F434645

General Info

Members Datasets Scaffolds Average Seq Length
400 183 800 148

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0256655|Ga0453684_0256655_64_546
Length 160
Sequence MSRKTTAWGKSEMPTFWDRPTRENFCRRIASLTPDATARWGKFTAAQMVAHLNDAMRMATGDLPVQPKKMPLRYFPLKQLVLYVLPFPKGAPTAPELLARCGGADLKTEQAEFVILAERTAAKSPADRWPDHPAFGSMSHAAWGKLINRHTDHHLKQFGA

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
154 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
155 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
156 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
157 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
160 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
161 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
162 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
163 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
166 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
167 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
168 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
169 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
170 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
171 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
172 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
173 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
174 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
175 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
181 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
182 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
183 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.25
Nodule 0
Rhizoplane 0.25
Rhizosphere 95.5
Stem 0
Stem Tuber 0
Unclassified 34.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0256655 3300044712 Bacteria 2005
2 Ga0065704_10077373 3300005289 Unclassified 4750
3 Ga0065715_10072531 3300005293 Unclassified 759
4 Ga0070676_10301946 3300005328 Bacteria 1086
5 Ga0070690_100131511 3300005330 Bacteria 1690
6 Ga0070670_100008180 3300005331 Bacteria 8907
7 Ga0070670_100032370 3300005331 Bacteria 4503
8 Ga0070670_100708501 3300005331 Unclassified 905
9 Ga0070677_10527403 3300005333 Bacteria 644
10 Ga0068869_100017765 3300005334 Unclassified 4831
11 Ga0068869_100038824 3300005334 Bacteria 3397
12 Ga0068869_100168176 3300005334 Unclassified 1711
13 Ga0070680_100306830 3300005336 Unclassified 1346
14 Ga0068868_100062788 3300005338 Bacteria 2946
15 Ga0068868_100155494 3300005338 Bacteria 1886
16 Ga0068868_101218498 3300005338 Bacteria 696
17 Ga0068868_101905943 3300005338 Unclassified 563
18 Ga0070660_100677283 3300005339 Bacteria 864
19 Ga0070689_100009315 3300005340 Bacteria 6960
20 Ga0070689_100191536 3300005340 Bacteria 1665
21 Ga0070689_100530962 3300005340 Bacteria 1011
22 Ga0070689_100581025 3300005340 Unclassified 968
23 Ga0070687_100135406 3300005343 Bacteria 1427
24 Ga0070687_100153384 3300005343 Bacteria 1354
25 Ga0070668_100235258 3300005347 Unclassified 1516
26 Ga0070668_101094983 3300005347 Bacteria 719
27 Ga0070668_101236213 3300005347 Bacteria 677
28 Ga0070669_100009065 3300005353 Bacteria 7095
29 Ga0070669_100070072 3300005353 Bacteria 2591
30 Ga0070669_100121200 3300005353 Bacteria 1995
31 Ga0070669_100171255 3300005353 Bacteria 1693
32 Ga0070669_100966613 3300005353 Unclassified 730
33 Ga0070675_100056081 3300005354 Unclassified 3245
34 Ga0070675_100093849 3300005354 Bacteria 2517
35 Ga0070675_100405354 3300005354 Unclassified 1217
36 Ga0070675_100900104 3300005354 Unclassified 811
37 Ga0070675_101000507 3300005354 Unclassified 767
38 Ga0070671_100297743 3300005355 Bacteria 1373
39 Ga0070671_100367486 3300005355 Bacteria 1229
40 Ga0070674_100070311 3300005356 Bacteria 2473
41 Ga0070674_100252357 3300005356 Bacteria 1386
42 Ga0070674_100429779 3300005356 Bacteria 1085
43 Ga0070674_100485125 3300005356 Bacteria 1026
44 Ga0070673_100026123 3300005364 Bacteria 4308
45 Ga0070673_100187721 3300005364 Unclassified 1773
46 Ga0070673_100414176 3300005364 Unclassified 1207
47 Ga0070673_100584376 3300005364 Unclassified 1017
48 Ga0070673_100616025 3300005364 Unclassified 991
49 Ga0070673_100859814 3300005364 Unclassified 840
50 Ga0070688_100076542 3300005365 Unclassified 2153
51 Ga0070688_100308794 3300005365 Bacteria 1145
52 Ga0070667_100159608 3300005367 Bacteria 1985
53 Ga0070667_100194729 3300005367 Bacteria 1797
54 Ga0070709_10090676 3300005434 Bacteria 2015
55 Ga0070701_10000188 3300005438 Bacteria 19171
56 Ga0070701_10064629 3300005438 Unclassified 1940
57 Ga0070701_10081179 3300005438 Bacteria 1756
58 Ga0070701_10273971 3300005438 Bacteria 1028
59 Ga0070705_100636214 3300005440 Unclassified 830
60 Ga0070705_101263061 3300005440 Bacteria 611
61 Ga0070700_100000014 3300005441 Bacteria 156712
62 Ga0070700_100018459 3300005441 Bacteria 4010
63 Ga0070700_100100883 3300005441 Bacteria 1901
64 Ga0070694_100850961 3300005444 Bacteria 750
65 Ga0070663_100307398 3300005455 Bacteria 1271
66 Ga0070678_100629538 3300005456 Bacteria 960
67 Ga0070678_100719247 3300005456 Bacteria 901
68 Ga0070678_102379489 3300005456 Bacteria 503
69 Ga0070662_100016743 3300005457 Bacteria 4927
70 Ga0068867_100010961 3300005459 Bacteria 6393
71 Ga0068867_100048429 3300005459 Bacteria 3126
72 Ga0068867_100212434 3300005459 Bacteria 1555
73 Ga0068867_100491071 3300005459 Bacteria 1054
74 Ga0070685_10068211 3300005466 Bacteria 2100
75 Ga0070685_10349562 3300005466 Unclassified 1010
76 Ga0070706_100037714 3300005467 Archaea 4463
77 Ga0070706_100178720 3300005467 Unclassified 1981
78 Ga0070706_100644290 3300005467 Unclassified 984
79 Ga0070707_100004033 3300005468 Bacteria 13811
80 Ga0070707_101419653 3300005468 Unclassified 661
81 Ga0070698_100012621 3300005471 Bacteria 8945
82 Ga0070698_100018556 3300005471 Bacteria 7323
83 Ga0070698_100102688 3300005471 Bacteria 2830
84 Ga0070698_101793402 3300005471 Unclassified 566
85 Ga0070699_100001706 3300005518 Bacteria 20017
86 Ga0070699_100014043 3300005518 Bacteria 6889
87 Ga0070699_100930331 3300005518 Bacteria 796
88 Ga0070697_100000068 3300005536 Bacteria 83020
89 Ga0068853_102256857 3300005539 Bacteria 527
90 Ga0070672_100010074 3300005543 Bacteria 6543
91 Ga0070672_100195155 3300005543 Bacteria 1691
92 Ga0070672_100471287 3300005543 Unclassified 1083
93 Ga0070672_100541010 3300005543 Unclassified 1010
94 Ga0070686_100032172 3300005544 Bacteria 3213
95 Ga0070686_100497441 3300005544 Bacteria 945
96 Ga0070686_100963607 3300005544 Unclassified 698
97 Ga0070695_100473581 3300005545 Bacteria 964
98 Ga0070696_100186663 3300005546 Bacteria 1541
99 Ga0070696_100294029 3300005546 Bacteria 1242
100 Ga0070693_101034956 3300005547 Unclassified 623
101 Ga0070704_100033393 3300005549 Unclassified 3478
102 Ga0070704_100077712 3300005549 Bacteria 2432
103 Ga0070664_100536021 3300005564 Unclassified 1081
104 Ga0070664_100746531 3300005564 Unclassified 913
105 Ga0070664_100781832 3300005564 Unclassified 892
106 Ga0068857_100430198 3300005577 Unclassified 1232
107 Ga0068857_100780956 3300005577 Bacteria 911
108 Ga0068854_100488735 3300005578 Unclassified 1035
109 Ga0070702_101029756 3300005615 Bacteria 653
110 Ga0068859_100057596 3300005617 Bacteria 3914
111 Ga0068859_100077696 3300005617 Bacteria 3360
112 Ga0068859_101337479 3300005617 Bacteria 790
113 Ga0068864_100268679 3300005618 Unclassified 1588
114 Ga0068864_100616192 3300005618 Bacteria 1054
115 Ga0068864_101285871 3300005618 Unclassified 732
116 Ga0068866_10004314 3300005718 Bacteria 5839
117 Ga0068861_100190562 3300005719 Bacteria 1714
118 Ga0068861_100216016 3300005719 Bacteria 1618
119 Ga0068861_100315239 3300005719 Bacteria 1360
120 Ga0068861_101158432 3300005719 Unclassified 746
121 Ga0068861_102199459 3300005719 Unclassified 553
122 Ga0068851_10011858 3300005834 Bacteria 4098
123 Ga0068851_10886631 3300005834 Unclassified 558
124 Ga0068870_10016668 3300005840 Bacteria 3516
125 Ga0068870_10042715 3300005840 Unclassified 2361
126 Ga0068870_10378291 3300005840 Unclassified 916
127 Ga0068863_100034932 3300005841 Bacteria 4789
128 Ga0068863_100427945 3300005841 Unclassified 1297
129 Ga0068863_100505386 3300005841 Bacteria 1190
130 Ga0068858_100013132 3300005842 Bacteria 7810
131 Ga0068858_100092436 3300005842 Unclassified 2816
132 Ga0068858_100733873 3300005842 Bacteria 962
133 Ga0068858_101210705 3300005842 Unclassified 742
134 Ga0068860_100065081 3300005843 Bacteria 3462
135 Ga0068860_100287736 3300005843 Bacteria 1607
136 Ga0068862_100109488 3300005844 Bacteria 2423
137 Ga0068862_102061721 3300005844 Unclassified 581
138 Ga0075367_10258460 3300006178 Bacteria 1093
139 Ga0075366_10117577 3300006195 Unclassified 1601
140 Ga0075428_100039767 3300006844 Bacteria 5176
141 Ga0075428_100044274 3300006844 Bacteria 4892
142 Ga0075428_100397482 3300006844 Viruses 1477
143 Ga0075428_101414218 3300006844 Unclassified 730
144 Ga0075428_101573846 3300006844 Unclassified 688
145 Ga0075430_100014930 3300006846 Bacteria 6614
146 Ga0075431_100000941 3300006847 Bacteria 25660
147 Ga0075431_100070411 3300006847 Bacteria 3609
148 Ga0075433_10044094 3300006852 Bacteria 3874
149 Ga0075434_100814063 3300006871 Unclassified 950
150 Ga0075434_101091848 3300006871 Unclassified 811
151 Ga0075429_100009060 3300006880 Bacteria 8643
152 Ga0075429_100929939 3300006880 Unclassified 761
153 Ga0068865_100050970 3300006881 Bacteria 2862
154 Ga0097620_100057596 3300006931 Bacteria 3914
155 Ga0097620_100077692 3300006931 Bacteria 3360
156 Ga0097620_101337178 3300006931 Bacteria 790
157 Ga0075435_100079504 3300007076 Unclassified 2691
158 Ga0075435_100480593 3300007076 Bacteria 1073
159 Ga0105240_10037591 3300009093 Bacteria 6220
160 Ga0111539_10000436 3300009094 Bacteria 52673
161 Ga0111539_10166314 3300009094 Bacteria 2578
162 Ga0111539_10287088 3300009094 Unclassified 1915
163 Ga0111539_12107400 3300009094 Unclassified 654
164 Ga0105245_10002435 3300009098 Bacteria 16840
165 Ga0105245_10495290 3300009098 Unclassified 1237
166 Ga0105245_10729950 3300009098 Bacteria 1025
167 Ga0105245_11960942 3300009098 Unclassified 639
168 Ga0105245_11994095 3300009098 Unclassified 634
169 Ga0105247_10519939 3300009101 Unclassified 870
170 Ga0114129_10016793 3300009147 Bacteria 10419
171 Ga0105243_10016429 3300009148 Bacteria 5598
172 Ga0105243_10047401 3300009148 Bacteria 3383
173 Ga0105243_12021566 3300009148 Unclassified 611
174 Ga0105242_10064279 3300009176 Bacteria 3024
175 Ga0105242_11006381 3300009176 Bacteria 841
176 Ga0105242_13230095 3300009176 Unclassified 506
177 Ga0105248_10404427 3300009177 Bacteria 1537
178 Ga0105248_10919667 3300009177 Unclassified 988
179 Ga0105238_10014686 3300009551 Bacteria 7917
180 Ga0105238_11039912 3300009551 Unclassified 840
181 Ga0105249_10117294 3300009553 Bacteria 2524
182 Ga0105249_10194678 3300009553 Unclassified 1980
183 Ga0105249_10222872 3300009553 Bacteria 1856
184 Ga0105249_11070716 3300009553 Bacteria 876
185 Ga0105239_10099317 3300010375 Bacteria 3218
186 Ga0105246_10151203 3300011119 Bacteria 1757
187 Ga0105246_10199000 3300011119 Unclassified 1556
188 Ga0105246_10581022 3300011119 Unclassified 965
189 Ga0157370_10234280 3300013104 Bacteria 1699
190 Ga0157369_10819706 3300013105 Bacteria 956
191 Ga0157374_10289198 3300013296 Bacteria 1619
192 Ga0157374_12703495 3300013296 Unclassified 524
193 Ga0157378_10241368 3300013297 Bacteria 1726
194 Ga0157378_10948521 3300013297 Unclassified 893
195 Ga0163162_10176159 3300013306 Archaea 2264
196 Ga0163162_10185181 3300013306 Bacteria 2209
197 Ga0157375_10166573 3300013308 Unclassified 2348
198 Ga0157375_10788943 3300013308 Unclassified 1099
199 Ga0163163_10004142 3300014325 Bacteria 12348
200 Ga0163163_10020387 3300014325 Bacteria 6242
201 Ga0163163_10089764 3300014325 Bacteria 3086
202 Ga0157380_10245213 3300014326 Bacteria 1618
203 Ga0157380_10335430 3300014326 Bacteria 1408
204 Ga0157380_10337318 3300014326 Bacteria 1404
205 Ga0157380_10492879 3300014326 Unclassified 1188
206 Ga0157380_10722135 3300014326 Unclassified 1004
207 Ga0182008_10438388 3300014497 Unclassified 708
208 Ga0157377_10166180 3300014745 Bacteria 1376
209 Ga0157379_10118882 3300014968 Unclassified 2377
210 Ga0157379_10510687 3300014968 Bacteria 1115
211 Ga0157376_10345072 3300014969 Bacteria 1423
212 Ga0163161_10134920 3300017792 Bacteria 1865
213 Ga0163161_10178038 3300017792 Bacteria 1629
214 Ga0163161_10698470 3300017792 Bacteria 844
215 Ga0207682_10088989 3300025893 Bacteria 1336
216 Ga0207682_10197211 3300025893 Unclassified 925
217 Ga0207682_10293873 3300025893 Bacteria 761
218 Ga0207642_10007863 3300025899 Bacteria 3622
219 Ga0207688_10063203 3300025901 Bacteria 2088
220 Ga0207680_10044282 3300025903 Bacteria 2616
221 Ga0207680_10187727 3300025903 Bacteria 1401
222 Ga0207680_10382353 3300025903 Unclassified 993
223 Ga0207699_10028059 3300025906 Unclassified 3124
224 Ga0207699_10715322 3300025906 Unclassified 733
225 Ga0207645_10127387 3300025907 Bacteria 1655
226 Ga0207645_10280746 3300025907 Bacteria 1106
227 Ga0207643_10017577 3300025908 Bacteria 3912
228 Ga0207643_10052234 3300025908 Bacteria 2321
229 Ga0207643_10243272 3300025908 Bacteria 1107
230 Ga0207643_11073039 3300025908 Bacteria 520
231 Ga0207684_10005884 3300025910 Bacteria 11229
232 Ga0207684_10030249 3300025910 Archaea 4611
233 Ga0207695_10314471 3300025913 Bacteria 1456
234 Ga0207662_10033416 3300025918 Bacteria 2998
235 Ga0207662_10040816 3300025918 Bacteria 2730
236 Ga0207662_10365107 3300025918 Unclassified 972
237 Ga0207657_10597247 3300025919 Bacteria 861
238 Ga0207646_10016030 3300025922 Bacteria 7044
239 Ga0207646_11207055 3300025922 Bacteria 663
240 Ga0207681_10001031 3300025923 Bacteria 18128
241 Ga0207681_10140881 3300025923 Bacteria 1795
242 Ga0207681_10682448 3300025923 Unclassified 853
243 Ga0207681_11203890 3300025923 Bacteria 636
244 Ga0207694_10010299 3300025924 Bacteria 7048
245 Ga0207694_10789861 3300025924 Unclassified 802
246 Ga0207650_10002511 3300025925 Bacteria 12739
247 Ga0207659_10019798 3300025926 Unclassified 4436
248 Ga0207659_10020618 3300025926 Bacteria 4360
249 Ga0207659_10069224 3300025926 Bacteria 2569
250 Ga0207659_10749179 3300025926 Bacteria 838
251 Ga0207659_10843022 3300025926 Unclassified 788
252 Ga0207687_10002142 3300025927 Bacteria 13452
253 Ga0207687_10088774 3300025927 Bacteria 2250
254 Ga0207687_10160592 3300025927 Unclassified 1724
255 Ga0207687_10736295 3300025927 Unclassified 838
256 Ga0207644_10021394 3300025931 Bacteria 4405
257 Ga0207706_10000268 3300025933 Bacteria 56719
258 Ga0207706_10099757 3300025933 Unclassified 2555
259 Ga0207706_10694001 3300025933 Unclassified 870
260 Ga0207686_10011686 3300025934 Bacteria 4816
261 Ga0207709_10422818 3300025935 Bacteria 1024
262 Ga0207709_10507985 3300025935 Unclassified 942
263 Ga0207670_10122886 3300025936 Bacteria 1890
264 Ga0207670_10479349 3300025936 Unclassified 1007
265 Ga0207670_10519119 3300025936 Unclassified 969
266 Ga0207669_10668376 3300025937 Unclassified 851
267 Ga0207669_10831618 3300025937 Unclassified 767
268 Ga0207669_11081332 3300025937 Bacteria 676
269 Ga0207665_10026384 3300025939 Bacteria 3835
270 Ga0207691_10073529 3300025940 Bacteria 3083
271 Ga0207691_10078295 3300025940 Unclassified 2976
272 Ga0207691_10095353 3300025940 Bacteria 2661
273 Ga0207691_10436997 3300025940 Bacteria 1114
274 Ga0207691_10576420 3300025940 Unclassified 953
275 Ga0207711_10569872 3300025941 Unclassified 1056
276 Ga0207711_10784332 3300025941 Unclassified 888
277 Ga0207689_10011224 3300025942 Bacteria 7689
278 Ga0207689_10051139 3300025942 Bacteria 3406
279 Ga0207689_10297795 3300025942 Bacteria 1337
280 Ga0207689_10874057 3300025942 Unclassified 759
281 Ga0207689_10996432 3300025942 Unclassified 707
282 Ga0207679_10662560 3300025945 Unclassified 945
283 Ga0207651_10094964 3300025960 Bacteria 2194
284 Ga0207651_10097457 3300025960 Unclassified 2171
285 Ga0207651_10114342 3300025960 Bacteria 2032
286 Ga0207651_10342789 3300025960 Bacteria 1256
287 Ga0207651_10665354 3300025960 Bacteria 915
288 Ga0207651_10771326 3300025960 Unclassified 851
289 Ga0207712_10029339 3300025961 Bacteria 3689
290 Ga0207712_10939268 3300025961 Unclassified 766
291 Ga0207668_10610085 3300025972 Unclassified 951
292 Ga0207668_11003142 3300025972 Bacteria 746
293 Ga0207640_10546217 3300025981 Unclassified 973
294 Ga0207640_10856922 3300025981 Bacteria 791
295 Ga0207640_11540204 3300025981 Unclassified 598
296 Ga0207658_10218809 3300025986 Bacteria 1601
297 Ga0207658_10899256 3300025986 Unclassified 806
298 Ga0207677_10016793 3300026023 Bacteria 4346
299 Ga0207677_10257674 3300026023 Bacteria 1420
300 Ga0207677_10718175 3300026023 Bacteria 888
301 Ga0207703_10109183 3300026035 Bacteria 2357
302 Ga0207703_10154497 3300026035 Bacteria 2004
303 Ga0207703_10383064 3300026035 Bacteria 1301
304 Ga0207678_10511231 3300026067 Unclassified 1048
305 Ga0207708_10000047 3300026075 Bacteria 115550
306 Ga0207708_10024456 3300026075 Bacteria 4569
307 Ga0207708_10360709 3300026075 Unclassified 1194
308 Ga0207708_11340044 3300026075 Bacteria 627
309 Ga0207641_10067054 3300026088 Bacteria 3073
310 Ga0207648_10000831 3300026089 Bacteria 34764
311 Ga0207648_10061293 3300026089 Bacteria 3280
312 Ga0207648_10068101 3300026089 Bacteria 3102
313 Ga0207648_11470464 3300026089 Unclassified 640
314 Ga0207648_11632808 3300026089 Bacteria 606
315 Ga0207676_10740183 3300026095 Bacteria 955
316 Ga0207676_11437003 3300026095 Unclassified 686
317 Ga0207676_11803100 3300026095 Unclassified 610
318 Ga0207676_12031330 3300026095 Unclassified 573
319 Ga0207675_100008698 3300026118 Bacteria 9541
320 Ga0207675_100272955 3300026118 Bacteria 1641
321 Ga0207675_100336160 3300026118 Bacteria 1477
322 Ga0207675_100424976 3300026118 Bacteria 1313
323 Ga0207675_101795957 3300026118 Unclassified 632
324 Ga0207675_101864659 3300026118 Bacteria 620
325 Ga0207683_10388474 3300026121 Unclassified 1283
326 Ga0207683_10672880 3300026121 Bacteria 959
327 Ga0207698_10624234 3300026142 Bacteria 1065
328 Ga0209813_10070224 3300027866 Bacteria 1137
329 Ga0209813_10331113 3300027866 Unclassified 598
330 Ga0268266_10386149 3300028379 Bacteria 1322
331 Ga0268265_10160595 3300028380 Bacteria 1908
332 Ga0268265_10291166 3300028380 Bacteria 1466
333 Ga0268265_10620690 3300028380 Bacteria 1036
334 Ga0268265_11475738 3300028380 Bacteria 683
335 Ga0268264_10066254 3300028381 Bacteria 3045
336 Ga0307513_10175750 3300031456 Bacteria 2012
337 Ga0307513_10608253 3300031456 Unclassified 802
338 Ga0307408_100042726 3300031548 Bacteria 3222
339 Ga0307408_100466355 3300031548 Unclassified 1099
340 Ga0307408_100600757 3300031548 Unclassified 978
341 Ga0307405_10837280 3300031731 Bacteria 773
342 Ga0307413_10035238 3300031824 Bacteria 2868
343 Ga0307413_11251634 3300031824 Unclassified 647
344 Ga0307410_10995779 3300031852 Bacteria 722
345 Ga0307406_10047463 3300031901 Bacteria 2706
346 Ga0307407_10811152 3300031903 Bacteria 712
347 Ga0307412_11382574 3300031911 Bacteria 636
348 Ga0307416_100065491 3300032002 Bacteria 2986
349 Ga0307416_100727020 3300032002 Unclassified 1084
350 Ga0307416_101599005 3300032002 Unclassified 757
351 Ga0307414_10426014 3300032004 Bacteria 1158
352 Ga0307411_10069677 3300032005 Unclassified 2376
353 Ga0307411_10127150 3300032005 Bacteria 1855
354 Ga0307411_10493400 3300032005 Unclassified 1034
355 Ga0307415_100596625 3300032126 Bacteria 982
356 Ga0451807_2438248 3300041486 Bacteria 573
357 Ga0451853_1447193 3300041512 Bacteria 1006
358 Ga0451853_1730653 3300041512 Unclassified 2593
359 Ga0439435_0004651 3300042436 Bacteria 2970
360 Ga0439435_0029281 3300042436 Bacteria 1485
361 Ga0450918_074126 3300042531 Unclassified 642
362 Ga0451577_0024402 3300042876 Bacteria 5501
363 Ga0451577_0231663 3300042876 Bacteria 1671
364 Ga0451577_0468027 3300042876 Unclassified 1144
365 Ga0453684_1411294 3300044712 Unclassified 722
366 Ga0451576_0203264 3300045051 Bacteria 2069
367 Ga0451576_0997573 3300045051 Unclassified 878
368 Ga0495582_0169921 3300046473 Unclassified 1241
369 Ga0495598_0185786 3300046537 Unclassified 744
370 Ga0495621_0308181 3300046539 Bacteria 657
371 Ga0495588_0321268 3300046674 Bacteria 814
372 Ga0501042_0342902 3300049578 Bacteria 1080
373 Ga0501048_0116554 3300049582 Bacteria 1887
374 Ga0501071_0005097 3300049587 Bacteria 8411
375 Ga0501072_0036915 3300049588 Bacteria 3832
376 Ga0501081_0594090 3300049743 Bacteria 829
377 Ga0501045_0115333 3300049824 Bacteria 1992
378 Ga0501045_0549360 3300049824 Unclassified 857
379 nmdc:mga00v17_3293_c1 3300050491 Bacteria 8328
380 nmdc:mga00v17_682195_c1 3300050491 Bacteria 659
381 nmdc:mga0yw44_2418_c1 3300050492 Bacteria 7949
382 nmdc:mga0k408_1295_c1 3300050493 Bacteria 13536
383 nmdc:mga06z11_2652_c1 3300050494 Bacteria 6856
384 nmdc:mga06z11_561811_c1 3300050494 Unclassified 693
385 nmdc:mga04h51_366010_c1 3300050495 Unclassified 598
386 nmdc:mga04h51_90553_c1 3300050495 Bacteria 1100
387 nmdc:mga09592_142801_c1 3300050508 Bacteria 2064
388 nmdc:mga09592_856161_c1 3300050508 Unclassified 766
389 nmdc:mga0qj67_328540_c1 3300050509 Bacteria 1238
390 nmdc:mga0qj67_954327_c1 3300050509 Unclassified 674
391 nmdc:mga06r32_60530_c1 3300050510 Bacteria 3644
392 nmdc:mga08y16_2251_c1 3300050511 Bacteria 19787
393 nmdc:mga08y16_472883_c1 3300050511 Bacteria 1276
394 nmdc:mga0n895_1642848_c1 3300050512 Unclassified 606
395 nmdc:mga0rr50_21809_c1 3300050513 Bacteria 4381
396 nmdc:mga0rr50_45394_c1 3300050513 Bacteria 3229
397 Ga0500646_0122219 3300053090 Unclassified 838
398 Ga0501084_0442944 3300054114 Bacteria 1098
399 Ga0590077_015489 3300059426 Bacteria 1595
400 Ga0530510_0166031 3300061734 Bacteria 1634
401 Ga0453684_0256655
402 Ga0065704_10077373
403 Ga0065715_10072531
404 Ga0070676_10301946
405 Ga0070690_100131511
406 Ga0070670_100008180
407 Ga0070670_100032370
408 Ga0070670_100708501
409 Ga0070677_10527403
410 Ga0068869_100017765
411 Ga0068869_100038824
412 Ga0068869_100168176
413 Ga0070680_100306830
414 Ga0068868_100062788
415 Ga0068868_100155494
416 Ga0068868_101218498
417 Ga0068868_101905943
418 Ga0070660_100677283
419 Ga0070689_100009315
420 Ga0070689_100191536
421 Ga0070689_100530962
422 Ga0070689_100581025
423 Ga0070687_100135406
424 Ga0070687_100153384
425 Ga0070668_100235258
426 Ga0070668_101094983
427 Ga0070668_101236213
428 Ga0070669_100009065
429 Ga0070669_100070072
430 Ga0070669_100121200
431 Ga0070669_100171255
432 Ga0070669_100966613
433 Ga0070675_100056081
434 Ga0070675_100093849
435 Ga0070675_100405354
436 Ga0070675_100900104
437 Ga0070675_101000507
438 Ga0070671_100297743
439 Ga0070671_100367486
440 Ga0070674_100070311
441 Ga0070674_100252357
442 Ga0070674_100429779
443 Ga0070674_100485125
444 Ga0070673_100026123
445 Ga0070673_100187721
446 Ga0070673_100414176
447 Ga0070673_100584376
448 Ga0070673_100616025
449 Ga0070673_100859814
450 Ga0070688_100076542
451 Ga0070688_100308794
452 Ga0070667_100159608
453 Ga0070667_100194729
454 Ga0070709_10090676
455 Ga0070701_10000188
456 Ga0070701_10064629
457 Ga0070701_10081179
458 Ga0070701_10273971
459 Ga0070705_100636214
460 Ga0070705_101263061
461 Ga0070700_100000014
462 Ga0070700_100018459
463 Ga0070700_100100883
464 Ga0070694_100850961
465 Ga0070663_100307398
466 Ga0070678_100629538
467 Ga0070678_100719247
468 Ga0070678_102379489
469 Ga0070662_100016743
470 Ga0068867_100010961
471 Ga0068867_100048429
472 Ga0068867_100212434
473 Ga0068867_100491071
474 Ga0070685_10068211
475 Ga0070685_10349562
476 Ga0070706_100037714
477 Ga0070706_100178720
478 Ga0070706_100644290
479 Ga0070707_100004033
480 Ga0070707_101419653
481 Ga0070698_100012621
482 Ga0070698_100018556
483 Ga0070698_100102688
484 Ga0070698_101793402
485 Ga0070699_100001706
486 Ga0070699_100014043
487 Ga0070699_100930331
488 Ga0070697_100000068
489 Ga0068853_102256857
490 Ga0070672_100010074
491 Ga0070672_100195155
492 Ga0070672_100471287
493 Ga0070672_100541010
494 Ga0070686_100032172
495 Ga0070686_100497441
496 Ga0070686_100963607
497 Ga0070695_100473581
498 Ga0070696_100186663
499 Ga0070696_100294029
500 Ga0070693_101034956
501 Ga0070704_100033393
502 Ga0070704_100077712
503 Ga0070664_100536021
504 Ga0070664_100746531
505 Ga0070664_100781832
506 Ga0068857_100430198
507 Ga0068857_100780956
508 Ga0068854_100488735
509 Ga0070702_101029756
510 Ga0068859_100057596
511 Ga0068859_100077696
512 Ga0068859_101337479
513 Ga0068864_100268679
514 Ga0068864_100616192
515 Ga0068864_101285871
516 Ga0068866_10004314
517 Ga0068861_100190562
518 Ga0068861_100216016
519 Ga0068861_100315239
520 Ga0068861_101158432
521 Ga0068861_102199459
522 Ga0068851_10011858
523 Ga0068851_10886631
524 Ga0068870_10016668
525 Ga0068870_10042715
526 Ga0068870_10378291
527 Ga0068863_100034932
528 Ga0068863_100427945
529 Ga0068863_100505386
530 Ga0068858_100013132
531 Ga0068858_100092436
532 Ga0068858_100733873
533 Ga0068858_101210705
534 Ga0068860_100065081
535 Ga0068860_100287736
536 Ga0068862_100109488
537 Ga0068862_102061721
538 Ga0075367_10258460
539 Ga0075366_10117577
540 Ga0075428_100039767
541 Ga0075428_100044274
542 Ga0075428_100397482
543 Ga0075428_101414218
544 Ga0075428_101573846
545 Ga0075430_100014930
546 Ga0075431_100000941
547 Ga0075431_100070411
548 Ga0075433_10044094
549 Ga0075434_100814063
550 Ga0075434_101091848
551 Ga0075429_100009060
552 Ga0075429_100929939
553 Ga0068865_100050970
554 Ga0097620_100057596
555 Ga0097620_100077692
556 Ga0097620_101337178
557 Ga0075435_100079504
558 Ga0075435_100480593
559 Ga0105240_10037591
560 Ga0111539_10000436
561 Ga0111539_10166314
562 Ga0111539_10287088
563 Ga0111539_12107400
564 Ga0105245_10002435
565 Ga0105245_10495290
566 Ga0105245_10729950
567 Ga0105245_11960942
568 Ga0105245_11994095
569 Ga0105247_10519939
570 Ga0114129_10016793
571 Ga0105243_10016429
572 Ga0105243_10047401
573 Ga0105243_12021566
574 Ga0105242_10064279
575 Ga0105242_11006381
576 Ga0105242_13230095
577 Ga0105248_10404427
578 Ga0105248_10919667
579 Ga0105238_10014686
580 Ga0105238_11039912
581 Ga0105249_10117294
582 Ga0105249_10194678
583 Ga0105249_10222872
584 Ga0105249_11070716
585 Ga0105239_10099317
586 Ga0105246_10151203
587 Ga0105246_10199000
588 Ga0105246_10581022
589 Ga0157370_10234280
590 Ga0157369_10819706
591 Ga0157374_10289198
592 Ga0157374_12703495
593 Ga0157378_10241368
594 Ga0157378_10948521
595 Ga0163162_10176159
596 Ga0163162_10185181
597 Ga0157375_10166573
598 Ga0157375_10788943
599 Ga0163163_10004142
600 Ga0163163_10020387
601 Ga0163163_10089764
602 Ga0157380_10245213
603 Ga0157380_10335430
604 Ga0157380_10337318
605 Ga0157380_10492879
606 Ga0157380_10722135
607 Ga0182008_10438388
608 Ga0157377_10166180
609 Ga0157379_10118882
610 Ga0157379_10510687
611 Ga0157376_10345072
612 Ga0163161_10134920
613 Ga0163161_10178038
614 Ga0163161_10698470
615 Ga0207682_10088989
616 Ga0207682_10197211
617 Ga0207682_10293873
618 Ga0207642_10007863
619 Ga0207688_10063203
620 Ga0207680_10044282
621 Ga0207680_10187727
622 Ga0207680_10382353
623 Ga0207699_10028059
624 Ga0207699_10715322
625 Ga0207645_10127387
626 Ga0207645_10280746
627 Ga0207643_10017577
628 Ga0207643_10052234
629 Ga0207643_10243272
630 Ga0207643_11073039
631 Ga0207684_10005884
632 Ga0207684_10030249
633 Ga0207695_10314471
634 Ga0207662_10033416
635 Ga0207662_10040816
636 Ga0207662_10365107
637 Ga0207657_10597247
638 Ga0207646_10016030
639 Ga0207646_11207055
640 Ga0207681_10001031
641 Ga0207681_10140881
642 Ga0207681_10682448
643 Ga0207681_11203890
644 Ga0207694_10010299
645 Ga0207694_10789861
646 Ga0207650_10002511
647 Ga0207659_10019798
648 Ga0207659_10020618
649 Ga0207659_10069224
650 Ga0207659_10749179
651 Ga0207659_10843022
652 Ga0207687_10002142
653 Ga0207687_10088774
654 Ga0207687_10160592
655 Ga0207687_10736295
656 Ga0207644_10021394
657 Ga0207706_10000268
658 Ga0207706_10099757
659 Ga0207706_10694001
660 Ga0207686_10011686
661 Ga0207709_10422818
662 Ga0207709_10507985
663 Ga0207670_10122886
664 Ga0207670_10479349
665 Ga0207670_10519119
666 Ga0207669_10668376
667 Ga0207669_10831618
668 Ga0207669_11081332
669 Ga0207665_10026384
670 Ga0207691_10073529
671 Ga0207691_10078295
672 Ga0207691_10095353
673 Ga0207691_10436997
674 Ga0207691_10576420
675 Ga0207711_10569872
676 Ga0207711_10784332
677 Ga0207689_10011224
678 Ga0207689_10051139
679 Ga0207689_10297795
680 Ga0207689_10874057
681 Ga0207689_10996432
682 Ga0207679_10662560
683 Ga0207651_10094964
684 Ga0207651_10097457
685 Ga0207651_10114342
686 Ga0207651_10342789
687 Ga0207651_10665354
688 Ga0207651_10771326
689 Ga0207712_10029339
690 Ga0207712_10939268
691 Ga0207668_10610085
692 Ga0207668_11003142
693 Ga0207640_10546217
694 Ga0207640_10856922
695 Ga0207640_11540204
696 Ga0207658_10218809
697 Ga0207658_10899256
698 Ga0207677_10016793
699 Ga0207677_10257674
700 Ga0207677_10718175
701 Ga0207703_10109183
702 Ga0207703_10154497
703 Ga0207703_10383064
704 Ga0207678_10511231
705 Ga0207708_10000047
706 Ga0207708_10024456
707 Ga0207708_10360709
708 Ga0207708_11340044
709 Ga0207641_10067054
710 Ga0207648_10000831
711 Ga0207648_10061293
712 Ga0207648_10068101
713 Ga0207648_11470464
714 Ga0207648_11632808
715 Ga0207676_10740183
716 Ga0207676_11437003
717 Ga0207676_11803100
718 Ga0207676_12031330
719 Ga0207675_100008698
720 Ga0207675_100272955
721 Ga0207675_100336160
722 Ga0207675_100424976
723 Ga0207675_101795957
724 Ga0207675_101864659
725 Ga0207683_10388474
726 Ga0207683_10672880
727 Ga0207698_10624234
728 Ga0209813_10070224
729 Ga0209813_10331113
730 Ga0268266_10386149
731 Ga0268265_10160595
732 Ga0268265_10291166
733 Ga0268265_10620690
734 Ga0268265_11475738
735 Ga0268264_10066254
736 Ga0307513_10175750
737 Ga0307513_10608253
738 Ga0307408_100042726
739 Ga0307408_100466355
740 Ga0307408_100600757
741 Ga0307405_10837280
742 Ga0307413_10035238
743 Ga0307413_11251634
744 Ga0307410_10995779
745 Ga0307406_10047463
746 Ga0307407_10811152
747 Ga0307412_11382574
748 Ga0307416_100065491
749 Ga0307416_100727020
750 Ga0307416_101599005
751 Ga0307414_10426014
752 Ga0307411_10069677
753 Ga0307411_10127150
754 Ga0307411_10493400
755 Ga0307415_100596625
756 Ga0451807_2438248
757 Ga0451853_1447193
758 Ga0451853_1730653
759 Ga0439435_0004651
760 Ga0439435_0029281
761 Ga0450918_074126
762 Ga0451577_0024402
763 Ga0451577_0231663
764 Ga0451577_0468027
765 Ga0453684_1411294
766 Ga0451576_0203264
767 Ga0451576_0997573
768 Ga0495582_0169921
769 Ga0495598_0185786
770 Ga0495621_0308181
771 Ga0495588_0321268
772 Ga0501042_0342902
773 Ga0501048_0116554
774 Ga0501071_0005097
775 Ga0501072_0036915
776 Ga0501081_0594090
777 Ga0501045_0115333
778 Ga0501045_0549360
779 nmdc:mga00v17_3293_c1
780 nmdc:mga00v17_682195_c1
781 nmdc:mga0yw44_2418_c1
782 nmdc:mga0k408_1295_c1
783 nmdc:mga06z11_2652_c1
784 nmdc:mga06z11_561811_c1
785 nmdc:mga04h51_366010_c1
786 nmdc:mga04h51_90553_c1
787 nmdc:mga09592_142801_c1
788 nmdc:mga09592_856161_c1
789 nmdc:mga0qj67_328540_c1
790 nmdc:mga0qj67_954327_c1
791 nmdc:mga06r32_60530_c1
792 nmdc:mga08y16_2251_c1
793 nmdc:mga08y16_472883_c1
794 nmdc:mga0n895_1642848_c1
795 nmdc:mga0rr50_21809_c1
796 nmdc:mga0rr50_45394_c1
797 Ga0500646_0122219
798 Ga0501084_0442944
799 Ga0590077_015489
800 Ga0530510_0166031

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07606

DUF1569

Protein of unknown function (DUF1569)

18

160

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hkv-assembly1.cif.gz_A-2 crystal structure of a putative member of the dinb family (exig_1237) from exiguobacterium sibiricum 255-15 at 1.70 a resolution 0.5807 8 146
2p1a-assembly1.cif.gz_B crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.5351 8 146
2p1a-assembly1.cif.gz_A crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.5113 4 146
1rxq-assembly1.cif.gz_B yfit from bacillus subtilis is a probable metal-dependent hydrolase with an unusual four-helix bundle topology 0.4958 4 146
8fx9-assembly1.cif.gz_A-2 crystal strucutre of mycobacterium tuberculosis mycothiol-s-transferase enzyme 0.4909 8 145
ID Description Score Start End Superfamily
2hkvA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6061 8 146 1.20.120.450
af_P71985_5_134_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.5542 2 147 1.20.120.450
af_P71985_5_134_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.551 2 147 1.20.120.450
af_P9WM91_7_150_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.5485 4 146 1.20.120.450
af_O05777_10_164_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.5378 4 146 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A2V8QVR3-F1-model_v4 DUF1569 domain-containing protein 0.9601 1 148
AF-A0A2V7YYC4-F1-model_v4 DUF1569 domain-containing protein 0.9507 3 148
AF-A0A7Y5F9D7-F1-model_v4 DUF1569 domain-containing protein 0.9432 1 148
AF-A0A7W1BJF4-F1-model_v4 DUF1569 domain-containing protein 0.9427 1 148
AF-A0A7W0LG96-F1-model_v4 DUF1569 domain-containing protein 0.9423 1 148

Map