc:mga0a205_127105_c1 3300050515 Bacteria 2449
388 nmdc:mga0a205_302663_c1 3300050515 Bacteria 1472
389 nmdc:mga0a205_382087_c1 3300050515 Bacteria 1273
390 Ga0495595_0201292 3300053084 Unclassified 991
391 Ga0495619_0004191 3300053085 Bacteria 9201
392 Ga0495619_0066406 3300053085 Bacteria 2407
393 Ga0501084_0085653 3300054114 Unclassified 2646
394 Ga0501084_0542825 3300054114 Unclassified 982
395 Ga0590071_000611 3300059421 Bacteria 10243
396 Ga0590074_003161 3300059423 Unclassified 2714
397 Ga0590075_000067 3300059424 Bacteria 25816
398 Ga0590077_001084 3300059426 Bacteria 6741
399 Ga0501082_0424320 3300060353 Unclassified 1161
400 Ga0530510_0030337 3300061734 Bacteria 3884
401 Ga0495600_0056524
402 Ga0065712_10002498
403 Ga0065712_10071943
404 Ga0065712_10077272
405 Ga0065712_10086573
406 Ga0065715_10029950
407 Ga0065715_10109026
408 Ga0065715_10152746
409 Ga0065715_10215697
410 Ga0065707_10149529
411 Ga0070658_10076105
412 Ga0070676_10063091
413 Ga0070690_100024298
414 Ga0070690_100025568
415 Ga0070690_100130646
416 Ga0070670_100007317
417 Ga0070670_100038722
418 Ga0068869_100310757
419 Ga0070666_10352014
420 Ga0068868_100256990
421 Ga0070689_100050010
422 Ga0070689_100062984
423 Ga0070689_100215249
424 Ga0070689_100326634
425 Ga0070689_100570298
426 Ga0070691_10151324
427 Ga0070687_100001021
428 Ga0070687_100313779
429 Ga0070669_100012781
430 Ga0070675_100009417
431 Ga0070675_100194173
432 Ga0070671_100015492
433 Ga0070671_100020192
434 Ga0070674_100022000
435 Ga0070674_100305861
436 Ga0070673_100025674
437 Ga0070688_100203013
438 Ga0070659_100487729
439 Ga0070667_100041865
440 Ga0070703_10063401
441 Ga0070713_100066228
442 Ga0070711_100015306
443 Ga0070700_100274472
444 Ga0070694_100006531
445 Ga0070678_100293239
446 Ga0070678_100363257
447 Ga0070685_10014320
448 Ga0070707_100090277
449 Ga0070699_100026823
450 Ga0070672_100007256
451 Ga0070672_100097499
452 Ga0070672_100229381
453 Ga0070686_100000416
454 Ga0070686_100073128
455 Ga0070686_100128331
456 Ga0070695_100008777
457 Ga0070696_100013291
458 Ga0070696_100014444
459 Ga0070696_100016300
460 Ga0070665_100009511
461 Ga0070665_100313293
462 Ga0070704_100074598
463 Ga0070704_100142168
464 Ga0068854_100026733
465 Ga0070702_100107685
466 Ga0068852_100128589
467 Ga0068852_100464559
468 Ga0068859_100246625
469 Ga0068859_100311572
470 Ga0068859_100727783
471 Ga0068859_100845265
472 Ga0068864_100527508
473 Ga0068861_100113068
474 Ga0068861_100322554
475 Ga0068861_100532153
476 Ga0068851_10170194
477 Ga0068863_100047824
478 Ga0068863_100204768
479 Ga0068858_100048295
480 Ga0068858_100361074
481 Ga0068858_100392876
482 Ga0068860_100029355
483 Ga0068860_100400724
484 Ga0068862_100161772
485 Ga0068862_100340656
486 Ga0081455_10050449
487 Ga0081538_10142605
488 Ga0070717_10042462
489 Ga0075368_10013191
490 Ga0075364_10023561
491 Ga0075367_10003105
492 Ga0097621_100004762
493 Ga0097621_100013139
494 Ga0075370_10028722
495 Ga0068871_100000687
496 Ga0068871_100004515
497 Ga0068871_100005904
498 Ga0075428_100021268
499 Ga0075428_100036168
500 Ga0075428_100289182
501 Ga0075428_100290295
502 Ga0075428_100427060
503 Ga0075430_100008965
504 Ga0075430_100042483
505 Ga0075430_100096587
506 Ga0075430_100145590
507 Ga0075431_100019876
508 Ga0075431_100031779
509 Ga0075431_100257840
510 Ga0075431_100583606
511 Ga0075431_100590678
512 Ga0075433_10017793
513 Ga0075433_10019458
514 Ga0075433_10153071
515 Ga0075434_100013873
516 Ga0075434_100088692
517 Ga0075434_100366399
518 Ga0075429_100004449
519 Ga0075429_100040627
520 Ga0075429_100057773
521 Ga0075429_100101829
522 Ga0068865_100001754
523 Ga0068865_100006608
524 Ga0068865_100159890
525 Ga0097620_100246617
526 Ga0097620_100311554
527 Ga0097620_100727868
528 Ga0097620_100845302
529 Ga0075435_100008645
530 Ga0105240_10100751
531 Ga0111539_10000702
532 Ga0111539_10001367
533 Ga0111539_10007550
534 Ga0111539_10048490
535 Ga0111539_10073471
536 Ga0111539_10074992
537 Ga0105245_10128375
538 Ga0105245_10145280
539 Ga0105245_10326172
540 Ga0114129_10023721
541 Ga0114129_10025374
542 Ga0114129_10038025
543 Ga0114129_10045636
544 Ga0114129_10068459
545 Ga0114129_10080026
546 Ga0114129_10095177
547 Ga0114129_10096017
548 Ga0114129_10170790
549 Ga0114129_10475205
550 Ga0105243_10026300
551 Ga0105241_10182619
552 Ga0105241_10239605
553 Ga0105242_10383935
554 Ga0105242_10681479
555 Ga0105248_10018525
556 Ga0105248_10024746
557 Ga0105248_10046756
558 Ga0105248_10089069
559 Ga0105248_10110758
560 Ga0105248_10125394
561 Ga0105248_10176640
562 Ga0105249_10111084
563 Ga0105239_10187570
564 Ga0157378_10028821
565 Ga0157378_10140841
566 Ga0157378_10749248
567 Ga0163162_10025829
568 Ga0163162_10501124
569 Ga0163162_10507011
570 Ga0157375_10064667
571 Ga0157375_10349969
572 Ga0163163_10000048
573 Ga0163163_10037369
574 Ga0157380_10005731
575 Ga0157380_10128220
576 Ga0157380_10150532
577 Ga0157380_10281805
578 Ga0157380_10446859
579 Ga0157379_10151909
580 Ga0157379_10261510
581 Ga0157376_10000975
582 Ga0157376_10177730
583 Ga0157376_10313742
584 Ga0163161_10051569
585 Ga0207697_10081820
586 Ga0207653_10101991
587 Ga0207688_10029401
588 Ga0207688_10070846
589 Ga0207680_10008374
590 Ga0207680_10074548
591 Ga0207654_10119009
592 Ga0207662_10003171
593 Ga0207662_10012474
594 Ga0207649_10093590
595 Ga0207646_10189875
596 Ga0207681_10010529
597 Ga0207650_10006413
598 Ga0207659_10012832
599 Ga0207659_10115496
600 Ga0207659_10454258
601 Ga0207700_10311263
602 Ga0207644_10267779
603 Ga0207706_10073672
604 Ga0207686_10008822
605 Ga0207686_10045421
606 Ga0207709_10064281
607 Ga0207670_10192905
608 Ga0207704_10005457
609 Ga0207704_10009140
610 Ga0207704_10131256
611 Ga0207691_10022789
612 Ga0207691_10022879
613 Ga0207691_10041990
614 Ga0207691_10045881
615 Ga0207691_10109421
616 Ga0207691_10145480
617 Ga0207691_10153058
618 Ga0207691_10223669
619 Ga0207711_10011717
620 Ga0207711_10016857
621 Ga0207711_10062467
622 Ga0207711_10062548
623 Ga0207711_10070412
624 Ga0207711_10302740
625 Ga0207711_10355129
626 Ga0207651_10040070
627 Ga0207651_10079274
628 Ga0207651_10245348
629 Ga0207712_10024333
630 Ga0207668_10223723
631 Ga0207640_10024043
632 Ga0207658_10244277
633 Ga0207703_10065377
634 Ga0207703_10066836
635 Ga0207703_10257118
636 Ga0207678_10163731
637 Ga0207708_10010517
638 Ga0207708_10015216
639 Ga0207708_10163895
640 Ga0207708_10374921
641 Ga0207641_10003710
642 Ga0207641_10326220
643 Ga0207648_10167384
644 Ga0207676_10236401
645 Ga0207676_10301201
646 Ga0207675_100028171
647 Ga0207675_100219457
648 Ga0207675_100370321
649 Ga0207683_10087840
650 Ga0207698_10101693
651 Ga0207428_10000395
652 Ga0207428_10002423
653 Ga0207428_10003862
654 Ga0207428_10390310
655 Ga0268266_10009887
656 Ga0268265_10386100
657 Ga0268264_10036902
658 Ga0268264_10234496
659 Ga0265338_10086277
660 Ga0265338_10161091
661 Ga0265338_10243449
662 Ga0265339_10009757
663 Ga0265316_10141583
664 Ga0307408_100021708
665 Ga0307408_100023278
666 Ga0265314_10000020
667 Ga0307410_10037609
668 Ga0307410_10326914
669 Ga0307412_10207664
670 Ga0307412_10446082
671 Ga0307409_100012880
672 Ga0307409_100129019
673 Ga0307409_100442002
674 Ga0307416_100036452
675 Ga0307416_100061302
676 Ga0307411_10509630
677 Ga0373944_0073053
678 Ga0373932_0049977
679 Ga0373936_0082446
680 Ga0373941_0031533
681 Ga0373941_0032042
682 Ga0373924_0006490
683 Ga0373935_0055583
684 Ga0373947_0067951
685 Ga0373937_0025857
686 Ga0373925_0011349
687 Ga0395905_0660541
688 Ga0439433_0018773
689 Ga0439449_0077890
690 Ga0439446_0006119
691 Ga0451577_0024130
692 Ga0453684_0052169
693 Ga0495592_0057174
694 Ga0495592_0133801
695 Ga0495580_0033913
696 Ga0495639_0028606
697 Ga0495639_0087721
698 Ga0495608_0004948
699 Ga0495628_0110474
700 Ga0495628_0124705
701 Ga0495630_0013161
702 Ga0495630_0202539
703 Ga0495665_0116621
704 Ga0495640_0252906
705 Ga0495587_0110888
706 Ga0495621_0094267
707 Ga0495645_0001717
708 Ga0495667_0052287
709 Ga0495635_0060461
710 Ga0495599_0084239
711 Ga0495647_0116706
712 Ga0495658_0050416
713 Ga0495613_0002935
714 Ga0495581_0184143
715 Ga0495604_0032282
716 Ga0495636_0108227
717 Ga0495674_0066023
718 Ga0495680_0070574
719 Ga0495680_0312595
720 Ga0495675_0034509
721 Ga0495684_0008920
722 Ga0495684_0045109
723 Ga0496103_0186660
724 Ga0496104_0210435
725 Ga0496105_0363017
726 Ga0496107_0046596
727 Ga0496109_0462778
728 Ga0496110_0227969
729 Ga0496110_0481931
730 Ga0496112_0074435
731 Ga0496112_0267827
732 Ga0496113_0161090
733 Ga0501034_0007874
734 Ga0501038_0107378
735 Ga0501040_0056007
736 Ga0501040_0060181
737 Ga0501041_0286771
738 Ga0501042_0424123
739 Ga0501068_0108324
740 Ga0501068_0157446
741 Ga0501071_0381184
742 Ga0501072_0141664
743 Ga0501073_0025892
744 Ga0501073_0089984
745 Ga0501075_0071986
746 Ga0501076_0056990
747 Ga0501079_0063913
748 Ga0501079_0086592
749 Ga0501079_0110789
750 Ga0501080_0231491
751 Ga0501081_0122396
752 Ga0501081_0340261
753 nmdc:mga03n38_69810_c1
754 nmdc:mga0yw44_11323_c1
755 nmdc:mga06z11_44908_c1
756 nmdc:mga05p37_1443_c1
757 nmdc:mga05p37_156484_c1
758 nmdc:mga05p37_184909_c1
759 nmdc:mga05p37_32330_c1
760 nmdc:mga05p37_326960_c1
761 nmdc:mga05p37_37091_c2
762 nmdc:mga05p37_430379_c1
763 nmdc:mga05p37_663227_c1
764 nmdc:mga05p37_68468_c1
765 nmdc:mga05p37_78218_c1
766 nmdc:mga09592_106098_c1
767 nmdc:mga09592_161173_c1
768 nmdc:mga09592_20416_c1
769 nmdc:mga0qj67_41703_c1
770 nmdc:mga0qj67_79762_c1
771 nmdc:mga0qj67_9704_c1
772 nmdc:mga06r32_153351_c1
773 nmdc:mga06r32_33709_c1
774 nmdc:mga06r32_497615_c1
775 nmdc:mga06r32_525744_c1
776 nmdc:mga06r32_66670_c1
777 nmdc:mga06r32_86434_c1
778 nmdc:mga08y16_125746_c1
779 nmdc:mga08y16_190970_c1
780 nmdc:mga08y16_414089_c1
781 nmdc:mga08y16_4202_c1
782 nmdc:mga08y16_622_c1
783 nmdc:mga08y16_72503_c1
784 nmdc:mga0rr50_186199_c1
785 nmdc:mga0rr50_316128_c1
786 nmdc:mga0rr50_403052_c1
787 nmdc:mga0a205_127105_c1
788 nmdc:mga0a205_302663_c1
789 nmdc:mga0a205_382087_c1
790 Ga0495595_0201292
791 Ga0495619_0004191
792 Ga0495619_0066406
793 Ga0501084_0085653
794 Ga0501084_0542825
795 Ga0590071_000611
796 Ga0590074_003161
797 Ga0590075_000067
798 Ga0590077_001084
799 Ga0501082_0424320
800 Ga0530510_0030337

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02401

LYTB

LytB protein

3

274

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4n7b-assembly1.cif.gz_A structure of the e-1-hydroxy-2-methyl-but-2-enyl-4-diphosphate reductase from plasmodium falciparum 0.9389 2 271
3ke8-assembly1.cif.gz_B crystal structure of isph:hmbpp-complex 0.9347 1 277
3szu-assembly1.cif.gz_A isph:hmbpp complex structure of e126q mutant 0.9288 1 276
3t0g-assembly1.cif.gz_A isph:hmbpp (substrate) structure of the t167c mutant 0.9274 1 276
3t0f-assembly1.cif.gz_A isph:hmbpp (substrate) structure of the e126d mutant 0.9128 1 276
ID Description Score Start End Superfamily
3dnfA01 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;4-hydroxy-3-methylbut-2-enyl diphosphate reductase, catalytic domain 0.9887 193 275 3.40.1010.20
af_P62623_198_298_3.40.1010.20 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;4-hydroxy-3-methylbut-2-enyl diphosphate reductase, catalytic domain 0.9657 194 277 3.40.1010.20
af_P9WKG1_221_305_3.40.1010.20 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;4-hydroxy-3-methylbut-2-enyl diphosphate reductase, catalytic domain 0.965 192 272 3.40.1010.20
3f7tA01 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;4-hydroxy-3-methylbut-2-enyl diphosphate reductase, catalytic domain 0.9617 194 277 3.40.1010.20
4n7bA01 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;4-hydroxy-3-methylbut-2-enyl diphosphate reductase, catalytic domain 0.9493 194 271 3.40.1010.20
ID Description Score Start End GO Terms
AF-A0A7Y4VFA2-F1-model_v4 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) (EC 1.17.7.4) 0.9929 1 276 GO:0016114
GO:0019288
GO:0046872
GO:0050992
GO:0051539
GO:0051745
AF-A0A848A2W7-F1-model_v4 deleted 0.9917 1 282
AF-A0A059XCA3-F1-model_v4 LytB protein 0.9916 43 218 GO:0019288
GO:0046872
GO:0050992
GO:0051539
GO:0051745
AF-A0A3C0DRR9-F1-model_v4 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) (EC 1.17.7.4) 0.9845 1 292 GO:0016114
GO:0019288
GO:0046872
GO:0050992
GO:0051539
GO:0051745
AF-A0A7V6EC17-F1-model_v4 4-hydroxy-3-methylbut-2-enyl diphosphate reductase 0.9836 194 276 GO:0019288
GO:0046872
GO:0050992
GO:0051539
GO:0051745

Map