F434626

General Info

Members Datasets Scaffolds Average Seq Length
400 214 800 315

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0001601|Ga0395899_0001601_1941_3023
Length 360
Sequence MDQAYGANASAQLELHWRDVRSQAAERALLPSPAVSASAASAAEPQRRIRPRLIYGVAAVLLLIAAILSFGDVGEKAGRLSDWQAFVLGVTQGLTELLPISSSGHLILVPWIADWHYLEVHPDFNKTFDVALHLGTLIAVVAYFWADVVLYVKAWLRSVAHRSVDTVDEKISWWIFAATIPAAIAGALGEDTIENHLGQPYQIAVFLAVFGVLLYAADRFPQERTIGQLGFWRAFAIGVSQILALMPGVSRSGITITTGRFQRLDRDAAARFAFLLLIPIVFGAVVYKGFKHVVLNSLPAGSIGPFVVGTMAAAAVGLIAIDLLLGYLRRHDYTIFVIYRLVLAAAILIVIASGWRGAHF

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
140 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
141 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
142 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
143 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
144 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
145 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
149 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
150 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
151 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
152 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
153 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
154 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
155 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
156 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
157 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
158 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
186 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
187 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
194 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
195 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
200 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
201 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
209 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
211 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
212 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
213 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
214 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.5
Nodule 0
Rhizoplane 8
Rhizosphere 91.25
Stem 0
Stem Tuber 0
Unclassified 8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0001601 3300037312 Bacteria 18987
2 Ga0070658_10090052 3300005327 Bacteria 2527
3 Ga0070683_100221981 3300005329 Unclassified 1796
4 Ga0070683_100268307 3300005329 Unclassified 1623
5 Ga0070690_100046508 3300005330 Bacteria 2759
6 Ga0070690_100201210 3300005330 Bacteria 1386
7 Ga0070680_100010255 3300005336 Bacteria 7223
8 Ga0070682_100012438 3300005337 Bacteria 4882
9 Ga0068868_100174315 3300005338 Bacteria 1782
10 Ga0068868_100228540 3300005338 Bacteria 1560
11 Ga0070660_100000691 3300005339 Bacteria 22340
12 Ga0070660_100196746 3300005339 Bacteria 1634
13 Ga0070689_100185649 3300005340 Bacteria 1691
14 Ga0070691_10027613 3300005341 Bacteria 2649
15 Ga0070687_100102585 3300005343 Bacteria 1604
16 Ga0070692_10060519 3300005345 Bacteria 1993
17 Ga0070668_100044773 3300005347 Bacteria 3395
18 Ga0070669_100162667 3300005353 Bacteria 1735
19 Ga0070675_100398715 3300005354 Bacteria 1227
20 Ga0070671_100115255 3300005355 Bacteria 2259
21 Ga0070674_100204714 3300005356 Bacteria 1526
22 Ga0070688_100256143 3300005365 Unclassified 1248
23 Ga0070703_10014050 3300005406 Bacteria 2277
24 Ga0070701_10035902 3300005438 Bacteria 2494
25 Ga0070701_10104828 3300005438 Bacteria 1571
26 Ga0070705_100038884 3300005440 Bacteria 2696
27 Ga0070705_100205896 3300005440 Bacteria 1352
28 Ga0070700_100005496 3300005441 Bacteria 6723
29 Ga0070700_100025740 3300005441 Bacteria 3467
30 Ga0070694_100295572 3300005444 Bacteria 1239
31 Ga0070662_100026331 3300005457 Bacteria 4027
32 Ga0070662_100037992 3300005457 Bacteria 3417
33 Ga0070662_100381111 3300005457 Unclassified 1161
34 Ga0070681_10000130 3300005458 Bacteria 56536
35 Ga0070681_10024209 3300005458 Bacteria 6113
36 Ga0070685_10211517 3300005466 Unclassified 1266
37 Ga0070698_100110114 3300005471 Unclassified 2719
38 Ga0070679_100054767 3300005530 Bacteria 3972
39 Ga0070679_100162323 3300005530 Bacteria 2209
40 Ga0070679_100231081 3300005530 Bacteria 1809
41 Ga0070679_100344959 3300005530 Bacteria 1437
42 Ga0070684_100224906 3300005535 Bacteria 1712
43 Ga0070684_100230841 3300005535 Unclassified 1690
44 Ga0068853_100101223 3300005539 Bacteria 2548
45 Ga0070686_100042646 3300005544 Bacteria 2843
46 Ga0070696_100024790 3300005546 Bacteria 4076
47 Ga0070693_100031928 3300005547 Bacteria 2891
48 Ga0070693_100049110 3300005547 Bacteria 2405
49 Ga0070693_100159398 3300005547 Unclassified 1436
50 Ga0070665_100068052 3300005548 Bacteria 3570
51 Ga0070704_100061031 3300005549 Bacteria 2696
52 Ga0068855_100013818 3300005563 Bacteria 9734
53 Ga0068855_100047350 3300005563 Bacteria 5079
54 Ga0070664_100201885 3300005564 Bacteria 1774
55 Ga0068857_100026560 3300005577 Bacteria 5103
56 Ga0068857_100158275 3300005577 Bacteria 2054
57 Ga0068854_100098545 3300005578 Bacteria 2188
58 Ga0068854_100105706 3300005578 Bacteria 2117
59 Ga0068856_100073638 3300005614 Bacteria 3382
60 Ga0070702_100011253 3300005615 Bacteria 4444
61 Ga0070702_100031233 3300005615 Bacteria 2912
62 Ga0068852_100329075 3300005616 Bacteria 1486
63 Ga0068852_100577393 3300005616 Bacteria 1127
64 Ga0068859_100225093 3300005617 Bacteria 1964
65 Ga0068861_100031373 3300005719 Bacteria 3903
66 Ga0068851_10123376 3300005834 Unclassified 1394
67 Ga0068863_100286465 3300005841 Unclassified 1596
68 Ga0068858_100210087 3300005842 Bacteria 1842
69 Ga0068858_100394748 3300005842 Unclassified 1329
70 Ga0068860_100086053 3300005843 Bacteria 2991
71 Ga0068862_100123516 3300005844 Bacteria 2284
72 Ga0081455_10003431 3300005937 Bacteria 18219
73 Ga0081455_10011880 3300005937 Bacteria 8719
74 Ga0081455_10100383 3300005937 Bacteria 2326
75 Ga0081455_10156540 3300005937 Bacteria 1751
76 Ga0081540_1005304 3300005983 Bacteria 9646
77 Ga0081540_1020028 3300005983 Bacteria 4039
78 Ga0081540_1026701 3300005983 Bacteria 3288
79 Ga0081539_10002405 3300005985 Bacteria 26516
80 Ga0081539_10004599 3300005985 Bacteria 15061
81 Ga0075365_10007234 3300006038 Bacteria 6201
82 Ga0075428_100035538 3300006844 Bacteria 5492
83 Ga0075428_100118215 3300006844 Bacteria 2887
84 Ga0075430_100071877 3300006846 Bacteria 2902
85 Ga0075431_100105538 3300006847 Bacteria 2907
86 Ga0075429_100007280 3300006880 Bacteria 9603
87 Ga0068865_100219587 3300006881 Bacteria 1485
88 Ga0075436_100086380 3300006914 Bacteria 2178
89 Ga0097620_100225116 3300006931 Bacteria 1964
90 Ga0075435_100038782 3300007076 Bacteria 3799
91 Ga0105240_10176091 3300009093 Bacteria 2529
92 Ga0111539_10015882 3300009094 Bacteria 9351
93 Ga0111539_10420391 3300009094 Bacteria 1557
94 Ga0111539_10608402 3300009094 Bacteria 1273
95 Ga0105245_10011070 3300009098 Bacteria 7853
96 Ga0105245_10014230 3300009098 Bacteria 6932
97 Ga0105245_10115155 3300009098 Bacteria 2505
98 Ga0105245_10123809 3300009098 Bacteria 2418
99 Ga0114129_10035556 3300009147 Bacteria 7037
100 Ga0114129_10035827 3300009147 Bacteria 7007
101 Ga0105243_10147945 3300009148 Bacteria 2012
102 Ga0105241_10054771 3300009174 Bacteria 3054
103 Ga0105241_10159243 3300009174 Bacteria 1854
104 Ga0105242_10068782 3300009176 Bacteria 2931
105 Ga0105237_10204834 3300009545 Bacteria 1973
106 Ga0105237_10237640 3300009545 Bacteria 1823
107 Ga0105238_10095792 3300009551 Bacteria 2954
108 Ga0105238_10355299 3300009551 Bacteria 1454
109 Ga0105238_10406052 3300009551 Bacteria 1356
110 Ga0105249_10002789 3300009553 Bacteria 15075
111 Ga0105249_10080157 3300009553 Bacteria 3032
112 Ga0105249_10271687 3300009553 Bacteria 1689
113 Ga0105249_10360955 3300009553 Bacteria 1474
114 Ga0105239_10058960 3300010375 Bacteria 4213
115 Ga0105246_10179772 3300011119 Bacteria 1628
116 Ga0157371_10059813 3300013102 Bacteria 2701
117 Ga0157374_10197335 3300013296 Bacteria 1970
118 Ga0157378_10404911 3300013297 Bacteria 1345
119 Ga0157378_10424674 3300013297 Bacteria 1314
120 Ga0163162_10387394 3300013306 Bacteria 1531
121 Ga0157375_10041311 3300013308 Bacteria 4452
122 Ga0157375_10058082 3300013308 Bacteria 3827
123 Ga0163163_10141610 3300014325 Bacteria 2447
124 Ga0157380_10034215 3300014326 Bacteria 3918
125 Ga0157380_10355889 3300014326 Bacteria 1372
126 Ga0157380_10536966 3300014326 Unclassified 1144
127 Ga0157377_10195767 3300014745 Bacteria 1280
128 Ga0157379_10095393 3300014968 Bacteria 2669
129 Ga0163161_10021496 3300017792 Bacteria 4534
130 Ga0206356_10684141 3300020070 Bacteria 2352
131 Ga0207642_10019008 3300025899 Bacteria 2650
132 Ga0207688_10092866 3300025901 Unclassified 1735
133 Ga0207688_10150787 3300025901 Bacteria 1373
134 Ga0207647_10152395 3300025904 Bacteria 1351
135 Ga0207643_10096136 3300025908 Bacteria 1732
136 Ga0207654_10085470 3300025911 Bacteria 1910
137 Ga0207707_10012305 3300025912 Bacteria 7436
138 Ga0207707_10078124 3300025912 Bacteria 2890
139 Ga0207660_10155103 3300025917 Bacteria 1762
140 Ga0207662_10021349 3300025918 Bacteria 3701
141 Ga0207657_10001176 3300025919 Bacteria 27761
142 Ga0207657_10002512 3300025919 Bacteria 19848
143 Ga0207652_10122215 3300025921 Bacteria 2317
144 Ga0207652_10180212 3300025921 Bacteria 1898
145 Ga0207652_10223413 3300025921 Bacteria 1697
146 Ga0207652_10259759 3300025921 Bacteria 1567
147 Ga0207681_10061736 3300025923 Bacteria 2578
148 Ga0207694_10308274 3300025924 Bacteria 1304
149 Ga0207650_10196971 3300025925 Unclassified 1612
150 Ga0207687_10039333 3300025927 Bacteria 3238
151 Ga0207687_10085858 3300025927 Bacteria 2284
152 Ga0207687_10180504 3300025927 Bacteria 1635
153 Ga0207644_10163822 3300025931 Bacteria 1730
154 Ga0207690_10072129 3300025932 Bacteria 2384
155 Ga0207706_10030025 3300025933 Bacteria 4851
156 Ga0207706_10089288 3300025933 Bacteria 2710
157 Ga0207706_10113642 3300025933 Bacteria 2382
158 Ga0207706_10149709 3300025933 Bacteria 2053
159 Ga0207706_10197602 3300025933 Bacteria 1764
160 Ga0207709_10123937 3300025935 Bacteria 1750
161 Ga0207704_10209434 3300025938 Bacteria 1433
162 Ga0207704_10268175 3300025938 Unclassified 1291
163 Ga0207691_10105790 3300025940 Bacteria 2506
164 Ga0207689_10225992 3300025942 Bacteria 1547
165 Ga0207661_10378376 3300025944 Unclassified 1281
166 Ga0207667_10197184 3300025949 Bacteria 2066
167 Ga0207712_10064844 3300025961 Bacteria 2605
168 Ga0207712_10196334 3300025961 Bacteria 1597
169 Ga0207640_10236626 3300025981 Bacteria 1408
170 Ga0207677_10030604 3300026023 Bacteria 3438
171 Ga0207639_10026643 3300026041 Bacteria 4201
172 Ga0207678_10204973 3300026067 Unclassified 1687
173 Ga0207708_10037386 3300026075 Bacteria 3698
174 Ga0207708_10078811 3300026075 Bacteria 2530
175 Ga0207648_10011001 3300026089 Bacteria 8543
176 Ga0207648_10015239 3300026089 Bacteria 7071
177 Ga0207648_10282557 3300026089 Bacteria 1484
178 Ga0207676_10295328 3300026095 Unclassified 1477
179 Ga0207674_10175678 3300026116 Bacteria 2094
180 Ga0207675_100000592 3300026118 Bacteria 35478
181 Ga0207675_100048782 3300026118 Bacteria 3952
182 Ga0207683_10040028 3300026121 Bacteria 4088
183 Ga0207698_10484446 3300026142 Bacteria 1200
184 Ga0207428_10011449 3300027907 Bacteria 7839
185 Ga0207428_10094780 3300027907 Bacteria 2313
186 Ga0268266_10009024 3300028379 Bacteria 8815
187 Ga0268265_10162752 3300028380 Bacteria 1898
188 Ga0268265_10322198 3300028380 Bacteria 1400
189 Ga0307408_100246208 3300031548 Bacteria 1472
190 Ga0307408_100259423 3300031548 Bacteria 1438
191 Ga0307405_10016940 3300031731 Bacteria 3988
192 Ga0307413_10021272 3300031824 Bacteria 3469
193 Ga0307413_10026190 3300031824 Bacteria 3210
194 Ga0307410_10008190 3300031852 Bacteria 5781
195 Ga0307410_10366244 3300031852 Bacteria 1156
196 Ga0307406_10027595 3300031901 Bacteria 3422
197 Ga0307407_10029211 3300031903 Bacteria 2958
198 Ga0307407_10126808 3300031903 Bacteria 1627
199 Ga0307412_10305512 3300031911 Bacteria 1259
200 Ga0307409_100014047 3300031995 Bacteria 5187
201 Ga0307409_100125180 3300031995 Bacteria 2185
202 Ga0307409_100128313 3300031995 Bacteria 2162
203 Ga0307416_100028599 3300032002 Bacteria 4148
204 Ga0307416_100051520 3300032002 Bacteria 3289
205 Ga0307416_100060919 3300032002 Bacteria 3076
206 Ga0307416_100085234 3300032002 Bacteria 2688
207 Ga0307414_10065046 3300032004 Bacteria 2600
208 Ga0307411_10027089 3300032005 Bacteria 3462
209 Ga0307415_100026918 3300032126 Bacteria 3635
210 Ga0307415_100072447 3300032126 Bacteria 2427
211 Ga0395899_0000690 3300037312 Bacteria 33973
212 Ga0395899_0001614 3300037312 Bacteria 18846
213 Ga0395900_0006008 3300037418 Bacteria 12665
214 Ga0395900_0006191 3300037418 Bacteria 12500
215 Ga0395900_0007252 3300037418 Bacteria 11478
216 Ga0395900_0029948 3300037418 Bacteria 5586
217 Ga0395900_0084452 3300037418 Bacteria 3262
218 Ga0395900_0176109 3300037418 Unclassified 2175
219 Ga0395900_0318478 3300037418 Bacteria 1536
220 Ga0395900_0322876 3300037418 Bacteria 1523
221 Ga0395898_0001382 3300037466 Bacteria 34742
222 Ga0395898_0028421 3300037466 Bacteria 5602
223 Ga0395898_0029690 3300037466 Bacteria 5473
224 Ga0395898_0030574 3300037466 Bacteria 5388
225 Ga0395898_0067109 3300037466 Bacteria 3474
226 Ga0395898_0087916 3300037466 Bacteria 2993
227 Ga0395898_0130721 3300037466 Bacteria 2405
228 Ga0395898_0168269 3300037466 Bacteria 2095
229 Ga0395898_0184242 3300037466 Bacteria 1995
230 Ga0395905_0006791 3300037471 Bacteria 11468
231 Ga0395905_0015226 3300037471 Bacteria 7313
232 Ga0395905_0032066 3300037471 Bacteria 4942
233 Ga0395905_0180687 3300037471 Bacteria 1981
234 Ga0395905_0216704 3300037471 Bacteria 1792
235 Ga0395905_0280729 3300037471 Bacteria 1551
236 Ga0395901_0000684 3300038443 Bacteria 38890
237 Ga0395901_0001867 3300038443 Bacteria 21768
238 Ga0395901_0005519 3300038443 Bacteria 12808
239 Ga0395901_0017959 3300038443 Bacteria 7221
240 Ga0395901_0033035 3300038443 Bacteria 5339
241 Ga0395901_0045160 3300038443 Bacteria 4571
242 Ga0395901_0075215 3300038443 Bacteria 3523
243 Ga0395901_0109344 3300038443 Unclassified 2902
244 Ga0395901_0154982 3300038443 Bacteria 2406
245 Ga0395901_0767431 3300038443 Unclassified 956
246 Ga0451853_0505702 3300041512 Unclassified 1967
247 Ga0439448_0013493 3300042005 Bacteria 2455
248 Ga0439448_0029285 3300042005 Bacteria 1742
249 Ga0439432_037893 3300042006 Unclassified 1537
250 Ga0439446_0005413 3300042156 Bacteria 3283
251 Ga0439458_0011235 3300042157 Bacteria 2001
252 Ga0439458_0011506 3300042157 Bacteria 1980
253 Ga0453683_0156716 3300044673 Bacteria 1440
254 Ga0466964_0003199 3300044706 Bacteria 5956
255 Ga0451576_0009300 3300045051 Bacteria 11410
256 Ga0451576_0182910 3300045051 Bacteria 2188
257 Ga0451576_0322496 3300045051 Bacteria 1617
258 Ga0466967_0036451 3300045976 Bacteria 4198
259 Ga0466967_0054912 3300045976 Bacteria 3508
260 Ga0495605_0056781 3300046474 Bacteria 1887
261 Ga0495620_0015185 3300046515 Bacteria 3894
262 Ga0495644_0062943 3300046523 Bacteria 1394
263 Ga0495663_0020298 3300046525 Bacteria 1906
264 Ga0495642_0022688 3300046528 Unclassified 2474
265 Ga0495609_0024171 3300046538 Bacteria 2790
266 Ga0495656_0023001 3300046615 Bacteria 2448
267 Ga0495669_0073265 3300046684 Bacteria 1564
268 Ga0495589_0140690 3300046794 Bacteria 1156
269 Ga0495636_0046358 3300047318 Unclassified 1813
270 Ga0495626_0076331 3300048091 Bacteria 1496
271 Ga0496100_0005334 3300048903 Bacteria 6911
272 Ga0496100_0308285 3300048903 Bacteria 1186
273 Ga0496101_0024462 3300048904 Bacteria 4180
274 Ga0496102_0017684 3300048905 Bacteria 6249
275 Ga0496102_0034257 3300048905 Bacteria 4566
276 Ga0496102_0087672 3300048905 Bacteria 2876
277 Ga0496102_0153735 3300048905 Bacteria 2163
278 Ga0496102_0227664 3300048905 Unclassified 1758
279 Ga0496102_0437474 3300048905 Unclassified 1228
280 Ga0496103_0234532 3300048906 Bacteria 1181
281 Ga0496104_0010379 3300048907 Bacteria 8320
282 Ga0496105_0009825 3300048908 Bacteria 7498
283 Ga0496106_0008564 3300048909 Bacteria 7569
284 Ga0496106_0270186 3300048909 Bacteria 1361
285 Ga0496107_0004653 3300048910 Bacteria 9311
286 Ga0496108_0010605 3300048911 Bacteria 7476
287 Ga0496109_0011113 3300048912 Bacteria 7721
288 Ga0496109_0013432 3300048912 Bacteria 7102
289 Ga0496109_0142324 3300048912 Bacteria 2243
290 Ga0496110_0001402 3300048913 Bacteria 17420
291 Ga0496110_0001410 3300048913 Bacteria 17372
292 Ga0496110_0017637 3300048913 Bacteria 5968
293 Ga0496110_0253480 3300048913 Bacteria 1602
294 Ga0496111_0005550 3300048914 Bacteria 8103
295 Ga0496111_0035431 3300048914 Bacteria 3566
296 Ga0496112_0021329 3300048915 Bacteria 6159
297 Ga0496112_0038276 3300048915 Bacteria 4683
298 Ga0496112_0462468 3300048915 Bacteria 1206
299 Ga0496113_0004448 3300048916 Bacteria 8622
300 Ga0496113_0012598 3300048916 Bacteria 5689
301 Ga0496114_0146177 3300048917 Bacteria 2049
302 Ga0496114_0240042 3300048917 Bacteria 1593
303 Ga0501031_0003117 3300049568 Bacteria 10619
304 Ga0501032_0121786 3300049569 Bacteria 1724
305 Ga0501034_0012332 3300049571 Bacteria 8831
306 Ga0501036_0000438 3300049572 Bacteria 29594
307 Ga0501036_0158997 3300049572 Unclassified 1905
308 Ga0501039_0079514 3300049575 Bacteria 2551
309 Ga0501040_0023283 3300049576 Bacteria 4152
310 Ga0501041_0000272 3300049577 Bacteria 24566
311 Ga0501041_0090858 3300049577 Bacteria 1885
312 Ga0501042_0009064 3300049578 Bacteria 6615
313 Ga0501042_0019586 3300049578 Bacteria 4702
314 Ga0501042_0021131 3300049578 Bacteria 4532
315 Ga0501043_0253950 3300049579 Unclassified 1353
316 Ga0501046_0014590 3300049580 Bacteria 6620
317 Ga0501046_0119305 3300049580 Bacteria 2008
318 Ga0501048_0001139 3300049582 Bacteria 19959
319 Ga0501048_0039951 3300049582 Bacteria 3363
320 Ga0501048_0122776 3300049582 Bacteria 1836
321 Ga0501067_0006592 3300049583 Bacteria 6437
322 Ga0501068_0005842 3300049584 Bacteria 6752
323 Ga0501068_0144646 3300049584 Bacteria 1492
324 Ga0501069_0006202 3300049585 Bacteria 6247
325 Ga0501070_0012113 3300049586 Bacteria 7279
326 Ga0501070_0033579 3300049586 Bacteria 4294
327 Ga0501070_0048414 3300049586 Bacteria 3531
328 Ga0501071_0001303 3300049587 Bacteria 14215
329 Ga0501071_0004522 3300049587 Bacteria 8821
330 Ga0501071_0023054 3300049587 Bacteria 4344
331 Ga0501071_0082617 3300049587 Bacteria 2352
332 Ga0501071_0087002 3300049587 Bacteria 2292
333 Ga0501071_0357130 3300049587 Bacteria 1112
334 Ga0501072_0005382 3300049588 Bacteria 9743
335 Ga0501072_0019579 3300049588 Bacteria 5234
336 Ga0501072_0022433 3300049588 Bacteria 4897
337 Ga0501072_0025759 3300049588 Bacteria 4582
338 Ga0501072_0134723 3300049588 Bacteria 1969
339 Ga0501073_0131478 3300049589 Bacteria 1735
340 Ga0501073_0196959 3300049589 Bacteria 1393
341 Ga0501073_0275027 3300049589 Bacteria 1162
342 Ga0501074_0082963 3300049590 Bacteria 2298
343 Ga0501074_0181898 3300049590 Unclassified 1499
344 Ga0501074_0187107 3300049590 Bacteria 1476
345 Ga0501075_0017997 3300049591 Bacteria 5107
346 Ga0501075_0018119 3300049591 Bacteria 5092
347 Ga0501075_0109153 3300049591 Bacteria 2103
348 Ga0501076_0011473 3300049592 Bacteria 6602
349 Ga0501076_0016196 3300049592 Bacteria 5646
350 Ga0501076_0019934 3300049592 Bacteria 5131
351 Ga0501076_0124584 3300049592 Bacteria 2087
352 Ga0501077_0008617 3300049593 Bacteria 6322
353 Ga0501077_0010870 3300049593 Bacteria 5671
354 Ga0501077_0084460 3300049593 Bacteria 2013
355 Ga0501079_0005523 3300049741 Bacteria 9428
356 Ga0501079_0006203 3300049741 Bacteria 8970
357 Ga0501079_0028160 3300049741 Bacteria 4310
358 Ga0501079_0076019 3300049741 Bacteria 2597
359 Ga0501079_0107375 3300049741 Bacteria 2167
360 Ga0501079_0133229 3300049741 Bacteria 1934
361 Ga0501080_0000309 3300049742 Bacteria 37361
362 Ga0501080_0061340 3300049742 Bacteria 3501
363 Ga0501081_0003083 3300049743 Bacteria 10583
364 Ga0501081_0058831 3300049743 Bacteria 2660
365 Ga0501083_0009873 3300049744 Bacteria 6740
366 Ga0501083_0085218 3300049744 Bacteria 2091
367 Ga0501045_0000357 3300049824 Bacteria 27239
368 Ga0501045_0010605 3300049824 Bacteria 6455
369 Ga0501045_0134745 3300049824 Bacteria 1836
370 nmdc:mga0yw44_116937_c1 3300050492 Bacteria 1714
371 nmdc:mga05p37_17214_c1 3300050507 Bacteria 8719
372 nmdc:mga05p37_41816_c1 3300050507 Bacteria 5628
373 nmdc:mga09592_122245_c1 3300050508 Bacteria 2236
374 nmdc:mga09592_25147_c1 3300050508 Bacteria 4926
375 nmdc:mga0qj67_105621_c1 3300050509 Bacteria 2272
376 nmdc:mga0qj67_54352_c1 3300050509 Bacteria 3171
377 nmdc:mga06r32_164001_c1 3300050510 Bacteria 2205
378 nmdc:mga08y16_250147_c1 3300050511 Bacteria 1832
379 nmdc:mga08y16_28110_c1 3300050511 Bacteria 5929
380 nmdc:mga08y16_513982_c1 3300050511 Unclassified 1215
381 nmdc:mga0n895_328102_c1 3300050512 Bacteria 1551
382 nmdc:mga0n895_88896_c1 3300050512 Bacteria 3090
383 nmdc:mga0rr50_148713_c1 3300050513 Bacteria 1891
384 nmdc:mga0rr50_259843_c1 3300050513 Unclassified 1445
385 nmdc:mga0rr50_53550_c1 3300050513 Bacteria 3002
386 nmdc:mga0a205_234441_c1 3300050515 Bacteria 1718
387 nmdc:mga0a205_283894_c1 3300050515 Bacteria 1530
388 nmdc:mga0a205_88622_c1 3300050515 Bacteria 2991
389 Ga0501084_0023150 3300054114 Bacteria 5186
390 Ga0501084_0030667 3300054114 Bacteria 4496
391 Ga0501084_0037727 3300054114 Bacteria 4038
392 Ga0590071_007861 3300059421 Bacteria 2521
393 Ga0590075_022453 3300059424 Bacteria 1579
394 Ga0501082_0055830 3300060353 Bacteria 3402
395 Ga0501082_0060829 3300060353 Bacteria 3251
396 Ga0501082_0085335 3300060353 Bacteria 2723
397 Ga0501082_0166247 3300060353 Bacteria 1917
398 Ga0501082_0285586 3300060353 Bacteria 1436
399 Ga0530510_0018428 3300061734 Bacteria 4949
400 Ga0530510_0028549 3300061734 Bacteria 4001
401 Ga0395899_0001601
402 Ga0070658_10090052
403 Ga0070683_100221981
404 Ga0070683_100268307
405 Ga0070690_100046508
406 Ga0070690_100201210
407 Ga0070680_100010255
408 Ga0070682_100012438
409 Ga0068868_100174315
410 Ga0068868_100228540
411 Ga0070660_100000691
412 Ga0070660_100196746
413 Ga0070689_100185649
414 Ga0070691_10027613
415 Ga0070687_100102585
416 Ga0070692_10060519
417 Ga0070668_100044773
418 Ga0070669_100162667
419 Ga0070675_100398715
420 Ga0070671_100115255
421 Ga0070674_100204714
422 Ga0070688_100256143
423 Ga0070703_10014050
424 Ga0070701_10035902
425 Ga0070701_10104828
426 Ga0070705_100038884
427 Ga0070705_100205896
428 Ga0070700_100005496
429 Ga0070700_100025740
430 Ga0070694_100295572
431 Ga0070662_100026331
432 Ga0070662_100037992
433 Ga0070662_100381111
434 Ga0070681_10000130
435 Ga0070681_10024209
436 Ga0070685_10211517
437 Ga0070698_100110114
438 Ga0070679_100054767
439 Ga0070679_100162323
440 Ga0070679_100231081
441 Ga0070679_100344959
442 Ga0070684_100224906
443 Ga0070684_100230841
444 Ga0068853_100101223
445 Ga0070686_100042646
446 Ga0070696_100024790
447 Ga0070693_100031928
448 Ga0070693_100049110
449 Ga0070693_100159398
450 Ga0070665_100068052
451 Ga0070704_100061031
452 Ga0068855_100013818
453 Ga0068855_100047350
454 Ga0070664_100201885
455 Ga0068857_100026560
456 Ga0068857_100158275
457 Ga0068854_100098545
458 Ga0068854_100105706
459 Ga0068856_100073638
460 Ga0070702_100011253
461 Ga0070702_100031233
462 Ga0068852_100329075
463 Ga0068852_100577393
464 Ga0068859_100225093
465 Ga0068861_100031373
466 Ga0068851_10123376
467 Ga0068863_100286465
468 Ga0068858_100210087
469 Ga0068858_100394748
470 Ga0068860_100086053
471 Ga0068862_100123516
472 Ga0081455_10003431
473 Ga0081455_10011880
474 Ga0081455_10100383
475 Ga0081455_10156540
476 Ga0081540_1005304
477 Ga0081540_1020028
478 Ga0081540_1026701
479 Ga0081539_10002405
480 Ga0081539_10004599
481 Ga0075365_10007234
482 Ga0075428_100035538
483 Ga0075428_100118215
484 Ga0075430_100071877
485 Ga0075431_100105538
486 Ga0075429_100007280
487 Ga0068865_100219587
488 Ga0075436_100086380
489 Ga0097620_100225116
490 Ga0075435_100038782
491 Ga0105240_10176091
492 Ga0111539_10015882
493 Ga0111539_10420391
494 Ga0111539_10608402
495 Ga0105245_10011070
496 Ga0105245_10014230
497 Ga0105245_10115155
498 Ga0105245_10123809
499 Ga0114129_10035556
500 Ga0114129_10035827
501 Ga0105243_10147945
502 Ga0105241_10054771
503 Ga0105241_10159243
504 Ga0105242_10068782
505 Ga0105237_10204834
506 Ga0105237_10237640
507 Ga0105238_10095792
508 Ga0105238_10355299
509 Ga0105238_10406052
510 Ga0105249_10002789
511 Ga0105249_10080157
512 Ga0105249_10271687
513 Ga0105249_10360955
514 Ga0105239_10058960
515 Ga0105246_10179772
516 Ga0157371_10059813
517 Ga0157374_10197335
518 Ga0157378_10404911
519 Ga0157378_10424674
520 Ga0163162_10387394
521 Ga0157375_10041311
522 Ga0157375_10058082
523 Ga0163163_10141610
524 Ga0157380_10034215
525 Ga0157380_10355889
526 Ga0157380_10536966
527 Ga0157377_10195767
528 Ga0157379_10095393
529 Ga0163161_10021496
530 Ga0206356_10684141
531 Ga0207642_10019008
532 Ga0207688_10092866
533 Ga0207688_10150787
534 Ga0207647_10152395
535 Ga0207643_10096136
536 Ga0207654_10085470
537 Ga0207707_10012305
538 Ga0207707_10078124
539 Ga0207660_10155103
540 Ga0207662_10021349
541 Ga0207657_10001176
542 Ga0207657_10002512
543 Ga0207652_10122215
544 Ga0207652_10180212
545 Ga0207652_10223413
546 Ga0207652_10259759
547 Ga0207681_10061736
548 Ga0207694_10308274
549 Ga0207650_10196971
550 Ga0207687_10039333
551 Ga0207687_10085858
552 Ga0207687_10180504
553 Ga0207644_10163822
554 Ga0207690_10072129
555 Ga0207706_10030025
556 Ga0207706_10089288
557 Ga0207706_10113642
558 Ga0207706_10149709
559 Ga0207706_10197602
560 Ga0207709_10123937
561 Ga0207704_10209434
562 Ga0207704_10268175
563 Ga0207691_10105790
564 Ga0207689_10225992
565 Ga0207661_10378376
566 Ga0207667_10197184
567 Ga0207712_10064844
568 Ga0207712_10196334
569 Ga0207640_10236626
570 Ga0207677_10030604
571 Ga0207639_10026643
572 Ga0207678_10204973
573 Ga0207708_10037386
574 Ga0207708_10078811
575 Ga0207648_10011001
576 Ga0207648_10015239
577 Ga0207648_10282557
578 Ga0207676_10295328
579 Ga0207674_10175678
580 Ga0207675_100000592
581 Ga0207675_100048782
582 Ga0207683_10040028
583 Ga0207698_10484446
584 Ga0207428_10011449
585 Ga0207428_10094780
586 Ga0268266_10009024
587 Ga0268265_10162752
588 Ga0268265_10322198
589 Ga0307408_100246208
590 Ga0307408_100259423
591 Ga0307405_10016940
592 Ga0307413_10021272
593 Ga0307413_10026190
594 Ga0307410_10008190
595 Ga0307410_10366244
596 Ga0307406_10027595
597 Ga0307407_10029211
598 Ga0307407_10126808
599 Ga0307412_10305512
600 Ga0307409_100014047
601 Ga0307409_100125180
602 Ga0307409_100128313
603 Ga0307416_100028599
604 Ga0307416_100051520
605 Ga0307416_100060919
606 Ga0307416_100085234
607 Ga0307414_10065046
608 Ga0307411_10027089
609 Ga0307415_100026918
610 Ga0307415_100072447
611 Ga0395899_0000690
612 Ga0395899_0001614
613 Ga0395900_0006008
614 Ga0395900_0006191
615 Ga0395900_0007252
616 Ga0395900_0029948
617 Ga0395900_0084452
618 Ga0395900_0176109
619 Ga0395900_0318478
620 Ga0395900_0322876
621 Ga0395898_0001382
622 Ga0395898_0028421
623 Ga0395898_0029690
624 Ga0395898_0030574
625 Ga0395898_0067109
626 Ga0395898_0087916
627 Ga0395898_0130721
628 Ga0395898_0168269
629 Ga0395898_0184242
630 Ga0395905_0006791
631 Ga0395905_0015226
632 Ga0395905_0032066
633 Ga0395905_0180687
634 Ga0395905_0216704
635 Ga0395905_0280729
636 Ga0395901_0000684
637 Ga0395901_0001867
638 Ga0395901_0005519
639 Ga0395901_0017959
640 Ga0395901_0033035
641 Ga0395901_0045160
642 Ga0395901_0075215
643 Ga0395901_0109344
644 Ga0395901_0154982
645 Ga0395901_0767431
646 Ga0451853_0505702
647 Ga0439448_0013493
648 Ga0439448_0029285
649 Ga0439432_037893
650 Ga0439446_0005413
651 Ga0439458_0011235
652 Ga0439458_0011506
653 Ga0453683_0156716
654 Ga0466964_0003199
655 Ga0451576_0009300
656 Ga0451576_0182910
657 Ga0451576_0322496
658 Ga0466967_0036451
659 Ga0466967_0054912
660 Ga0495605_0056781
661 Ga0495620_0015185
662 Ga0495644_0062943
663 Ga0495663_0020298
664 Ga0495642_0022688
665 Ga0495609_0024171
666 Ga0495656_0023001
667 Ga0495669_0073265
668 Ga0495589_0140690
669 Ga0495636_0046358
670 Ga0495626_0076331
671 Ga0496100_0005334
672 Ga0496100_0308285
673 Ga0496101_0024462
674 Ga0496102_0017684
675 Ga0496102_0034257
676 Ga0496102_0087672
677 Ga0496102_0153735
678 Ga0496102_0227664
679 Ga0496102_0437474
680 Ga0496103_0234532
681 Ga0496104_0010379
682 Ga0496105_0009825
683 Ga0496106_0008564
684 Ga0496106_0270186
685 Ga0496107_0004653
686 Ga0496108_0010605
687 Ga0496109_0011113
688 Ga0496109_0013432
689 Ga0496109_0142324
690 Ga0496110_0001402
691 Ga0496110_0001410
692 Ga0496110_0017637
693 Ga0496110_0253480
694 Ga0496111_0005550
695 Ga0496111_0035431
696 Ga0496112_0021329
697 Ga0496112_0038276
698 Ga0496112_0462468
699 Ga0496113_0004448
700 Ga0496113_0012598
701 Ga0496114_0146177
702 Ga0496114_0240042
703 Ga0501031_0003117
704 Ga0501032_0121786
705 Ga0501034_0012332
706 Ga0501036_0000438
707 Ga0501036_0158997
708 Ga0501039_0079514
709 Ga0501040_0023283
710 Ga0501041_0000272
711 Ga0501041_0090858
712 Ga0501042_0009064
713 Ga0501042_0019586
714 Ga0501042_0021131
715 Ga0501043_0253950
716 Ga0501046_0014590
717 Ga0501046_0119305
718 Ga0501048_0001139
719 Ga0501048_0039951
720 Ga0501048_0122776
721 Ga0501067_0006592
722 Ga0501068_0005842
723 Ga0501068_0144646
724 Ga0501069_0006202
725 Ga0501070_0012113
726 Ga0501070_0033579
727 Ga0501070_0048414
728 Ga0501071_0001303
729 Ga0501071_0004522
730 Ga0501071_0023054
731 Ga0501071_0082617
732 Ga0501071_0087002
733 Ga0501071_0357130
734 Ga0501072_0005382
735 Ga0501072_0019579
736 Ga0501072_0022433
737 Ga0501072_0025759
738 Ga0501072_0134723
739 Ga0501073_0131478
740 Ga0501073_0196959
741 Ga0501073_0275027
742 Ga0501074_0082963
743 Ga0501074_0181898
744 Ga0501074_0187107
745 Ga0501075_0017997
746 Ga0501075_0018119
747 Ga0501075_0109153
748 Ga0501076_0011473
749 Ga0501076_0016196
750 Ga0501076_0019934
751 Ga0501076_0124584
752 Ga0501077_0008617
753 Ga0501077_0010870
754 Ga0501077_0084460
755 Ga0501079_0005523
756 Ga0501079_0006203
757 Ga0501079_0028160
758 Ga0501079_0076019
759 Ga0501079_0107375
760 Ga0501079_0133229
761 Ga0501080_0000309
762 Ga0501080_0061340
763 Ga0501081_0003083
764 Ga0501081_0058831
765 Ga0501083_0009873
766 Ga0501083_0085218
767 Ga0501045_0000357
768 Ga0501045_0010605
769 Ga0501045_0134745
770 nmdc:mga0yw44_116937_c1
771 nmdc:mga05p37_17214_c1
772 nmdc:mga05p37_41816_c1
773 nmdc:mga09592_122245_c1
774 nmdc:mga09592_25147_c1
775 nmdc:mga0qj67_105621_c1
776 nmdc:mga0qj67_54352_c1
777 nmdc:mga06r32_164001_c1
778 nmdc:mga08y16_250147_c1
779 nmdc:mga08y16_28110_c1
780 nmdc:mga08y16_513982_c1
781 nmdc:mga0n895_328102_c1
782 nmdc:mga0n895_88896_c1
783 nmdc:mga0rr50_148713_c1
784 nmdc:mga0rr50_259843_c1
785 nmdc:mga0rr50_53550_c1
786 nmdc:mga0a205_234441_c1
787 nmdc:mga0a205_283894_c1
788 nmdc:mga0a205_88622_c1
789 Ga0501084_0023150
790 Ga0501084_0030667
791 Ga0501084_0037727
792 Ga0590071_007861
793 Ga0590075_022453
794 Ga0501082_0055830
795 Ga0501082_0060829
796 Ga0501082_0085335
797 Ga0501082_0166247
798 Ga0501082_0285586
799 Ga0530510_0018428
800 Ga0530510_0028549

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02673

BacA

Bacitracin resistance protein BacA

85

346

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fmt-assembly1.cif.gz_A imisx-ep of hg-baca soaking sad 0.849 48 313
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.8269 48 314
6fmt-assembly1.cif.gz_A imisx-ep of hg-baca soaking sad 0.8209 48 313
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.8042 48 314
8sc1-assembly1.cif.gz_A human oct1 (apo) in inward-open conformation 0.3555 89 313
ID Description Score Start End Superfamily
af_A0A0P0X7B4_1_270_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4166 70 312 1.20.1250.20
af_Q54E81_21_266_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4027 95 310 1.20.1250.20
af_I1KCR2_55_521_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3925 88 312 1.20.1250.20
af_Q2FW83_254_447_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.39 86 313 1.20.1250.20
af_P0CU10_39_465_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3897 81 310 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A537YTN2-F1-model_v4 Undecaprenyl-diphosphatase (EC 3.6.1.27) (Bacitracin resistance protein) (Undecaprenyl pyrophosphate phosphatase) 0.989 44 323 GO:0005886
GO:0008360
GO:0009252
GO:0046677
GO:0050380
GO:0071555
AF-A0A7W0UNF1-F1-model_v4 Undecaprenyl-diphosphatase (EC 3.6.1.27) (Bacitracin resistance protein) (Undecaprenyl pyrophosphate phosphatase) 0.9885 14 323 GO:0005886
GO:0008360
GO:0009252
GO:0046677
GO:0050380
GO:0071555
AF-A0A537YTN2-F1-model_v4 Undecaprenyl-diphosphatase (EC 3.6.1.27) (Bacitracin resistance protein) (Undecaprenyl pyrophosphate phosphatase) 0.982 44 323 GO:0005886
GO:0008360
GO:0009252
GO:0046677
GO:0050380
GO:0071555
AF-A0A7W0UNF1-F1-model_v4 Undecaprenyl-diphosphatase (EC 3.6.1.27) (Bacitracin resistance protein) (Undecaprenyl pyrophosphate phosphatase) 0.9791 14 323 GO:0005886
GO:0008360
GO:0009252
GO:0046677
GO:0050380
GO:0071555
AF-A0A538JIY8-F1-model_v4 Undecaprenyl-diphosphatase (EC 3.6.1.27) (Bacitracin resistance protein) (Undecaprenyl pyrophosphate phosphatase) 0.9726 39 322 GO:0005886
GO:0008360
GO:0009252
GO:0046677
GO:0050380
GO:0071555

Map