F434665

General Info

Members Datasets Scaffolds Average Seq Length
400 273 400 121

Family's Representative Sequence

Representative Sequence 3300046558|Ga0495633_0145288|Ga0495633_0145288_157_597
Length 146
Sequence MANPAESPRDRAATAAGQRTRHITKEIPMSYVDGFVLPVPQERLAEYRRMARKAGAVWKDHGALAYLEAVADDVKPGKHTSFPQAVKLKENEVVIFAYIVYRSRAHRDRVNAKAMADPRLAGMDTKTMPFDGKRMFWGGFKPFIDL

Samples

Sample ID Description Type Environment
1 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
85 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
111 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
114 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
115 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
116 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
119 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
121 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
124 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
150 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
164 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
168 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
169 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
170 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
171 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
172 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
175 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
176 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
177 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
178 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
181 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
184 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
185 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
186 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
187 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
188 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
189 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
192 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
193 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
194 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
195 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
196 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
197 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
198 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
199 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
200 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
201 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
202 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
203 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
204 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
205 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
206 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
207 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
208 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
209 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
210 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
211 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
212 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
213 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
214 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
215 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
216 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
217 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
218 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
219 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
236 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
237 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
238 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
239 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
240 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
241 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
242 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
243 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
244 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
245 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
246 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
252 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
253 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
254 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
255 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
256 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
257 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
258 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
259 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
260 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
261 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
262 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
266 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
267 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
268 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
269 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
270 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
271 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
272 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0.5
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18
Nodule 0.5
Rhizoplane 7
Rhizosphere 70.25
Stem 0
Stem Tuber 0
Unclassified 4.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10047169 3300002075 Bacteria 877
2 JGI25152J39213_1001499 3300002773 Bacteria 9946
3 JGI25150J39212_1000981 3300002774 Bacteria 8980
4 JGI25150J39212_1008469 3300002774 Bacteria 2009
5 JGI25159J45721_1004238 3300002987 Bacteria 4830
6 JGI25159J45721_1033588 3300002987 Bacteria 801
7 JGI25153J46596_10035733 3300003215 Bacteria 1605
8 rootL2_10112024 3300003322 Bacteria 1977
9 rootH1_10038810 3300003323 Bacteria 13711
10 JGI25160J50197_1028884 3300003354 Bacteria 1479
11 JGI25161J50226_1003401 3300003374 Bacteria 3654
12 Ga0055526_1010124 3300003771 Bacteria 4426
13 Ga0055537_1009178 3300003773 Bacteria 2208
14 Ga0055537_1009248 3300003773 Bacteria 2193
15 Ga0055524_1002064 3300003775 Bacteria 10667
16 Ga0055524_1015441 3300003775 Bacteria 2783
17 Ga0055534_1005784 3300003784 Bacteria 3238
18 Ga0055530_10006643 3300003791 Bacteria 5105
19 Ga0055530_10062396 3300003791 Bacteria 827
20 Ga0055540_1028480 3300003792 Bacteria 1321
21 Ga0055531_10013872 3300003794 Bacteria 3680
22 Ga0055531_10014678 3300003794 Bacteria 3509
23 Ga0065165_1000045 3300005262 Bacteria 198887
24 Ga0065165_1028925 3300005262 Bacteria 1782
25 Ga0065165_1040458 3300005262 Bacteria 1390
26 Ga0065715_10022064 3300005293 Bacteria 2504
27 Ga0070658_10292185 3300005327 Bacteria 1389
28 Ga0070676_10055689 3300005328 Bacteria 2334
29 Ga0070690_100148866 3300005330 Bacteria 1595
30 Ga0070690_100738416 3300005330 Bacteria 759
31 Ga0070670_100000274 3300005331 Bacteria 45804
32 Ga0070670_100221042 3300005331 Bacteria 1648
33 Ga0070670_100562856 3300005331 Bacteria 1018
34 Ga0070677_10160896 3300005333 Bacteria 1053
35 Ga0070677_10843581 3300005333 Unclassified 526
36 Ga0068869_100001694 3300005334 Bacteria 13168
37 Ga0070666_11042087 3300005335 Bacteria 607
38 Ga0070680_101942221 3300005336 Bacteria 510
39 Ga0068868_100037134 3300005338 Bacteria 3775
40 Ga0068868_100056621 3300005338 Bacteria 3096
41 Ga0070660_100749280 3300005339 Bacteria 820
42 Ga0070689_100248077 3300005340 Bacteria 1468
43 Ga0070689_100791974 3300005340 Bacteria 833
44 Ga0070661_100377329 3300005344 Bacteria 1117
45 Ga0070668_100060705 3300005347 Bacteria 2928
46 Ga0070668_100129984 3300005347 Bacteria 2021
47 Ga0070669_100005562 3300005353 Bacteria 9102
48 Ga0070669_100970280 3300005353 Bacteria 728
49 Ga0070675_100097983 3300005354 Bacteria 2466
50 Ga0070673_100106494 3300005364 Bacteria 2318
51 Ga0070673_101082709 3300005364 Bacteria 748
52 Ga0070688_100225341 3300005365 Bacteria 1323
53 Ga0070688_100897703 3300005365 Bacteria 699
54 Ga0070667_100002746 3300005367 Bacteria 15229
55 Ga0070667_100047816 3300005367 Bacteria 3600
56 Ga0070667_100680336 3300005367 Bacteria 951
57 Ga0070701_10397728 3300005438 Bacteria 872
58 Ga0070705_101040285 3300005440 Unclassified 667
59 Ga0070700_100431690 3300005441 Bacteria 998
60 Ga0070708_100004480 3300005445 Archaea 10984
61 Ga0070663_100326808 3300005455 Bacteria 1235
62 Ga0070663_100512914 3300005455 Bacteria 997
63 Ga0070678_100935988 3300005456 Bacteria 794
64 Ga0070662_101074948 3300005457 Bacteria 690
65 Ga0070662_101365090 3300005457 Bacteria 610
66 Ga0068867_100001239 3300005459 Bacteria 17579
67 Ga0070706_101588699 3300005467 Bacteria 597
68 Ga0070699_100081123 3300005518 Archaea 2827
69 Ga0070697_100069872 3300005536 Bacteria 2878
70 Ga0068853_100200891 3300005539 Bacteria 1814
71 Ga0068853_100440773 3300005539 Bacteria 1224
72 Ga0068853_100651221 3300005539 Bacteria 1003
73 Ga0070672_101390110 3300005543 Unclassified 628
74 Ga0070672_101669964 3300005543 Unclassified 572
75 Ga0070686_100334426 3300005544 Bacteria 1133
76 Ga0070686_101343820 3300005544 Bacteria 598
77 Ga0070695_100152688 3300005545 Bacteria 1613
78 Ga0070695_100200114 3300005545 Bacteria 1427
79 Ga0070695_101640823 3300005545 Bacteria 537
80 Ga0070696_100030023 3300005546 Bacteria 3719
81 Ga0070696_100272926 3300005546 Archaea 1286
82 Ga0070693_100576158 3300005547 Bacteria 809
83 Ga0070665_100327858 3300005548 Bacteria 1535
84 Ga0070665_101955975 3300005548 Bacteria 592
85 Ga0070704_100013958 3300005549 Bacteria 5005
86 Ga0070704_100111704 3300005549 Bacteria 2081
87 Ga0070704_101054273 3300005549 Bacteria 737
88 Ga0068855_100727080 3300005563 Bacteria 1060
89 Ga0070664_100064195 3300005564 Bacteria 3132
90 Ga0068857_100006394 3300005577 Bacteria 10097
91 Ga0068854_100115630 3300005578 Bacteria 2030
92 Ga0068854_100691875 3300005578 Bacteria 879
93 Ga0068859_100006523 3300005617 Bacteria 11850
94 Ga0068859_100176367 3300005617 Bacteria 2219
95 Ga0068859_102143204 3300005617 Bacteria 617
96 Ga0068859_103133137 3300005617 Unclassified 504
97 Ga0068864_100005598 3300005618 Bacteria 10299
98 Ga0068864_100240371 3300005618 Bacteria 1678
99 Ga0068866_10183255 3300005718 Bacteria 1238
100 Ga0068861_100133186 3300005719 Bacteria 2020
101 Ga0068861_100164981 3300005719 Bacteria 1831
102 Ga0068861_100256099 3300005719 Bacteria 1496
103 Ga0068861_100626149 3300005719 Bacteria 991
104 Ga0068870_10016023 3300005840 Bacteria 3572
105 Ga0068863_100002100 3300005841 Bacteria 19742
106 Ga0068863_100956570 3300005841 Bacteria 858
107 Ga0068858_100091440 3300005842 Bacteria 2832
108 Ga0068858_100315261 3300005842 Bacteria 1494
109 Ga0068860_100161972 3300005843 Bacteria 2157
110 Ga0068860_101012018 3300005843 Bacteria 849
111 Ga0068860_101147330 3300005843 Bacteria 797
112 Ga0068862_100013014 3300005844 Bacteria 6880
113 Ga0068862_100084666 3300005844 Bacteria 2755
114 Ga0068862_100088989 3300005844 Bacteria 2687
115 Ga0075365_10023735 3300006038 Bacteria 3860
116 Ga0075365_11058153 3300006038 Bacteria 571
117 Ga0075365_11085710 3300006038 Bacteria 563
118 Ga0075368_10009174 3300006042 Bacteria 3554
119 Ga0075368_10039480 3300006042 Bacteria 1850
120 Ga0075363_100047944 3300006048 Bacteria 2270
121 Ga0075363_100095772 3300006048 Bacteria 1638
122 Ga0075364_10094551 3300006051 Bacteria 1986
123 Ga0075364_10263990 3300006051 Bacteria 1170
124 Ga0070716_101131498 3300006173 Bacteria 626
125 Ga0075362_10087041 3300006177 Bacteria 1446
126 Ga0075367_10006983 3300006178 Bacteria 5750
127 Ga0075366_10680974 3300006195 Bacteria 638
128 Ga0097621_100785754 3300006237 Bacteria 881
129 Ga0097621_101934689 3300006237 Bacteria 563
130 Ga0075370_10019828 3300006353 Bacteria 3665
131 Ga0068871_100670379 3300006358 Bacteria 948
132 Ga0068871_102288275 3300006358 Bacteria 515
133 Ga0075433_10457875 3300006852 Bacteria 1124
134 Ga0075434_100796874 3300006871 Bacteria 961
135 Ga0068865_100263290 3300006881 Bacteria 1366
136 Ga0097620_100006521 3300006931 Bacteria 11850
137 Ga0097620_100176362 3300006931 Bacteria 2219
138 Ga0097620_102143127 3300006931 Bacteria 617
139 Ga0097620_103133209 3300006931 Unclassified 504
140 Ga0079104_1009999 3300006946 Bacteria 3162
141 Ga0105251_10002849 3300009011 Bacteria 13064
142 Ga0105240_10201458 3300009093 Bacteria 2332
143 Ga0111539_11663453 3300009094 Bacteria 740
144 Ga0105245_10012285 3300009098 Bacteria 7451
145 Ga0105245_10907929 3300009098 Bacteria 923
146 Ga0105247_10272350 3300009101 Bacteria 1165
147 Ga0105243_10091886 3300009148 Bacteria 2501
148 Ga0105243_11408702 3300009148 Bacteria 718
149 Ga0105241_10070792 3300009174 Bacteria 2707
150 Ga0105241_11597930 3300009174 Bacteria 630
151 Ga0105242_10099041 3300009176 Bacteria 2467
152 Ga0105242_10162396 3300009176 Bacteria 1957
153 Ga0105242_12943510 3300009176 Bacteria 527
154 Ga0105248_10015240 3300009177 Bacteria 8473
155 Ga0105248_10057304 3300009177 Bacteria 4373
156 Ga0105248_13254573 3300009177 Bacteria 517
157 Ga0105237_10715279 3300009545 Bacteria 1008
158 Ga0105238_10083993 3300009551 Bacteria 3173
159 Ga0105238_10086435 3300009551 Bacteria 3124
160 Ga0105238_10251523 3300009551 Bacteria 1746
161 Ga0105238_11058016 3300009551 Bacteria 833
162 Ga0105249_10011311 3300009553 Bacteria 7833
163 Ga0105249_10236720 3300009553 Bacteria 1803
164 Ga0105249_10667275 3300009553 Bacteria 1098
165 Ga0105249_11378698 3300009553 Bacteria 777
166 Ga0105239_10263070 3300010375 Bacteria 1939
167 Ga0105239_11548386 3300010375 Bacteria 766
168 Ga0105246_10116161 3300011119 Bacteria 1975
169 Ga0157373_10620938 3300013100 Bacteria 788
170 Ga0157370_11944960 3300013104 Unclassified 527
171 Ga0157369_10124452 3300013105 Bacteria 2734
172 Ga0157378_10038343 3300013297 Bacteria 4247
173 Ga0157378_10206622 3300013297 Bacteria 1860
174 Ga0157378_10787386 3300013297 Bacteria 976
175 Ga0163162_10110266 3300013306 Bacteria 2849
176 Ga0163162_13038623 3300013306 Bacteria 539
177 Ga0157372_10976765 3300013307 Bacteria 981
178 Ga0157375_10499426 3300013308 Bacteria 1381
179 Ga0163163_10001190 3300014325 Bacteria 22057
180 Ga0163163_13110969 3300014325 Bacteria 517
181 Ga0157380_11838320 3300014326 Bacteria 665
182 Ga0157379_10000105 3300014968 Bacteria 57976
183 Ga0157379_10370110 3300014968 Bacteria 1314
184 Ga0157376_11114468 3300014969 Bacteria 815
185 Ga0182007_10037748 3300015262 Bacteria 1621
186 Ga0182005_1000006 3300015265 Bacteria 515188
187 Ga0163161_11520382 3300017792 Bacteria 588
188 Ga0209436_101209 3300025208 Bacteria 9409
189 Ga0207425_1000009 3300025245 Bacteria 593135
190 Ga0207425_1000516 3300025245 Bacteria 23590
191 Ga0209129_1000051 3300025258 Bacteria 267104
192 Ga0209129_1004010 3300025258 Bacteria 6040
193 Ga0209565_1010986 3300025263 Bacteria 2225
194 Ga0209565_1019386 3300025263 Bacteria 1454
195 Ga0209673_1045678 3300025273 Bacteria 1201
196 Ga0209130_1000043 3300025284 Bacteria 254257
197 Ga0209675_1008323 3300025291 Bacteria 3831
198 Ga0209758_1000054 3300025297 Bacteria 337655
199 Ga0209050_1000040 3300025298 Bacteria 408492
200 Ga0209050_1015091 3300025298 Bacteria 3273
201 Ga0209256_1000392 3300025299 Bacteria 69623
202 Ga0209256_1006982 3300025299 Bacteria 5745
203 Ga0207426_1003734 3300025302 Bacteria 7949
204 Ga0207426_1004271 3300025302 Bacteria 7079
205 Ga0209051_1019014 3300025303 Bacteria 3015
206 Ga0209257_1000054 3300025304 Bacteria 416957
207 Ga0209257_1009076 3300025304 Bacteria 5438
208 Ga0207713_1009586 3300025735 Bacteria 5442
209 Ga0207647_10079442 3300025904 Bacteria 1969
210 Ga0207705_10640516 3300025909 Bacteria 826
211 Ga0207654_10191937 3300025911 Bacteria 1339
212 Ga0207695_10575031 3300025913 Bacteria 1008
213 Ga0207695_10936997 3300025913 Bacteria 746
214 Ga0207671_10190372 3300025914 Bacteria 1600
215 Ga0207681_10087044 3300025923 Bacteria 2222
216 Ga0207681_11551124 3300025923 Bacteria 555
217 Ga0207694_10264071 3300025924 Bacteria 1411
218 Ga0207694_10719093 3300025924 Bacteria 842
219 Ga0207650_10995027 3300025925 Bacteria 713
220 Ga0207659_10828677 3300025926 Bacteria 795
221 Ga0207659_11699220 3300025926 Bacteria 538
222 Ga0207687_10068731 3300025927 Bacteria 2524
223 Ga0207664_10040628 3300025929 Bacteria 3619
224 Ga0207686_10109838 3300025934 Bacteria 1858
225 Ga0207686_10229966 3300025934 Bacteria 1344
226 Ga0207709_10394289 3300025935 Bacteria 1057
227 Ga0207711_10121890 3300025941 Bacteria 2329
228 Ga0207651_10255160 3300025960 Bacteria 1437
229 Ga0207651_10338283 3300025960 Bacteria 1264
230 Ga0207712_10044469 3300025961 Bacteria 3069
231 Ga0207712_10398377 3300025961 Unclassified 1156
232 Ga0207658_10290470 3300025986 Bacteria 1405
233 Ga0207658_10461505 3300025986 Bacteria 1126
234 Ga0207677_10182093 3300026023 Bacteria 1654
235 Ga0207639_10664723 3300026041 Bacteria 965
236 Ga0207708_11332371 3300026075 Bacteria 629
237 Ga0207641_11102624 3300026088 Bacteria 792
238 Ga0207676_10084202 3300026095 Bacteria 2592
239 Ga0209281_1002034 3300027111 Bacteria 9137
240 Ga0209974_10044442 3300027876 Bacteria 1482
241 Ga0268265_10065332 3300028380 Bacteria 2807
242 Ga0268264_10965199 3300028381 Bacteria 858
243 Ga0307509_10233269 3300031507 Bacteria 1641
244 Ga0307408_100004165 3300031548 Bacteria 9853
245 Ga0307408_100004198 3300031548 Bacteria 9816
246 Ga0307408_100006097 3300031548 Bacteria 8017
247 Ga0307408_100026804 3300031548 Bacteria 3964
248 Ga0307408_100043655 3300031548 Bacteria 3191
249 Ga0307408_101110750 3300031548 Bacteria 734
250 Ga0307408_101824599 3300031548 Bacteria 582
251 Ga0307406_10047597 3300031901 Bacteria 2703
252 Ga0307407_10721014 3300031903 Bacteria 753
253 Ga0307412_11452239 3300031911 Bacteria 622
254 Ga0307409_101230004 3300031995 Bacteria 773
255 Ga0307416_100004954 3300032002 Bacteria 8115
256 Ga0307416_100114195 3300032002 Bacteria 2389
257 Ga0307416_100659394 3300032002 Bacteria 1132
258 Ga0307416_102810201 3300032002 Bacteria 582
259 Ga0307414_10411821 3300032004 Bacteria 1177
260 Ga0307411_11230153 3300032005 Bacteria 680
261 Ga0307415_102518140 3300032126 Bacteria 507
262 Ga0373950_0020849 3300034818 Bacteria 1155
263 Ga0373936_0443090 3300035113 Bacteria 600
264 Ga0373925_0821967 3300037068 Bacteria 766
265 Ga0395905_0001579 3300037471 Bacteria 27189
266 Ga0439436_0203835 3300041404 Bacteria 566
267 Ga0439439_0054551 3300041406 Bacteria 1053
268 Ga0439439_0085420 3300041406 Bacteria 857
269 Ga0451839_0278244 3300041496 Bacteria 636
270 Ga0439448_0262718 3300042005 Bacteria 610
271 Ga0439449_0210067 3300042007 Bacteria 729
272 Ga0439446_0000580 3300042156 Bacteria 7459
273 Ga0451577_0079343 3300042876 Bacteria 2926
274 Ga0466972_0001512 3300044658 Bacteria 11316
275 Ga0453683_0036124 3300044673 Bacteria 3111
276 Ga0466961_0188450 3300044693 Bacteria 1279
277 Ga0453684_0082669 3300044712 Bacteria 3999
278 Ga0466970_0102110 3300044765 Bacteria 1562
279 Ga0451576_0006902 3300045051 Bacteria 13748
280 Ga0451576_0065917 3300045051 Bacteria 3770
281 Ga0495627_000004 3300046453 Bacteria 640612
282 Ga0495590_0033721 3300046457 Bacteria 1789
283 Ga0495629_0007814 3300046459 Bacteria 7869
284 Ga0495638_0345622 3300046460 Bacteria 787
285 Ga0495653_0004634 3300046463 Bacteria 11118
286 Ga0495580_0839597 3300046472 Bacteria 594
287 Ga0495584_0030823 3300046491 Bacteria 2716
288 Ga0495596_0036127 3300046500 Bacteria 1958
289 Ga0495606_0034357 3300046507 Bacteria 3482
290 Ga0495616_0177444 3300046513 Bacteria 949
291 Ga0495630_0015094 3300046517 Bacteria 5636
292 Ga0495644_0129025 3300046523 Bacteria 963
293 Ga0495663_0001567 3300046525 Bacteria 7165
294 Ga0495642_0113100 3300046528 Bacteria 1162
295 Ga0495652_0038529 3300046529 Bacteria 4140
296 Ga0495665_0000313 3300046531 Bacteria 24673
297 Ga0495586_0448789 3300046535 Bacteria 743
298 Ga0495597_0006890 3300046542 Bacteria 5833
299 Ga0495633_0145288 3300046558 Bacteria 1096
300 Ga0495668_0066125 3300046616 Bacteria 1990
301 Ga0495668_0513170 3300046616 Bacteria 661
302 Ga0495634_0323402 3300046642 Bacteria 928
303 Ga0495635_0005093 3300046663 Bacteria 9138
304 Ga0495661_0280100 3300046665 Bacteria 841
305 Ga0495599_0142271 3300046678 Bacteria 1488
306 Ga0495623_0030281 3300046679 Bacteria 3481
307 Ga0495646_0015845 3300046680 Bacteria 4786
308 Ga0495669_0148174 3300046684 Bacteria 1110
309 Ga0495669_0483479 3300046684 Bacteria 602
310 Ga0495624_0037999 3300046690 Bacteria 3095
311 Ga0495649_0478477 3300046694 Bacteria 620
312 Ga0495600_0044787 3300046809 Bacteria 2886
313 Ga0495604_0058338 3300047317 Bacteria 2964
314 Ga0495674_0140482 3300047319 Bacteria 2030
315 Ga0495680_0015176 3300047322 Bacteria 6651
316 Ga0495683_0032138 3300047323 Bacteria 2673
317 Ga0495687_042810 3300047443 Bacteria 1976
318 Ga0495675_0061421 3300047444 Bacteria 2380
319 Ga0495675_0073873 3300047444 Bacteria 2150
320 Ga0495673_0180023 3300047469 Bacteria 801
321 Ga0495681_0005803 3300047470 Bacteria 8202
322 Ga0495593_0525624 3300047673 Bacteria 593
323 Ga0495602_0008064 3300048088 Bacteria 11008
324 Ga0496100_0020597 3300048903 Bacteria 3956
325 Ga0496100_0953859 3300048903 Bacteria 674
326 Ga0496101_0227692 3300048904 Bacteria 1448
327 Ga0496102_0239122 3300048905 Bacteria 1712
328 Ga0496102_1054542 3300048905 Bacteria 733
329 Ga0496103_0555635 3300048906 Bacteria 733
330 Ga0496104_0000771 3300048907 Bacteria 27410
331 Ga0496104_0029014 3300048907 Bacteria 5130
332 Ga0496104_0087398 3300048907 Bacteria 2977
333 Ga0496105_0012653 3300048908 Bacteria 6683
334 Ga0496105_0144464 3300048908 Bacteria 1957
335 Ga0496106_0007220 3300048909 Bacteria 8207
336 Ga0496106_1355998 3300048909 Bacteria 551
337 Ga0496107_0050611 3300048910 Bacteria 2995
338 Ga0496107_0416636 3300048910 Bacteria 999
339 Ga0496108_0001711 3300048911 Bacteria 17382
340 Ga0496108_0328343 3300048911 Bacteria 1334
341 Ga0496109_0007550 3300048912 Bacteria 9219
342 Ga0496109_0080652 3300048912 Bacteria 2998
343 Ga0496109_0629105 3300048912 Bacteria 1010
344 Ga0496110_0001734 3300048913 Bacteria 16069
345 Ga0496110_0003160 3300048913 Bacteria 12531
346 Ga0496111_0004499 3300048914 Bacteria 8820
347 Ga0496112_0015892 3300048915 Bacteria 7033
348 Ga0496112_0036562 3300048915 Bacteria 4790
349 Ga0496113_0008277 3300048916 Bacteria 6765
350 Ga0496113_0070939 3300048916 Bacteria 2649
351 Ga0496115_0200859 3300048918 Bacteria 1647
352 Ga0496116_0001914 3300048919 Bacteria 22410
353 Ga0496117_0001844 3300048920 Bacteria 28622
354 Ga0496118_0062439 3300048921 Bacteria 2750
355 Ga0496119_0025965 3300048922 Bacteria 4076
356 Ga0496119_0316863 3300048922 Bacteria 764
357 Ga0496121_0006340 3300048924 Bacteria 14745
358 Ga0496122_0024089 3300048925 Bacteria 5336
359 Ga0496123_0065587 3300048926 Bacteria 2306
360 Ga0496124_0035396 3300048927 Bacteria 4369
361 Ga0496124_0154746 3300048927 Bacteria 1794
362 Ga0496125_0012666 3300048928 Bacteria 8347
363 Ga0496126_0068872 3300048929 Bacteria 3158
364 Ga0496126_0338483 3300048929 Bacteria 1233
365 Ga0495678_149905 3300049459 Bacteria 754
366 Ga0495678_251692 3300049459 Bacteria 525
367 Ga0501034_0000383 3300049571 Bacteria 75632
368 Ga0501036_0984570 3300049572 Bacteria 691
369 Ga0501039_0009394 3300049575 Bacteria 7454
370 Ga0501040_0126062 3300049576 Bacteria 1799
371 Ga0501042_0428340 3300049578 Bacteria 959
372 Ga0501070_0027949 3300049586 Bacteria 4732
373 Ga0501077_0865295 3300049593 Bacteria 581
374 Ga0501257_050988 3300049686 Bacteria 1032
375 Ga0501234_024614 3300049707 Bacteria 965
376 Ga0501279_004312 3300049775 Bacteria 1865
377 Ga0501279_007694 3300049775 Bacteria 1430
378 Ga0501226_023625 3300049853 Bacteria 685
379 nmdc:mga03n38_157810_c1 3300050490 Bacteria 1147
380 nmdc:mga03n38_809395_c1 3300050490 Bacteria 546
381 nmdc:mga00v17_171337_c1 3300050491 Bacteria 1400
382 nmdc:mga00v17_520189_c1 3300050491 Bacteria 771
383 nmdc:mga0yw44_104789_c1 3300050492 Bacteria 1806
384 nmdc:mga0yw44_153019_c1 3300050492 Bacteria 1506
385 nmdc:mga0k408_22279_c1 3300050493 Bacteria 3567
386 nmdc:mga0k408_315734_c1 3300050493 Bacteria 932
387 nmdc:mga06z11_49962_c1 3300050494 Bacteria 2136
388 nmdc:mga06z11_920921_c1 3300050494 Bacteria 533
389 nmdc:mga07m45_41774_c1 3300050496 Bacteria 2569
390 nmdc:mga05p37_1400161_c1 3300050507 Bacteria 704
391 nmdc:mga0n895_421280_c1 3300050512 Bacteria 1349
392 nmdc:mga0a205_806595_c1 3300050515 Bacteria 786
393 Ga0500644_0089963 3300053088 Bacteria 1147
394 Ga0500641_0312491 3300053096 Bacteria 642
395 Ga0500555_002513 3300053103 Bacteria 5301
396 Ga0500616_0053547 3300053153 Bacteria 2117
397 Ga0500633_0139306 3300053160 Unclassified 908
398 Ga0500656_074552 3300053732 Unclassified 527
399 Ga0587088_118899 3300059508 Bacteria 609
400 Ga0587091_041979 3300059511 Bacteria 906

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046513 Ga0495616_0177444 Ga0495616_0177444_206_649 110
2 3300009551 Ga0105238_10086435 Ga0105238_100864351 113
3 3300013307 Ga0157372_10976765 Ga0157372_109767652 113
4 3300005331 Ga0070670_100562856 Ga0070670_1005628561 117
5 3300005333 Ga0070677_10843581 Ga0070677_108435811 117
6 3300005347 Ga0070668_100060705 Ga0070668_1000607053 117
7 3300005354 Ga0070675_100097983 Ga0070675_1000979832 117
8 3300005365 Ga0070688_100225341 Ga0070688_1002253413 117
9 3300005457 Ga0070662_101074948 Ga0070662_1010749481 117
10 3300005543 Ga0070672_101669964 Ga0070672_1016699641 117
11 3300005719 Ga0068861_100133186 Ga0068861_1001331863 117
12 3300005844 Ga0068862_100088989 Ga0068862_1000889893 117
13 3300009553 Ga0105249_10667275 Ga0105249_106672752 117
14 3300027876 Ga0209974_10044442 Ga0209974_100444423 117
15 3300003215 JGI25153J46596_10035733 JGI25153J46596_100357332 118
16 3300003792 Ga0055540_1028480 Ga0055540_10284803 118
17 3300005262 Ga0065165_1040458 Ga0065165_10404583 118
18 3300005293 Ga0065715_10022064 Ga0065715_100220642 118
19 3300005328 Ga0070676_10055689 Ga0070676_100556893 118
20 3300005330 Ga0070690_100738416 Ga0070690_1007384162 118
21 3300005331 Ga0070670_100000274 Ga0070670_1000002748 118
22 3300005331 Ga0070670_100221042 Ga0070670_1002210422 118
23 3300005333 Ga0070677_10160896 Ga0070677_101608962 118
24 3300005334 Ga0068869_100001694 Ga0068869_1000016945 118
25 3300005335 Ga0070666_11042087 Ga0070666_110420871 118
26 3300005336 Ga0070680_101942221 Ga0070680_1019422211 118
27 3300005338 Ga0068868_100037134 Ga0068868_1000371344 118
28 3300005340 Ga0070689_100248077 Ga0070689_1002480772 118
29 3300005344 Ga0070661_100377329 Ga0070661_1003773291 118
30 3300005347 Ga0070668_100129984 Ga0070668_1001299842 118
31 3300005353 Ga0070669_100005562 Ga0070669_1000055629 118
32 3300005364 Ga0070673_100106494 Ga0070673_1001064943 118
33 3300005367 Ga0070667_100002746 Ga0070667_1000027468 118
34 3300005438 Ga0070701_10397728 Ga0070701_103977281 118
35 3300005455 Ga0070663_100512914 Ga0070663_1005129142 118
36 3300005457 Ga0070662_101365090 Ga0070662_1013650902 118
37 3300005459 Ga0068867_100001239 Ga0068867_10000123920 118
38 3300005467 Ga0070706_101588699 Ga0070706_1015886991 118
39 3300005539 Ga0068853_100440773 Ga0068853_1004407732 118
40 3300005539 Ga0068853_100651221 Ga0068853_1006512211 118
41 3300005544 Ga0070686_100334426 Ga0070686_1003344262 118
42 3300005545 Ga0070695_101640823 Ga0070695_1016408231 118
43 3300005547 Ga0070693_100576158 Ga0070693_1005761582 118
44 3300005548 Ga0070665_101955975 Ga0070665_1019559752 118
45 3300005549 Ga0070704_100111704 Ga0070704_1001117044 118
46 3300005564 Ga0070664_100064195 Ga0070664_1000641955 118
47 3300005577 Ga0068857_100006394 Ga0068857_1000063945 118
48 3300005578 Ga0068854_100115630 Ga0068854_1001156303 118
49 3300005578 Ga0068854_100691875 Ga0068854_1006918752 118
50 3300005617 Ga0068859_100006523 Ga0068859_1000065238 118
51 3300005617 Ga0068859_102143204 Ga0068859_1021432042 118
52 3300005618 Ga0068864_100005598 Ga0068864_1000055988 118
53 3300005718 Ga0068866_10183255 Ga0068866_101832552 118
54 3300005719 Ga0068861_100256099 Ga0068861_1002560992 118
55 3300005719 Ga0068861_100626149 Ga0068861_1006261492 118
56 3300005840 Ga0068870_10016023 Ga0068870_100160233 118
57 3300005841 Ga0068863_100002100 Ga0068863_10000210012 118
58 3300005842 Ga0068858_100091440 Ga0068858_1000914402 118
59 3300005842 Ga0068858_100315261 Ga0068858_1003152612 118
60 3300005843 Ga0068860_100161972 Ga0068860_1001619722 118
61 3300005844 Ga0068862_100013014 Ga0068862_1000130142 118
62 3300006038 Ga0075365_10023735 Ga0075365_100237356 118
63 3300006042 Ga0075368_10039480 Ga0075368_100394801 118
64 3300006048 Ga0075363_100095772 Ga0075363_1000957723 118
65 3300006051 Ga0075364_10263990 Ga0075364_102639902 118
66 3300006178 Ga0075367_10006983 Ga0075367_100069837 118
67 3300006237 Ga0097621_101934689 Ga0097621_1019346892 118
68 3300006358 Ga0068871_102288275 Ga0068871_1022882751 118
69 3300006852 Ga0075433_10457875 Ga0075433_104578753 118
70 3300006881 Ga0068865_100263290 Ga0068865_1002632903 118
71 3300006931 Ga0097620_100006521 Ga0097620_1000065218 118
72 3300006931 Ga0097620_102143127 Ga0097620_1021431272 118
73 3300009101 Ga0105247_10272350 Ga0105247_102723502 118
74 3300009174 Ga0105241_11597930 Ga0105241_115979301 118
75 3300009177 Ga0105248_10015240 Ga0105248_100152408 118
76 3300009177 Ga0105248_13254573 Ga0105248_132545732 118
77 3300009551 Ga0105238_11058016 Ga0105238_110580161 118
78 3300009553 Ga0105249_10236720 Ga0105249_102367202 118
79 3300010375 Ga0105239_10263070 Ga0105239_102630702 118
80 3300011119 Ga0105246_10116161 Ga0105246_101161613 118
81 3300013297 Ga0157378_10206622 Ga0157378_102066224 118
82 3300013306 Ga0163162_10110266 Ga0163162_101102664 118
83 3300013308 Ga0157375_10499426 Ga0157375_104994263 118
84 3300014325 Ga0163163_10001190 Ga0163163_100011907 118
85 3300014968 Ga0157379_10000105 Ga0157379_100001055 118
86 3300044658 Ga0466972_0001512 Ga0466972_0001512_8194_8643 118
87 3300049571 Ga0501034_0000383 Ga0501034_0000383_23896_24387 118
88 3300049575 Ga0501039_0009394 Ga0501039_0009394_2997_3392 118
89 3300049576 Ga0501040_0126062 Ga0501040_0126062_1372_1767 118
90 3300049586 Ga0501070_0027949 Ga0501070_0027949_3482_3877 118
91 3300002773 JGI25152J39213_1001499 JGI25152J39213_10014998 119
92 3300002774 JGI25150J39212_1000981 JGI25150J39212_10009814 119
93 3300002774 JGI25150J39212_1008469 JGI25150J39212_10084692 119
94 3300002987 JGI25159J45721_1004238 JGI25159J45721_10042382 119
95 3300002987 JGI25159J45721_1033588 JGI25159J45721_10335882 119
96 3300003322 rootL2_10112024 rootL2_101120242 119
97 3300003374 JGI25161J50226_1003401 JGI25161J50226_10034012 119
98 3300003771 Ga0055526_1010124 Ga0055526_10101242 119
99 3300003773 Ga0055537_1009178 Ga0055537_10091782 119
100 3300003773 Ga0055537_1009248 Ga0055537_10092482 119
101 3300003775 Ga0055524_1002064 Ga0055524_10020647 119
102 3300003775 Ga0055524_1015441 Ga0055524_10154412 119
103 3300003784 Ga0055534_1005784 Ga0055534_10057844 119
104 3300003791 Ga0055530_10006643 Ga0055530_100066437 119
105 3300003791 Ga0055530_10062396 Ga0055530_100623962 119
106 3300003794 Ga0055531_10013872 Ga0055531_100138723 119
107 3300003794 Ga0055531_10014678 Ga0055531_100146782 119
108 3300005262 Ga0065165_1000045 Ga0065165_1000045165 119
109 3300005262 Ga0065165_1028925 Ga0065165_10289252 119
110 3300005330 Ga0070690_100148866 Ga0070690_1001488663 119
111 3300005338 Ga0068868_100056621 Ga0068868_1000566212 119
112 3300005353 Ga0070669_100970280 Ga0070669_1009702802 119
113 3300005364 Ga0070673_101082709 Ga0070673_1010827092 119
114 3300005367 Ga0070667_100047816 Ga0070667_1000478167 119
115 3300005367 Ga0070667_100680336 Ga0070667_1006803361 119
116 3300005440 Ga0070705_101040285 Ga0070705_1010402851 119
117 3300005445 Ga0070708_100004480 Ga0070708_10000448011 119
118 3300005518 Ga0070699_100081123 Ga0070699_1000811232 119
119 3300005539 Ga0068853_100200891 Ga0068853_1002008913 119
120 3300005544 Ga0070686_101343820 Ga0070686_1013438201 119
121 3300005545 Ga0070695_100152688 Ga0070695_1001526881 119
122 3300005545 Ga0070695_100200114 Ga0070695_1002001143 119
123 3300005546 Ga0070696_100030023 Ga0070696_1000300234 119
124 3300005546 Ga0070696_100272926 Ga0070696_1002729262 119
125 3300005549 Ga0070704_100013958 Ga0070704_1000139585 119
126 3300005549 Ga0070704_101054273 Ga0070704_1010542731 119
127 3300005563 Ga0068855_100727080 Ga0068855_1007270802 119
128 3300005617 Ga0068859_100176367 Ga0068859_1001763673 119
129 3300005618 Ga0068864_100240371 Ga0068864_1002403712 119
130 3300005841 Ga0068863_100956570 Ga0068863_1009565702 119
131 3300005843 Ga0068860_101012018 Ga0068860_1010120182 119
132 3300005843 Ga0068860_101147330 Ga0068860_1011473301 119
133 3300006173 Ga0070716_101131498 Ga0070716_1011314981 119
134 3300006237 Ga0097621_100785754 Ga0097621_1007857542 119
135 3300006931 Ga0097620_100176362 Ga0097620_1001763623 119
136 3300006946 Ga0079104_1009999 Ga0079104_10099993 119
137 3300009094 Ga0111539_11663453 Ga0111539_116634531 119
138 3300009098 Ga0105245_10012285 Ga0105245_100122859 119
139 3300009148 Ga0105243_10091886 Ga0105243_100918863 119
140 3300009176 Ga0105242_10162396 Ga0105242_101623962 119
141 3300009176 Ga0105242_12943510 Ga0105242_129435101 119
142 3300009177 Ga0105248_10057304 Ga0105248_100573045 119
143 3300009545 Ga0105237_10715279 Ga0105237_107152791 119
144 3300009551 Ga0105238_10083993 Ga0105238_100839935 119
145 3300009553 Ga0105249_10011311 Ga0105249_100113118 119
146 3300013100 Ga0157373_10620938 Ga0157373_106209382 119
147 3300013104 Ga0157370_11944960 Ga0157370_119449602 119
148 3300013297 Ga0157378_10787386 Ga0157378_107873862 119
149 3300013306 Ga0163162_13038623 Ga0163162_130386232 119
150 3300014325 Ga0163163_13110969 Ga0163163_131109691 119
151 3300025208 Ga0209436_101209 Ga0209436_10120912 119
152 3300025245 Ga0207425_1000009 Ga0207425_1000009299 119
153 3300025245 Ga0207425_1000516 Ga0207425_10005168 119
154 3300025258 Ga0209129_1000051 Ga0209129_1000051223 119
155 3300025258 Ga0209129_1004010 Ga0209129_10040107 119
156 3300025263 Ga0209565_1010986 Ga0209565_10109863 119
157 3300025263 Ga0209565_1019386 Ga0209565_10193862 119
158 3300025273 Ga0209673_1045678 Ga0209673_10456782 119
159 3300025284 Ga0209130_1000043 Ga0209130_1000043204 119
160 3300025291 Ga0209675_1008323 Ga0209675_10083235 119
161 3300025297 Ga0209758_1000054 Ga0209758_1000054300 119
162 3300025298 Ga0209050_1000040 Ga0209050_1000040143 119
163 3300025298 Ga0209050_1015091 Ga0209050_10150911 119
164 3300025299 Ga0209256_1000392 Ga0209256_100039257 119
165 3300025299 Ga0209256_1006982 Ga0209256_10069825 119
166 3300025302 Ga0207426_1004271 Ga0207426_10042717 119
167 3300025303 Ga0209051_1019014 Ga0209051_10190142 119
168 3300025304 Ga0209257_1000054 Ga0209257_1000054255 119
169 3300025304 Ga0209257_1009076 Ga0209257_10090762 119
170 3300025923 Ga0207681_11551124 Ga0207681_115511241 119
171 3300025924 Ga0207694_10264071 Ga0207694_102640713 119
172 3300025925 Ga0207650_10995027 Ga0207650_109950271 119
173 3300025927 Ga0207687_10068731 Ga0207687_100687313 119
174 3300025929 Ga0207664_10040628 Ga0207664_100406284 119
175 3300025934 Ga0207686_10109838 Ga0207686_101098384 119
176 3300025935 Ga0207709_10394289 Ga0207709_103942892 119
177 3300025941 Ga0207711_10121890 Ga0207711_101218903 119
178 3300025960 Ga0207651_10255160 Ga0207651_102551602 119
179 3300025960 Ga0207651_10338283 Ga0207651_103382832 119
180 3300025961 Ga0207712_10044469 Ga0207712_100444693 119
181 3300025986 Ga0207658_10290470 Ga0207658_102904702 119
182 3300025986 Ga0207658_10461505 Ga0207658_104615052 119
183 3300026023 Ga0207677_10182093 Ga0207677_101820932 119
184 3300026041 Ga0207639_10664723 Ga0207639_106647231 119
185 3300026088 Ga0207641_11102624 Ga0207641_111026242 119
186 3300026095 Ga0207676_10084202 Ga0207676_100842023 119
187 3300027111 Ga0209281_1002034 Ga0209281_10020344 119
188 3300028381 Ga0268264_10965199 Ga0268264_109651992 119
189 3300031548 Ga0307408_100004165 Ga0307408_1000041655 119
190 3300031548 Ga0307408_100004198 Ga0307408_1000041988 119
191 3300031548 Ga0307408_100006097 Ga0307408_1000060979 119
192 3300031548 Ga0307408_100026804 Ga0307408_1000268041 119
193 3300031901 Ga0307406_10047597 Ga0307406_100475972 119
194 3300031911 Ga0307412_11452239 Ga0307412_114522392 119
195 3300032002 Ga0307416_100004954 Ga0307416_1000049549 119
196 3300032002 Ga0307416_100659394 Ga0307416_1006593942 119
197 3300035113 Ga0373936_0443090 Ga0373936_0443090_199_558 119
198 3300037068 Ga0373925_0821967 Ga0373925_0821967_198_557 119
199 3300041404 Ga0439436_0203835 Ga0439436_0203835_124_495 119
200 3300041406 Ga0439439_0054551 Ga0439439_0054551_264_623 119
201 3300041406 Ga0439439_0085420 Ga0439439_0085420_27_398 119
202 3300042005 Ga0439448_0262718 Ga0439448_0262718_95_454 119
203 3300042007 Ga0439449_0210067 Ga0439449_0210067_261_632 119
204 3300042156 Ga0439446_0000580 Ga0439446_0000580_1708_2079 119
205 3300046460 Ga0495638_0345622 Ga0495638_0345622_248_607 119
206 3300046525 Ga0495663_0001567 Ga0495663_0001567_2507_2947 119
207 3300046528 Ga0495642_0113100 Ga0495642_0113100_722_1081 119
208 3300046558 Ga0495633_0145288 Ga0495633_0145288_157_597 119
209 3300046665 Ga0495661_0280100 Ga0495661_0280100_404_763 119
210 3300046684 Ga0495669_0483479 Ga0495669_0483479_43_402 119
211 3300047470 Ga0495681_0005803 Ga0495681_0005803_4685_5044 119
212 3300048907 Ga0496104_0000771 Ga0496104_0000771_6877_7236 119
213 3300048908 Ga0496105_0012653 Ga0496105_0012653_4186_4545 119
214 3300048909 Ga0496106_1355998 Ga0496106_1355998_121_480 119
215 3300048911 Ga0496108_0001711 Ga0496108_0001711_4669_5028 119
216 3300048912 Ga0496109_0007550 Ga0496109_0007550_5436_5795 119
217 3300048913 Ga0496110_0001734 Ga0496110_0001734_9809_10168 119
218 3300048915 Ga0496112_0015892 Ga0496112_0015892_577_936 119
219 3300048916 Ga0496113_0070939 Ga0496113_0070939_1389_1748 119
220 3300048927 Ga0496124_0035396 Ga0496124_0035396_3684_4043 119
221 3300049572 Ga0501036_0984570 Ga0501036_0984570_182_541 119
222 3300049578 Ga0501042_0428340 Ga0501042_0428340_16_375 119
223 3300049593 Ga0501077_0865295 Ga0501077_0865295_122_481 119
224 3300049686 Ga0501257_050988 Ga0501257_050988_256_615 119
225 3300049707 Ga0501234_024614 Ga0501234_024614_574_933 119
226 3300049775 Ga0501279_004312 Ga0501279_004312_1028_1387 119
227 3300049775 Ga0501279_007694 Ga0501279_007694_549_908 119
228 3300049853 Ga0501226_023625 Ga0501226_023625_19_378 119
229 3300050493 nmdc:mga0k408_315734_c1 nmdc:mga0k408_315734_c1_457_816 119
230 3300050515 nmdc:mga0a205_806595_c1 nmdc:mga0a205_806595_c1_240_599 119
231 3300053103 Ga0500555_002513 Ga0500555_002513_4585_4947 119
232 3300003323 rootH1_10038810 rootH1_1003881014 120
233 3300005340 Ga0070689_100791974 Ga0070689_1007919742 120
234 3300005365 Ga0070688_100897703 Ga0070688_1008977031 120
235 3300005441 Ga0070700_100431690 Ga0070700_1004316902 120
236 3300005456 Ga0070678_100935988 Ga0070678_1009359882 120
237 3300005536 Ga0070697_100069872 Ga0070697_1000698722 120
238 3300005543 Ga0070672_101390110 Ga0070672_1013901102 120
239 3300005617 Ga0068859_103133137 Ga0068859_1031331371 120
240 3300005719 Ga0068861_100164981 Ga0068861_1001649812 120
241 3300005844 Ga0068862_100084666 Ga0068862_1000846662 120
242 3300006353 Ga0075370_10019828 Ga0075370_100198285 120
243 3300006358 Ga0068871_100670379 Ga0068871_1006703792 120
244 3300006871 Ga0075434_100796874 Ga0075434_1007968742 120
245 3300006931 Ga0097620_103133209 Ga0097620_1031332091 120
246 3300009148 Ga0105243_11408702 Ga0105243_114087021 120
247 3300009176 Ga0105242_10099041 Ga0105242_100990415 120
248 3300009553 Ga0105249_11378698 Ga0105249_113786981 120
249 3300013297 Ga0157378_10038343 Ga0157378_100383436 120
250 3300014326 Ga0157380_11838320 Ga0157380_118383201 120
251 3300014968 Ga0157379_10370110 Ga0157379_103701102 120
252 3300014969 Ga0157376_11114468 Ga0157376_111144681 120
253 3300015262 Ga0182007_10037748 Ga0182007_100377483 120
254 3300015265 Ga0182005_1000006 Ga0182005_1000006219 120
255 3300017792 Ga0163161_11520382 Ga0163161_115203822 120
256 3300025923 Ga0207681_10087044 Ga0207681_100870442 120
257 3300025926 Ga0207659_10828677 Ga0207659_108286772 120
258 3300025926 Ga0207659_11699220 Ga0207659_116992202 120
259 3300025934 Ga0207686_10229966 Ga0207686_102299663 120
260 3300025961 Ga0207712_10398377 Ga0207712_103983772 120
261 3300026075 Ga0207708_11332371 Ga0207708_113323712 120
262 3300028380 Ga0268265_10065332 Ga0268265_100653322 120
263 3300031507 Ga0307509_10233269 Ga0307509_102332692 120
264 3300031548 Ga0307408_100043655 Ga0307408_1000436555 120
265 3300031548 Ga0307408_101110750 Ga0307408_1011107502 120
266 3300031548 Ga0307408_101824599 Ga0307408_1018245992 120
267 3300031903 Ga0307407_10721014 Ga0307407_107210141 120
268 3300031995 Ga0307409_101230004 Ga0307409_1012300042 120
269 3300032002 Ga0307416_100114195 Ga0307416_1001141952 120
270 3300032002 Ga0307416_102810201 Ga0307416_1028102011 120
271 3300032004 Ga0307414_10411821 Ga0307414_104118212 120
272 3300032005 Ga0307411_11230153 Ga0307411_112301532 120
273 3300032126 Ga0307415_102518140 Ga0307415_1025181402 120
274 3300041496 Ga0451839_0278244 Ga0451839_0278244_56_418 120
275 3300042876 Ga0451577_0079343 Ga0451577_0079343_1806_2168 120
276 3300044673 Ga0453683_0036124 Ga0453683_0036124_1568_1930 120
277 3300044712 Ga0453684_0082669 Ga0453684_0082669_2430_2792 120
278 3300045051 Ga0451576_0006902 Ga0451576_0006902_1436_1798 120
279 3300045051 Ga0451576_0065917 Ga0451576_0065917_1992_2354 120
280 3300046453 Ga0495627_000004 Ga0495627_000004_398201_398566 120
281 3300046523 Ga0495644_0129025 Ga0495644_0129025_384_749 120
282 3300046616 Ga0495668_0066125 Ga0495668_0066125_1070_1513 120
283 3300049459 Ga0495678_149905 Ga0495678_149905_365_730 120
284 3300050490 nmdc:mga03n38_809395_c1 nmdc:mga03n38_809395_c1_69_512 120
285 3300050491 nmdc:mga00v17_171337_c1 nmdc:mga00v17_171337_c1_448_891 120
286 3300050492 nmdc:mga0yw44_104789_c1 nmdc:mga0yw44_104789_c1_911_1354 120
287 3300050493 nmdc:mga0k408_22279_c1 nmdc:mga0k408_22279_c1_2715_3077 120
288 3300050494 nmdc:mga06z11_49962_c1 nmdc:mga06z11_49962_c1_865_1308 120
289 3300050494 nmdc:mga06z11_920921_c1 nmdc:mga06z11_920921_c1_118_489 120
290 3300050496 nmdc:mga07m45_41774_c1 nmdc:mga07m45_41774_c1_1820_2182 120
291 3300050507 nmdc:mga05p37_1400161_c1 nmdc:mga05p37_1400161_c1_149_511 120
292 3300050512 nmdc:mga0n895_421280_c1 nmdc:mga0n895_421280_c1_892_1254 120
293 3300053088 Ga0500644_0089963 Ga0500644_0089963_350_718 120
294 3300053096 Ga0500641_0312491 Ga0500641_0312491_231_599 120
295 3300053153 Ga0500616_0053547 Ga0500616_0053547_1354_1797 120
296 3300053160 Ga0500633_0139306 Ga0500633_0139306_90_452 120
297 3300053732 Ga0500656_074552 Ga0500656_074552_56_418 120
298 3300006038 Ga0075365_11058153 Ga0075365_110581531 122
299 3300006038 Ga0075365_11085710 Ga0075365_110857102 122
300 3300006042 Ga0075368_10009174 Ga0075368_100091743 122
301 3300006048 Ga0075363_100047944 Ga0075363_1000479444 122
302 3300006051 Ga0075364_10094551 Ga0075364_100945513 122
303 3300006177 Ga0075362_10087041 Ga0075362_100870414 122
304 3300006195 Ga0075366_10680974 Ga0075366_106809741 122
305 3300034818 Ga0373950_0020849 Ga0373950_0020849_95_463 122
306 3300050490 nmdc:mga03n38_157810_c1 nmdc:mga03n38_157810_c1_83_451 122
307 3300050491 nmdc:mga00v17_520189_c1 nmdc:mga00v17_520189_c1_301_669 122
308 3300050492 nmdc:mga0yw44_153019_c1 nmdc:mga0yw44_153019_c1_983_1351 122
309 3300002075 JGI24738J21930_10047169 JGI24738J21930_100471692 123
310 3300003354 JGI25160J50197_1028884 JGI25160J50197_10288842 123
311 3300005327 Ga0070658_10292185 Ga0070658_102921853 123
312 3300005339 Ga0070660_100749280 Ga0070660_1007492801 123
313 3300005455 Ga0070663_100326808 Ga0070663_1003268082 123
314 3300005548 Ga0070665_100327858 Ga0070665_1003278582 123
315 3300009011 Ga0105251_10002849 Ga0105251_1000284912 123
316 3300009093 Ga0105240_10201458 Ga0105240_102014582 123
317 3300009098 Ga0105245_10907929 Ga0105245_109079292 123
318 3300009174 Ga0105241_10070792 Ga0105241_100707924 123
319 3300009551 Ga0105238_10251523 Ga0105238_102515234 123
320 3300010375 Ga0105239_11548386 Ga0105239_115483861 123
321 3300013105 Ga0157369_10124452 Ga0157369_101244522 123
322 3300025302 Ga0207426_1003734 Ga0207426_10037345 123
323 3300025735 Ga0207713_1009586 Ga0207713_10095864 123
324 3300025904 Ga0207647_10079442 Ga0207647_100794422 123
325 3300025909 Ga0207705_10640516 Ga0207705_106405162 123
326 3300025911 Ga0207654_10191937 Ga0207654_101919374 123
327 3300025913 Ga0207695_10575031 Ga0207695_105750312 123
328 3300025913 Ga0207695_10936997 Ga0207695_109369971 123
329 3300025914 Ga0207671_10190372 Ga0207671_101903724 123
330 3300025924 Ga0207694_10719093 Ga0207694_107190932 123
331 3300037471 Ga0395905_0001579 Ga0395905_0001579_10641_11012 123
332 3300044693 Ga0466961_0188450 Ga0466961_0188450_550_954 123
333 3300044765 Ga0466970_0102110 Ga0466970_0102110_858_1262 123
334 3300046457 Ga0495590_0033721 Ga0495590_0033721_729_1100 123
335 3300046459 Ga0495629_0007814 Ga0495629_0007814_559_930 123
336 3300046463 Ga0495653_0004634 Ga0495653_0004634_2471_2842 123
337 3300046472 Ga0495580_0839597 Ga0495580_0839597_57_428 123
338 3300046491 Ga0495584_0030823 Ga0495584_0030823_493_864 123
339 3300046500 Ga0495596_0036127 Ga0495596_0036127_1119_1490 123
340 3300046507 Ga0495606_0034357 Ga0495606_0034357_2081_2452 123
341 3300046517 Ga0495630_0015094 Ga0495630_0015094_3877_4248 123
342 3300046529 Ga0495652_0038529 Ga0495652_0038529_1555_1926 123
343 3300046531 Ga0495665_0000313 Ga0495665_0000313_2510_2881 123
344 3300046535 Ga0495586_0448789 Ga0495586_0448789_80_451 123
345 3300046542 Ga0495597_0006890 Ga0495597_0006890_4204_4575 123
346 3300046616 Ga0495668_0513170 Ga0495668_0513170_40_411 123
347 3300046642 Ga0495634_0323402 Ga0495634_0323402_436_807 123
348 3300046663 Ga0495635_0005093 Ga0495635_0005093_2278_2649 123
349 3300046678 Ga0495599_0142271 Ga0495599_0142271_683_1054 123
350 3300046679 Ga0495623_0030281 Ga0495623_0030281_223_594 123
351 3300046680 Ga0495646_0015845 Ga0495646_0015845_1678_2049 123
352 3300046684 Ga0495669_0148174 Ga0495669_0148174_122_493 123
353 3300046690 Ga0495624_0037999 Ga0495624_0037999_2009_2380 123
354 3300046694 Ga0495649_0478477 Ga0495649_0478477_54_425 123
355 3300046809 Ga0495600_0044787 Ga0495600_0044787_688_1059 123
356 3300047317 Ga0495604_0058338 Ga0495604_0058338_2539_2910 123
357 3300047319 Ga0495674_0140482 Ga0495674_0140482_484_855 123
358 3300047322 Ga0495680_0015176 Ga0495680_0015176_3590_3961 123
359 3300047323 Ga0495683_0032138 Ga0495683_0032138_1733_2104 123
360 3300047443 Ga0495687_042810 Ga0495687_042810_1124_1495 123
361 3300047444 Ga0495675_0061421 Ga0495675_0061421_1931_2302 123
362 3300047444 Ga0495675_0073873 Ga0495675_0073873_129_500 123
363 3300047469 Ga0495673_0180023 Ga0495673_0180023_327_698 123
364 3300047673 Ga0495593_0525624 Ga0495593_0525624_15_386 123
365 3300048088 Ga0495602_0008064 Ga0495602_0008064_8130_8501 123
366 3300048903 Ga0496100_0020597 Ga0496100_0020597_2511_2882 123
367 3300048903 Ga0496100_0953859 Ga0496100_0953859_87_458 123
368 3300048904 Ga0496101_0227692 Ga0496101_0227692_1005_1376 123
369 3300048905 Ga0496102_0239122 Ga0496102_0239122_1160_1531 123
370 3300048905 Ga0496102_1054542 Ga0496102_1054542_299_670 123
371 3300048906 Ga0496103_0555635 Ga0496103_0555635_64_435 123
372 3300048907 Ga0496104_0029014 Ga0496104_0029014_3641_4012 123
373 3300048907 Ga0496104_0087398 Ga0496104_0087398_2053_2424 123
374 3300048908 Ga0496105_0144464 Ga0496105_0144464_826_1197 123
375 3300048909 Ga0496106_0007220 Ga0496106_0007220_7005_7376 123
376 3300048910 Ga0496107_0050611 Ga0496107_0050611_132_503 123
377 3300048910 Ga0496107_0416636 Ga0496107_0416636_279_650 123
378 3300048911 Ga0496108_0328343 Ga0496108_0328343_705_1076 123
379 3300048912 Ga0496109_0080652 Ga0496109_0080652_2546_2917 123
380 3300048912 Ga0496109_0629105 Ga0496109_0629105_619_990 123
381 3300048913 Ga0496110_0003160 Ga0496110_0003160_9727_10098 123
382 3300048914 Ga0496111_0004499 Ga0496111_0004499_1248_1619 123
383 3300048915 Ga0496112_0036562 Ga0496112_0036562_2418_2789 123
384 3300048916 Ga0496113_0008277 Ga0496113_0008277_2114_2485 123
385 3300048918 Ga0496115_0200859 Ga0496115_0200859_328_699 123
386 3300048919 Ga0496116_0001914 Ga0496116_0001914_1533_1904 123
387 3300048920 Ga0496117_0001844 Ga0496117_0001844_8107_8478 123
388 3300048921 Ga0496118_0062439 Ga0496118_0062439_1836_2207 123
389 3300048922 Ga0496119_0025965 Ga0496119_0025965_1291_1662 123
390 3300048922 Ga0496119_0316863 Ga0496119_0316863_137_508 123
391 3300048924 Ga0496121_0006340 Ga0496121_0006340_13806_14177 123
392 3300048925 Ga0496122_0024089 Ga0496122_0024089_4267_4638 123
393 3300048926 Ga0496123_0065587 Ga0496123_0065587_526_897 123
394 3300048927 Ga0496124_0154746 Ga0496124_0154746_342_713 123
395 3300048928 Ga0496125_0012666 Ga0496125_0012666_2421_2792 123
396 3300048929 Ga0496126_0068872 Ga0496126_0068872_2545_2916 123
397 3300048929 Ga0496126_0338483 Ga0496126_0338483_208_579 123
398 3300049459 Ga0495678_251692 Ga0495678_251692_58_429 123
399 3300059508 Ga0587088_118899 Ga0587088_118899_184_555 123
400 3300059511 Ga0587091_041979 Ga0587091_041979_338_709 123

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07237

DUF1428

Protein of unknown function (DUF1428)

30

132

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2okq-assembly1.cif.gz_B crystal structure of unknown conserved ybaa protein from shigella flexneri 0.9518 2 120
2okq-assembly1.cif.gz_A crystal structure of unknown conserved ybaa protein from shigella flexneri 0.9513 2 118
2okq-assembly1.cif.gz_A crystal structure of unknown conserved ybaa protein from shigella flexneri 0.8844 2 118
2okq-assembly1.cif.gz_B crystal structure of unknown conserved ybaa protein from shigella flexneri 0.8745 2 120
6fxd-assembly1.cif.gz_B-2 crystal structure of mupz from pseudomonas fluorescens 0.8147 1 89
ID Description Score Start End Superfamily
af_P0AAQ6_1_117_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9464 3 120 3.30.70.100
af_P0AAQ6_1_117_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9309 3 120 3.30.70.100
af_Q55CR9_1_97_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7695 2 117 3.30.70.100
af_F6NVH9_176_279_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7505 1 120 3.30.70.100
5k9fA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7486 4 115 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A4R2I8P8-F1-model_v4 Uncharacterized protein YbaA (DUF1428 family) 0.966 3 120
AF-A0A6J4S241-F1-model_v4 RNA signal recognition particle 4.5S RNA 0.9651 2 120
AF-A2SLW6-F1-model_v4 RNA signal recognition particle 4.5S RNA 0.9649 3 120
AF-A0A157ZPH8-F1-model_v4 RNA signal recognition particle 4.5S RNA 0.9637 1 123
AF-G6YAM0-F1-model_v4 RNA signal recognition particle 4.5S RNA 0.9629 3 120

Feature Viewer

pLDDT pTM Quality
92.46 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map