F434644

General Info

Members Datasets Scaffolds Average Seq Length
400 218 800 140

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0000216|Ga0453684_0000216_128438_128869
Length 143
Sequence MPVFLTRQIHFNLARRIHNPALSEEENRRIYGEANNPHGFGHNVSLEASVGGEVDPETGMVMNLVDLDRILRQEVHDRFDHRNVNLDVPPFDRLPPTAENLALWMWERIAGALPTGVRLAHLRLQLTRDFRVDLGDPGLAGDL

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
160 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
164 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
165 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
166 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
167 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
168 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
169 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
172 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
173 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
174 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
175 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
176 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
177 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
178 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
179 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
189 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
190 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
191 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
192 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
193 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
194 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
195 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
196 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
197 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
198 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
199 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
200 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
201 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
202 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
203 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
204 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
205 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
206 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
207 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
208 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
209 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
210 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
211 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
212 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
213 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
216 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
217 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.5
Rhizosphere 97.75
Stem 0
Stem Tuber 0
Unclassified 34.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0000216 3300044712 Bacteria 250915
2 JGI25406J46586_10020979 3300003203 Bacteria 2629
3 Ga0065712_10077645 3300005290 Bacteria 3463
4 Ga0065715_10004145 3300005293 Bacteria 5681
5 Ga0065715_10472897 3300005293 Unclassified 804
6 Ga0070658_10769553 3300005327 Archaea 836
7 Ga0070658_10860814 3300005327 Bacteria 788
8 Ga0070676_10240941 3300005328 Bacteria 1203
9 Ga0070676_10311574 3300005328 Bacteria 1070
10 Ga0070683_100070971 3300005329 Bacteria 3250
11 Ga0070683_100117866 3300005329 Unclassified 2507
12 Ga0070690_100280307 3300005330 Bacteria 1189
13 Ga0070690_100955245 3300005330 Unclassified 673
14 Ga0070670_100354493 3300005331 Bacteria 1289
15 Ga0070670_100649543 3300005331 Bacteria 946
16 Ga0070666_10313161 3300005335 Bacteria 1119
17 Ga0070680_100081408 3300005336 Bacteria 2671
18 Ga0070680_100168194 3300005336 Bacteria 1844
19 Ga0070680_100407192 3300005336 Unclassified 1160
20 Ga0070680_100496411 3300005336 Archaea 1044
21 Ga0070682_100221191 3300005337 Bacteria 1348
22 Ga0070682_101871014 3300005337 Bacteria 525
23 Ga0068868_100073075 3300005338 Unclassified 2737
24 Ga0070691_10188981 3300005341 Unclassified 1076
25 Ga0070691_10607812 3300005341 Unclassified 646
26 Ga0070661_100049928 3300005344 Bacteria 3062
27 Ga0070661_100147688 3300005344 Bacteria 1776
28 Ga0070661_100750944 3300005344 Unclassified 798
29 Ga0070661_101199254 3300005344 Bacteria 635
30 Ga0070661_101410555 3300005344 Unclassified 586
31 Ga0070668_100001834 3300005347 Bacteria 15467
32 Ga0070669_100508502 3300005353 Unclassified 1000
33 Ga0070669_100805019 3300005353 Unclassified 799
34 Ga0070675_100153675 3300005354 Unclassified 1974
35 Ga0070675_100776334 3300005354 Unclassified 875
36 Ga0070671_100068196 3300005355 Bacteria 2966
37 Ga0070671_100238683 3300005355 Bacteria 1543
38 Ga0070674_100033424 3300005356 Bacteria 3423
39 Ga0070674_100065876 3300005356 Bacteria 2544
40 Ga0070674_100159716 3300005356 Unclassified 1709
41 Ga0070674_100675623 3300005356 Bacteria 880
42 Ga0070673_100107116 3300005364 Unclassified 2312
43 Ga0070673_100278386 3300005364 Bacteria 1466
44 Ga0070673_100901502 3300005364 Unclassified 820
45 Ga0070688_101753485 3300005365 Unclassified 509
46 Ga0070659_100090029 3300005366 Bacteria 2459
47 Ga0070667_100007036 3300005367 Bacteria 9353
48 Ga0070714_100002683 3300005435 Bacteria 13108
49 Ga0070714_100022844 3300005435 Bacteria 5133
50 Ga0070713_101474270 3300005436 Unclassified 660
51 Ga0070710_10122819 3300005437 Bacteria 1574
52 Ga0070710_10889281 3300005437 Bacteria 642
53 Ga0070711_100226192 3300005439 Bacteria 1457
54 Ga0070700_100025550 3300005441 Bacteria 3478
55 Ga0070700_100124066 3300005441 Bacteria 1734
56 Ga0070694_100320241 3300005444 Archaea 1193
57 Ga0070694_100482021 3300005444 Bacteria 984
58 Ga0070708_100000180 3300005445 Bacteria 45454
59 Ga0070708_101470707 3300005445 Bacteria 635
60 Ga0070663_101307661 3300005455 Bacteria 640
61 Ga0070678_100058313 3300005456 Unclassified 2833
62 Ga0070662_100018874 3300005457 Bacteria 4672
63 Ga0070681_10003552 3300005458 Bacteria 14625
64 Ga0070681_10236740 3300005458 Bacteria 1739
65 Ga0070681_10352274 3300005458 Unclassified 1382
66 Ga0070681_10428364 3300005458 Bacteria 1235
67 Ga0070681_10503134 3300005458 Unclassified 1125
68 Ga0070681_11601284 3300005458 Archaea 577
69 Ga0068867_100007225 3300005459 Bacteria 7853
70 Ga0068867_100234331 3300005459 Unclassified 1485
71 Ga0068867_100415818 3300005459 Unclassified 1138
72 Ga0070685_10129437 3300005466 Bacteria 1577
73 Ga0070706_100066087 3300005467 Unclassified 3345
74 Ga0070706_100067088 3300005467 Bacteria 3318
75 Ga0070707_101062226 3300005468 Unclassified 775
76 Ga0070707_101614419 3300005468 Bacteria 615
77 Ga0070698_100067328 3300005471 Unclassified 3602
78 Ga0070699_100014420 3300005518 Bacteria 6795
79 Ga0070679_100001192 3300005530 Bacteria 22842
80 Ga0070679_100002296 3300005530 Bacteria 17285
81 Ga0070679_100074473 3300005530 Bacteria 3386
82 Ga0070679_100092312 3300005530 Bacteria 3015
83 Ga0070679_100212545 3300005530 Bacteria 1898
84 Ga0070679_100288188 3300005530 Unclassified 1594
85 Ga0070679_100401894 3300005530 Bacteria 1316
86 Ga0070679_100853266 3300005530 Archaea 854
87 Ga0070684_100022951 3300005535 Bacteria 5211
88 Ga0070684_100064923 3300005535 Bacteria 3203
89 Ga0070684_100141964 3300005535 Bacteria 2172
90 Ga0070684_100239157 3300005535 Bacteria 1659
91 Ga0070697_100250386 3300005536 Bacteria 1515
92 Ga0070697_100777105 3300005536 Unclassified 847
93 Ga0068853_100155421 3300005539 Bacteria 2061
94 Ga0070672_100070487 3300005543 Bacteria 2778
95 Ga0070672_100373133 3300005543 Unclassified 1219
96 Ga0070686_100642168 3300005544 Bacteria 841
97 Ga0070695_100011502 3300005545 Bacteria 5294
98 Ga0070695_100588596 3300005545 Unclassified 872
99 Ga0070695_100904506 3300005545 Archaea 713
100 Ga0070696_100000113 3300005546 Bacteria 41571
101 Ga0070696_100016866 3300005546 Bacteria 4926
102 Ga0070696_100452885 3300005546 Archaea 1013
103 Ga0070693_100024405 3300005547 Bacteria 3242
104 Ga0070693_100312085 3300005547 Bacteria 1064
105 Ga0070693_100465379 3300005547 Bacteria 890
106 Ga0068855_100110898 3300005563 Bacteria 3149
107 Ga0068855_100563939 3300005563 Bacteria 1231
108 Ga0070664_100023175 3300005564 Bacteria 5127
109 Ga0070664_100044755 3300005564 Unclassified 3738
110 Ga0070664_100336720 3300005564 Bacteria 1370
111 Ga0068854_100016136 3300005578 Bacteria 4970
112 Ga0068854_100030973 3300005578 Bacteria 3714
113 Ga0068854_100135415 3300005578 Unclassified 1885
114 Ga0068856_100048469 3300005614 Bacteria 4187
115 Ga0068856_100196607 3300005614 Unclassified 2030
116 Ga0068856_100325728 3300005614 Bacteria 1554
117 Ga0068856_101097207 3300005614 Bacteria 813
118 Ga0070702_100010226 3300005615 Unclassified 4614
119 Ga0070702_100284899 3300005615 Bacteria 1136
120 Ga0070702_100468555 3300005615 Unclassified 918
121 Ga0070702_100563687 3300005615 Unclassified 848
122 Ga0068852_100287927 3300005616 Bacteria 1586
123 Ga0068859_100228551 3300005617 Bacteria 1948
124 Ga0068859_100286206 3300005617 Bacteria 1741
125 Ga0068864_101033294 3300005618 Unclassified 816
126 Ga0068864_101984936 3300005618 Bacteria 588
127 Ga0068866_10038707 3300005718 Bacteria 2350
128 Ga0068866_10104588 3300005718 Bacteria 1568
129 Ga0068866_10229933 3300005718 Bacteria 1124
130 Ga0068851_10265640 3300005834 Bacteria 977
131 Ga0068858_100023427 3300005842 Bacteria 5752
132 Ga0068858_100381715 3300005842 Unclassified 1352
133 Ga0068860_100071022 3300005843 Bacteria 3309
134 Ga0068860_100306876 3300005843 Unclassified 1556
135 Ga0068860_101644487 3300005843 Bacteria 664
136 Ga0081539_10000174 3300005985 Bacteria 151265
137 Ga0070716_100006661 3300006173 Bacteria 5652
138 Ga0068871_101330085 3300006358 Bacteria 676
139 Ga0075433_10255396 3300006852 Bacteria 1555
140 Ga0068865_100004136 3300006881 Bacteria 8724
141 Ga0068865_100006794 3300006881 Bacteria 7004
142 Ga0068865_100052737 3300006881 Unclassified 2820
143 Ga0075436_100014600 3300006914 Bacteria 5384
144 Ga0075436_100041561 3300006914 Unclassified 3173
145 Ga0075436_100053880 3300006914 Bacteria 2777
146 Ga0097620_100228555 3300006931 Bacteria 1948
147 Ga0097620_100286171 3300006931 Bacteria 1741
148 Ga0075435_100659707 3300007076 Unclassified 908
149 Ga0099795_10016636 3300007788 Bacteria 2330
150 Ga0105240_10005639 3300009093 Bacteria 18584
151 Ga0105240_10107336 3300009093 Unclassified 3385
152 Ga0105245_10335561 3300009098 Bacteria 1493
153 Ga0105245_10393859 3300009098 Bacteria 1383
154 Ga0105245_11332693 3300009098 Bacteria 767
155 Ga0105243_10031193 3300009148 Bacteria 4108
156 Ga0105243_11543620 3300009148 Unclassified 689
157 Ga0105242_10007428 3300009176 Bacteria 8437
158 Ga0105248_10005452 3300009177 Bacteria 13980
159 Ga0105248_10028982 3300009177 Bacteria 6172
160 Ga0105248_10176017 3300009177 Unclassified 2411
161 Ga0105248_12112020 3300009177 Unclassified 641
162 Ga0105237_10355809 3300009545 Unclassified 1469
163 Ga0105237_11585201 3300009545 Unclassified 662
164 Ga0105238_10121460 3300009551 Bacteria 2592
165 Ga0105238_10835386 3300009551 Unclassified 938
166 Ga0099796_10004313 3300010159 Bacteria 3424
167 Ga0105239_10382445 3300010375 Bacteria 1591
168 Ga0105246_10638347 3300011119 Bacteria 925
169 Ga0105246_11519134 3300011119 Bacteria 630
170 Ga0157373_10126715 3300013100 Bacteria 1796
171 Ga0157373_10377010 3300013100 Bacteria 1014
172 Ga0157371_10855424 3300013102 Bacteria 688
173 Ga0157370_10006396 3300013104 Bacteria 12995
174 Ga0157370_10030983 3300013104 Bacteria 5237
175 Ga0157370_10409011 3300013104 Unclassified 1248
176 Ga0157370_10550319 3300013104 Bacteria 1058
177 Ga0157370_10939779 3300013104 Bacteria 784
178 Ga0157370_11192645 3300013104 Unclassified 687
179 Ga0157369_10117497 3300013105 Bacteria 2823
180 Ga0157378_10006407 3300013297 Bacteria 10289
181 Ga0157378_10068270 3300013297 Bacteria 3188
182 Ga0157378_10346561 3300013297 Unclassified 1450
183 Ga0157378_10684483 3300013297 Bacteria 1044
184 Ga0157378_11111265 3300013297 Bacteria 828
185 Ga0163162_10095253 3300013306 Bacteria 3063
186 Ga0157372_10028925 3300013307 Bacteria 6047
187 Ga0157372_10042935 3300013307 Bacteria 5004
188 Ga0157372_10123073 3300013307 Bacteria 2981
189 Ga0157372_10457546 3300013307 Bacteria 1487
190 Ga0157372_11811893 3300013307 Unclassified 702
191 Ga0157375_10004165 3300013308 Bacteria 12550
192 Ga0157375_10267816 3300013308 Bacteria 1870
193 Ga0163163_10095681 3300014325 Bacteria 2989
194 Ga0157380_11025789 3300014326 Bacteria 860
195 Ga0157376_10265744 3300014969 Unclassified 1609
196 Ga0207697_10440802 3300025315 Unclassified 578
197 Ga0207656_10035086 3300025321 Bacteria 2098
198 Ga0207682_10081591 3300025893 Bacteria 1387
199 Ga0207642_10059508 3300025899 Unclassified 1767
200 Ga0207642_10065638 3300025899 Bacteria 1706
201 Ga0207642_10326483 3300025899 Unclassified 898
202 Ga0207699_10822978 3300025906 Bacteria 683
203 Ga0207645_10003327 3300025907 Bacteria 12262
204 Ga0207645_10214491 3300025907 Bacteria 1268
205 Ga0207645_10403078 3300025907 Bacteria 920
206 Ga0207705_10170709 3300025909 Unclassified 1637
207 Ga0207705_11130743 3300025909 Bacteria 602
208 Ga0207684_10063215 3300025910 Unclassified 3143
209 Ga0207654_10267458 3300025911 Unclassified 1152
210 Ga0207707_10007045 3300025912 Bacteria 9803
211 Ga0207707_10034842 3300025912 Bacteria 4403
212 Ga0207707_10036393 3300025912 Bacteria 4304
213 Ga0207707_10269574 3300025912 Bacteria 1476
214 Ga0207707_11483338 3300025912 Archaea 538
215 Ga0207695_10052640 3300025913 Bacteria 4263
216 Ga0207695_10272178 3300025913 Bacteria 1589
217 Ga0207695_11230919 3300025913 Bacteria 629
218 Ga0207671_10809774 3300025914 Unclassified 743
219 Ga0207693_10524444 3300025915 Archaea 924
220 Ga0207663_10860562 3300025916 Bacteria 724
221 Ga0207660_10018894 3300025917 Bacteria 4602
222 Ga0207660_10150085 3300025917 Unclassified 1790
223 Ga0207660_10262886 3300025917 Bacteria 1365
224 Ga0207660_10419357 3300025917 Bacteria 1079
225 Ga0207660_11146443 3300025917 Archaea 633
226 Ga0207662_10106119 3300025918 Bacteria 1747
227 Ga0207657_10190201 3300025919 Bacteria 1656
228 Ga0207649_10088020 3300025920 Bacteria 2027
229 Ga0207649_11362038 3300025920 Unclassified 561
230 Ga0207652_10000636 3300025921 Bacteria 34690
231 Ga0207652_10193012 3300025921 Bacteria 1832
232 Ga0207652_10195247 3300025921 Bacteria 1821
233 Ga0207652_10199180 3300025921 Unclassified 1802
234 Ga0207652_10619675 3300025921 Unclassified 969
235 Ga0207652_10623958 3300025921 Bacteria 965
236 Ga0207681_10158551 3300025923 Unclassified 1703
237 Ga0207681_10598718 3300025923 Unclassified 911
238 Ga0207694_10071962 3300025924 Bacteria 2702
239 Ga0207650_10859399 3300025925 Bacteria 770
240 Ga0207687_10041605 3300025927 Unclassified 3156
241 Ga0207687_10153288 3300025927 Unclassified 1761
242 Ga0207664_10076002 3300025929 Bacteria 2717
243 Ga0207664_10129898 3300025929 Unclassified 2119
244 Ga0207644_10529742 3300025931 Bacteria 974
245 Ga0207706_10002195 3300025933 Bacteria 19021
246 Ga0207706_10319949 3300025933 Bacteria 1350
247 Ga0207709_10110016 3300025935 Unclassified 1840
248 Ga0207669_10054155 3300025937 Bacteria 2422
249 Ga0207669_10387281 3300025937 Unclassified 1091
250 Ga0207669_10763875 3300025937 Unclassified 799
251 Ga0207704_10035623 3300025938 Bacteria 2854
252 Ga0207704_10332050 3300025938 Unclassified 1177
253 Ga0207665_10002276 3300025939 Bacteria 12965
254 Ga0207665_10859514 3300025939 Archaea 718
255 Ga0207691_10009404 3300025940 Bacteria 9387
256 Ga0207691_10160061 3300025940 Unclassified 1975
257 Ga0207691_10249747 3300025940 Bacteria 1532
258 Ga0207711_10006653 3300025941 Bacteria 9736
259 Ga0207689_10119514 3300025942 Unclassified 2168
260 Ga0207661_10038821 3300025944 Unclassified 3735
261 Ga0207661_10051631 3300025944 Bacteria 3281
262 Ga0207661_10161285 3300025944 Bacteria 1945
263 Ga0207661_10298760 3300025944 Bacteria 1443
264 Ga0207661_10410803 3300025944 Bacteria 1228
265 Ga0207679_10007044 3300025945 Bacteria 7128
266 Ga0207679_10681783 3300025945 Unclassified 931
267 Ga0207667_10101719 3300025949 Unclassified 2964
268 Ga0207651_10515931 3300025960 Unclassified 1035
269 Ga0207651_12049360 3300025960 Unclassified 514
270 Ga0207668_10273240 3300025972 Bacteria 1382
271 Ga0207668_10506103 3300025972 Bacteria 1040
272 Ga0207640_10551427 3300025981 Bacteria 968
273 Ga0207640_11291913 3300025981 Unclassified 651
274 Ga0207640_11771020 3300025981 Bacteria 558
275 Ga0207658_10008761 3300025986 Bacteria 6870
276 Ga0207658_10774273 3300025986 Bacteria 870
277 Ga0207677_10052316 3300026023 Unclassified 2774
278 Ga0207677_10423596 3300026023 Bacteria 1134
279 Ga0207703_10053425 3300026035 Bacteria 3284
280 Ga0207639_10138177 3300026041 Bacteria 2027
281 Ga0207678_10191072 3300026067 Bacteria 1750
282 Ga0207708_10041599 3300026075 Bacteria 3503
283 Ga0207702_10117719 3300026078 Bacteria 2373
284 Ga0207702_10264538 3300026078 Bacteria 1620
285 Ga0207702_10438493 3300026078 Unclassified 1266
286 Ga0207702_11136788 3300026078 Bacteria 775
287 Ga0207641_10414638 3300026088 Bacteria 1296
288 Ga0207648_10002747 3300026089 Bacteria 18704
289 Ga0207648_10281188 3300026089 Unclassified 1488
290 Ga0207648_10586119 3300026089 Unclassified 1027
291 Ga0207676_10870546 3300026095 Unclassified 882
292 Ga0207676_11266017 3300026095 Bacteria 732
293 Ga0207676_11893879 3300026095 Bacteria 595
294 Ga0207683_10003858 3300026121 Bacteria 13009
295 Ga0207683_10530887 3300026121 Bacteria 1088
296 Ga0207698_10152306 3300026142 Unclassified 2009
297 Ga0207698_10200876 3300026142 Unclassified 1785
298 Ga0207698_10850411 3300026142 Unclassified 917
299 Ga0209179_1047795 3300027512 Unclassified 912
300 Ga0268265_10779760 3300028380 Unclassified 930
301 Ga0268264_10053380 3300028381 Bacteria 3372
302 Ga0268264_10243214 3300028381 Unclassified 1668
303 Ga0268264_11143025 3300028381 Bacteria 788
304 Ga0307408_100131093 3300031548 Bacteria 1956
305 Ga0307408_100348956 3300031548 Bacteria 1255
306 Ga0307408_101093785 3300031548 Bacteria 739
307 Ga0307405_10000752 3300031731 Bacteria 12631
308 Ga0307405_10006571 3300031731 Bacteria 5730
309 Ga0307405_10079632 3300031731 Bacteria 2136
310 Ga0307405_10219040 3300031731 Bacteria 1395
311 Ga0307413_10001411 3300031824 Bacteria 9083
312 Ga0307413_10010440 3300031824 Bacteria 4505
313 Ga0307410_10648364 3300031852 Bacteria 885
314 Ga0307410_11001938 3300031852 Bacteria 720
315 Ga0307410_11467284 3300031852 Unclassified 600
316 Ga0307406_10004861 3300031901 Bacteria 7321
317 Ga0307406_10005539 3300031901 Bacteria 6906
318 Ga0307406_10015395 3300031901 Bacteria 4425
319 Ga0307406_10706476 3300031901 Bacteria 842
320 Ga0307407_10007205 3300031903 Bacteria 5020
321 Ga0307407_10113234 3300031903 Unclassified 1707
322 Ga0307412_10114378 3300031911 Unclassified 1932
323 Ga0307409_100000357 3300031995 Bacteria 19077
324 Ga0307409_100022038 3300031995 Bacteria 4383
325 Ga0307409_100041843 3300031995 Bacteria 3426
326 Ga0307409_100990858 3300031995 Bacteria 858
327 Ga0307416_100003409 3300032002 Bacteria 9326
328 Ga0307416_100009979 3300032002 Bacteria 6249
329 Ga0307416_100078318 3300032002 Bacteria 2780
330 Ga0307416_103189364 3300032002 Bacteria 549
331 Ga0307414_10001989 3300032004 Bacteria 10605
332 Ga0307411_10005565 3300032005 Bacteria 6205
333 Ga0307411_10728494 3300032005 Bacteria 866
334 Ga0307415_100001197 3300032126 Bacteria 12144
335 Ga0307415_100017543 3300032126 Bacteria 4296
336 Ga0373949_0122144 3300035090 Unclassified 732
337 Ga0373949_0164576 3300035090 Unclassified 649
338 Ga0373939_0271591 3300035114 Unclassified 667
339 Ga0373943_0226984 3300035170 Bacteria 1042
340 Ga0373935_0074339 3300035692 Unclassified 2197
341 Ga0373927_0004157 3300035695 Bacteria 10175
342 Ga0436365_0061065 3300039437 Bacteria 2456
343 Ga0436365_0919604 3300039437 Bacteria 2971
344 Ga0451835_0188428 3300041492 Archaea 568
345 Ga0439446_0383249 3300042156 Bacteria 505
346 Ga0451577_0001351 3300042876 Bacteria 33131
347 Ga0451577_0251812 3300042876 Bacteria 1599
348 Ga0466957_1084303 3300044842 Bacteria 577
349 Ga0466967_2386531 3300045976 Unclassified 524
350 Ga0495603_0437633 3300046455 Unclassified 749
351 Ga0495582_0541049 3300046473 Bacteria 673
352 Ga0495664_0861215 3300046477 Unclassified 531
353 Ga0495594_0114409 3300046499 Bacteria 1523
354 Ga0495594_0200552 3300046499 Unclassified 1137
355 Ga0495628_0320766 3300046516 Unclassified 1143
356 Ga0495663_0094751 3300046525 Bacteria 977
357 Ga0495645_0045053 3300046543 Unclassified 3218
358 Ga0495659_0074657 3300046664 Unclassified 1276
359 Ga0495613_0591605 3300046689 Unclassified 739
360 Ga0495675_0320537 3300047444 Unclassified 917
361 Ga0496105_0080714 3300048908 Bacteria 2687
362 Ga0496106_0183245 3300048909 Unclassified 1663
363 Ga0496107_0047875 3300048910 Unclassified 3079
364 Ga0496109_0355233 3300048912 Bacteria 1385
365 Ga0496112_0124316 3300048915 Unclassified 2550
366 Ga0496112_0240918 3300048915 Unclassified 1761
367 Ga0501032_0119312 3300049569 Unclassified 1744
368 Ga0501033_0005356 3300049570 Bacteria 10166
369 Ga0501040_0218671 3300049576 Unclassified 1355
370 Ga0501202_011960 3300049652 Bacteria 1632
371 Ga0501207_017441 3300049654 Unclassified 1121
372 Ga0501209_100236 3300049656 Unclassified 849
373 Ga0501214_006423 3300049659 Bacteria 1168
374 Ga0501216_009076 3300049660 Unclassified 1579
375 Ga0501217_006942 3300049661 Unclassified 2419
376 Ga0501222_031997 3300049662 Unclassified 725
377 Ga0501223_007936 3300049663 Unclassified 2166
378 Ga0501227_021077 3300049665 Unclassified 1500
379 Ga0501228_003075 3300049666 Unclassified 1352
380 Ga0501235_006800 3300049669 Bacteria 2489
381 Ga0501243_001540 3300049675 Unclassified 3303
382 Ga0501249_035618 3300049679 Bacteria 1119
383 Ga0501257_015281 3300049686 Unclassified 1771
384 Ga0501225_0010079 3300049705 Unclassified 2682
385 Ga0501234_000799 3300049707 Bacteria 4927
386 Ga0501245_003162 3300049708 Unclassified 2225
387 Ga0501232_004674 3300049757 Unclassified 1323
388 Ga0501267_004309 3300049764 Unclassified 1319
389 Ga0501268_001431 3300049765 Bacteria 2979
390 Ga0501270_002690 3300049767 Unclassified 1847
391 Ga0501272_011642 3300049769 Unclassified 993
392 Ga0501274_050928 3300049771 Bacteria 520
393 Ga0501275_004827 3300049772 Unclassified 1278
394 Ga0501278_032378 3300049774 Unclassified 537
395 Ga0501035_0230099 3300049822 Unclassified 1580
396 Ga0501044_0007739 3300049823 Bacteria 11813
397 nmdc:mga0rr50_422242_c1 3300050513 Unclassified 1128
398 nmdc:mga08x19_2197_c1 3300050514 Bacteria 11933
399 Ga0495601_0090057 3300053077 Unclassified 1973
400 Ga0495619_0284850 3300053085 Unclassified 1145
401 Ga0453684_0000216
402 JGI25406J46586_10020979
403 Ga0065712_10077645
404 Ga0065715_10004145
405 Ga0065715_10472897
406 Ga0070658_10769553
407 Ga0070658_10860814
408 Ga0070676_10240941
409 Ga0070676_10311574
410 Ga0070683_100070971
411 Ga0070683_100117866
412 Ga0070690_100280307
413 Ga0070690_100955245
414 Ga0070670_100354493
415 Ga0070670_100649543
416 Ga0070666_10313161
417 Ga0070680_100081408
418 Ga0070680_100168194
419 Ga0070680_100407192
420 Ga0070680_100496411
421 Ga0070682_100221191
422 Ga0070682_101871014
423 Ga0068868_100073075
424 Ga0070691_10188981
425 Ga0070691_10607812
426 Ga0070661_100049928
427 Ga0070661_100147688
428 Ga0070661_100750944
429 Ga0070661_101199254
430 Ga0070661_101410555
431 Ga0070668_100001834
432 Ga0070669_100508502
433 Ga0070669_100805019
434 Ga0070675_100153675
435 Ga0070675_100776334
436 Ga0070671_100068196
437 Ga0070671_100238683
438 Ga0070674_100033424
439 Ga0070674_100065876
440 Ga0070674_100159716
441 Ga0070674_100675623
442 Ga0070673_100107116
443 Ga0070673_100278386
444 Ga0070673_100901502
445 Ga0070688_101753485
446 Ga0070659_100090029
447 Ga0070667_100007036
448 Ga0070714_100002683
449 Ga0070714_100022844
450 Ga0070713_101474270
451 Ga0070710_10122819
452 Ga0070710_10889281
453 Ga0070711_100226192
454 Ga0070700_100025550
455 Ga0070700_100124066
456 Ga0070694_100320241
457 Ga0070694_100482021
458 Ga0070708_100000180
459 Ga0070708_101470707
460 Ga0070663_101307661
461 Ga0070678_100058313
462 Ga0070662_100018874
463 Ga0070681_10003552
464 Ga0070681_10236740
465 Ga0070681_10352274
466 Ga0070681_10428364
467 Ga0070681_10503134
468 Ga0070681_11601284
469 Ga0068867_100007225
470 Ga0068867_100234331
471 Ga0068867_100415818
472 Ga0070685_10129437
473 Ga0070706_100066087
474 Ga0070706_100067088
475 Ga0070707_101062226
476 Ga0070707_101614419
477 Ga0070698_100067328
478 Ga0070699_100014420
479 Ga0070679_100001192
480 Ga0070679_100002296
481 Ga0070679_100074473
482 Ga0070679_100092312
483 Ga0070679_100212545
484 Ga0070679_100288188
485 Ga0070679_100401894
486 Ga0070679_100853266
487 Ga0070684_100022951
488 Ga0070684_100064923
489 Ga0070684_100141964
490 Ga0070684_100239157
491 Ga0070697_100250386
492 Ga0070697_100777105
493 Ga0068853_100155421
494 Ga0070672_100070487
495 Ga0070672_100373133
496 Ga0070686_100642168
497 Ga0070695_100011502
498 Ga0070695_100588596
499 Ga0070695_100904506
500 Ga0070696_100000113
501 Ga0070696_100016866
502 Ga0070696_100452885
503 Ga0070693_100024405
504 Ga0070693_100312085
505 Ga0070693_100465379
506 Ga0068855_100110898
507 Ga0068855_100563939
508 Ga0070664_100023175
509 Ga0070664_100044755
510 Ga0070664_100336720
511 Ga0068854_100016136
512 Ga0068854_100030973
513 Ga0068854_100135415
514 Ga0068856_100048469
515 Ga0068856_100196607
516 Ga0068856_100325728
517 Ga0068856_101097207
518 Ga0070702_100010226
519 Ga0070702_100284899
520 Ga0070702_100468555
521 Ga0070702_100563687
522 Ga0068852_100287927
523 Ga0068859_100228551
524 Ga0068859_100286206
525 Ga0068864_101033294
526 Ga0068864_101984936
527 Ga0068866_10038707
528 Ga0068866_10104588
529 Ga0068866_10229933
530 Ga0068851_10265640
531 Ga0068858_100023427
532 Ga0068858_100381715
533 Ga0068860_100071022
534 Ga0068860_100306876
535 Ga0068860_101644487
536 Ga0081539_10000174
537 Ga0070716_100006661
538 Ga0068871_101330085
539 Ga0075433_10255396
540 Ga0068865_100004136
541 Ga0068865_100006794
542 Ga0068865_100052737
543 Ga0075436_100014600
544 Ga0075436_100041561
545 Ga0075436_100053880
546 Ga0097620_100228555
547 Ga0097620_100286171
548 Ga0075435_100659707
549 Ga0099795_10016636
550 Ga0105240_10005639
551 Ga0105240_10107336
552 Ga0105245_10335561
553 Ga0105245_10393859
554 Ga0105245_11332693
555 Ga0105243_10031193
556 Ga0105243_11543620
557 Ga0105242_10007428
558 Ga0105248_10005452
559 Ga0105248_10028982
560 Ga0105248_10176017
561 Ga0105248_12112020
562 Ga0105237_10355809
563 Ga0105237_11585201
564 Ga0105238_10121460
565 Ga0105238_10835386
566 Ga0099796_10004313
567 Ga0105239_10382445
568 Ga0105246_10638347
569 Ga0105246_11519134
570 Ga0157373_10126715
571 Ga0157373_10377010
572 Ga0157371_10855424
573 Ga0157370_10006396
574 Ga0157370_10030983
575 Ga0157370_10409011
576 Ga0157370_10550319
577 Ga0157370_10939779
578 Ga0157370_11192645
579 Ga0157369_10117497
580 Ga0157378_10006407
581 Ga0157378_10068270
582 Ga0157378_10346561
583 Ga0157378_10684483
584 Ga0157378_11111265
585 Ga0163162_10095253
586 Ga0157372_10028925
587 Ga0157372_10042935
588 Ga0157372_10123073
589 Ga0157372_10457546
590 Ga0157372_11811893
591 Ga0157375_10004165
592 Ga0157375_10267816
593 Ga0163163_10095681
594 Ga0157380_11025789
595 Ga0157376_10265744
596 Ga0207697_10440802
597 Ga0207656_10035086
598 Ga0207682_10081591
599 Ga0207642_10059508
600 Ga0207642_10065638
601 Ga0207642_10326483
602 Ga0207699_10822978
603 Ga0207645_10003327
604 Ga0207645_10214491
605 Ga0207645_10403078
606 Ga0207705_10170709
607 Ga0207705_11130743
608 Ga0207684_10063215
609 Ga0207654_10267458
610 Ga0207707_10007045
611 Ga0207707_10034842
612 Ga0207707_10036393
613 Ga0207707_10269574
614 Ga0207707_11483338
615 Ga0207695_10052640
616 Ga0207695_10272178
617 Ga0207695_11230919
618 Ga0207671_10809774
619 Ga0207693_10524444
620 Ga0207663_10860562
621 Ga0207660_10018894
622 Ga0207660_10150085
623 Ga0207660_10262886
624 Ga0207660_10419357
625 Ga0207660_11146443
626 Ga0207662_10106119
627 Ga0207657_10190201
628 Ga0207649_10088020
629 Ga0207649_11362038
630 Ga0207652_10000636
631 Ga0207652_10193012
632 Ga0207652_10195247
633 Ga0207652_10199180
634 Ga0207652_10619675
635 Ga0207652_10623958
636 Ga0207681_10158551
637 Ga0207681_10598718
638 Ga0207694_10071962
639 Ga0207650_10859399
640 Ga0207687_10041605
641 Ga0207687_10153288
642 Ga0207664_10076002
643 Ga0207664_10129898
644 Ga0207644_10529742
645 Ga0207706_10002195
646 Ga0207706_10319949
647 Ga0207709_10110016
648 Ga0207669_10054155
649 Ga0207669_10387281
650 Ga0207669_10763875
651 Ga0207704_10035623
652 Ga0207704_10332050
653 Ga0207665_10002276
654 Ga0207665_10859514
655 Ga0207691_10009404
656 Ga0207691_10160061
657 Ga0207691_10249747
658 Ga0207711_10006653
659 Ga0207689_10119514
660 Ga0207661_10038821
661 Ga0207661_10051631
662 Ga0207661_10161285
663 Ga0207661_10298760
664 Ga0207661_10410803
665 Ga0207679_10007044
666 Ga0207679_10681783
667 Ga0207667_10101719
668 Ga0207651_10515931
669 Ga0207651_12049360
670 Ga0207668_10273240
671 Ga0207668_10506103
672 Ga0207640_10551427
673 Ga0207640_11291913
674 Ga0207640_11771020
675 Ga0207658_10008761
676 Ga0207658_10774273
677 Ga0207677_10052316
678 Ga0207677_10423596
679 Ga0207703_10053425
680 Ga0207639_10138177
681 Ga0207678_10191072
682 Ga0207708_10041599
683 Ga0207702_10117719
684 Ga0207702_10264538
685 Ga0207702_10438493
686 Ga0207702_11136788
687 Ga0207641_10414638
688 Ga0207648_10002747
689 Ga0207648_10281188
690 Ga0207648_10586119
691 Ga0207676_10870546
692 Ga0207676_11266017
693 Ga0207676_11893879
694 Ga0207683_10003858
695 Ga0207683_10530887
696 Ga0207698_10152306
697 Ga0207698_10200876
698 Ga0207698_10850411
699 Ga0209179_1047795
700 Ga0268265_10779760
701 Ga0268264_10053380
702 Ga0268264_10243214
703 Ga0268264_11143025
704 Ga0307408_100131093
705 Ga0307408_100348956
706 Ga0307408_101093785
707 Ga0307405_10000752
708 Ga0307405_10006571
709 Ga0307405_10079632
710 Ga0307405_10219040
711 Ga0307413_10001411
712 Ga0307413_10010440
713 Ga0307410_10648364
714 Ga0307410_11001938
715 Ga0307410_11467284
716 Ga0307406_10004861
717 Ga0307406_10005539
718 Ga0307406_10015395
719 Ga0307406_10706476
720 Ga0307407_10007205
721 Ga0307407_10113234
722 Ga0307412_10114378
723 Ga0307409_100000357
724 Ga0307409_100022038
725 Ga0307409_100041843
726 Ga0307409_100990858
727 Ga0307416_100003409
728 Ga0307416_100009979
729 Ga0307416_100078318
730 Ga0307416_103189364
731 Ga0307414_10001989
732 Ga0307411_10005565
733 Ga0307411_10728494
734 Ga0307415_100001197
735 Ga0307415_100017543
736 Ga0373949_0122144
737 Ga0373949_0164576
738 Ga0373939_0271591
739 Ga0373943_0226984
740 Ga0373935_0074339
741 Ga0373927_0004157
742 Ga0436365_0061065
743 Ga0436365_0919604
744 Ga0451835_0188428
745 Ga0439446_0383249
746 Ga0451577_0001351
747 Ga0451577_0251812
748 Ga0466957_1084303
749 Ga0466967_2386531
750 Ga0495603_0437633
751 Ga0495582_0541049
752 Ga0495664_0861215
753 Ga0495594_0114409
754 Ga0495594_0200552
755 Ga0495628_0320766
756 Ga0495663_0094751
757 Ga0495645_0045053
758 Ga0495659_0074657
759 Ga0495613_0591605
760 Ga0495675_0320537
761 Ga0496105_0080714
762 Ga0496106_0183245
763 Ga0496107_0047875
764 Ga0496109_0355233
765 Ga0496112_0124316
766 Ga0496112_0240918
767 Ga0501032_0119312
768 Ga0501033_0005356
769 Ga0501040_0218671
770 Ga0501202_011960
771 Ga0501207_017441
772 Ga0501209_100236
773 Ga0501214_006423
774 Ga0501216_009076
775 Ga0501217_006942
776 Ga0501222_031997
777 Ga0501223_007936
778 Ga0501227_021077
779 Ga0501228_003075
780 Ga0501235_006800
781 Ga0501243_001540
782 Ga0501249_035618
783 Ga0501257_015281
784 Ga0501225_0010079
785 Ga0501234_000799
786 Ga0501245_003162
787 Ga0501232_004674
788 Ga0501267_004309
789 Ga0501268_001431
790 Ga0501270_002690
791 Ga0501272_011642
792 Ga0501274_050928
793 Ga0501275_004827
794 Ga0501278_032378
795 Ga0501035_0230099
796 Ga0501044_0007739
797 nmdc:mga0rr50_422242_c1
798 nmdc:mga08x19_2197_c1
799 Ga0495601_0090057
800 Ga0495619_0284850

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01242

PTPS

6-pyruvoyl tetrahydropterin synthase

4

133

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1b66-assembly1.cif.gz_A 6-pyruvoyl tetrahydropterin synthase 0.948 2 139
2g64-assembly1.cif.gz_A structure of caenorhabditis elegans 6-pyruvoyl tetrahydropterin synthase 0.9455 1 139
3i2b-assembly3.cif.gz_I the crystal structure of human 6 pyruvoyl tetrahydrobiopterin synthase 0.9451 2 139
1b66-assembly1.cif.gz_A 6-pyruvoyl tetrahydropterin synthase 0.9216 2 139
2g64-assembly1.cif.gz_A structure of caenorhabditis elegans 6-pyruvoyl tetrahydropterin synthase 0.9195 1 139
ID Description Score Start End Superfamily
2g64A00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9455 1 139 3.30.479.10
af_Q1ZXI0_1_135_3.30.479.10 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9454 2 139 3.30.479.10
2g64A00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9195 1 139 3.30.479.10
af_Q1ZXI0_1_135_3.30.479.10 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9186 2 139 3.30.479.10
4ntmA00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8972 4 139 3.30.479.10
ID Description Score Start End GO Terms
AF-A0A7W1ENX6-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9853 2 139 GO:0016829
GO:0046872
AF-A0A2V7HGF6-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9839 1 139 GO:0046872
GO:0070497
AF-A0A2V7RV96-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9829 2 109 GO:0046872
GO:0070497
AF-A0A2V7SVC0-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9828 3 139 GO:0046872
GO:0070497
AF-A0A258L0I8-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.978 4 87 GO:0046872
GO:0070497

Map