F434620

General Info

Members Datasets Scaffolds Average Seq Length
400 154 800 358

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_10054981|Ga0307406_100549812
Length 348
Sequence VSPIPLSRPPVDDELKQAVLTAIDSRQYILGPECKAFEAELASYVGVRHCVLSNSATAALWLSLRAFGVKAGDEILVPSHTAFPTIEAICFAEATPVFVDVDDWYTLDVADAAGKATPRTVGMVPVHLYGQPVDVTAVRELAARLGVWVLEDCAQAHGAAWNGTRVGRFGRAGVFSFYPSKNLTVMGDGRCRRLRDHGRLNKDVHSEIGFNLRFNDIQAAIGRVLLRRLETMNERRRALAARYDKGLAGLPLELPRERPRARHVYHLYVVRTPRRQELAAHLKAQGIQTGVHYPMPSHRQPAVERFYQGALPRTEQIVNEIVTLPLSAGHTEGEIDAVVDAVRSFFGA

Samples

Sample ID Description Type Environment
1 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
106 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
107 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
108 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
109 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
114 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
115 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
116 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
119 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
120 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
130 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
131 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
132 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
133 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
134 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
135 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
136 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
137 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
138 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
141 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
142 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
143 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
144 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
145 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
146 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
147 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
148 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
149 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
150 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
151 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
152 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
153 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
154 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307406_10054981 3300031901 Unclassified 2543
2 Ga0070676_10001613 3300005328 Bacteria 11470
3 Ga0070676_10097018 3300005328 Bacteria 1815
4 Ga0070670_100024722 3300005331 Bacteria 5166
5 Ga0068869_100000186 3300005334 Bacteria 31973
6 Ga0068869_100016414 3300005334 Bacteria 4991
7 Ga0068869_100123147 3300005334 Bacteria 1985
8 Ga0070680_100065629 3300005336 Bacteria 2975
9 Ga0070680_100162070 3300005336 Unclassified 1880
10 Ga0070682_100000213 3300005337 Bacteria 42727
11 Ga0070660_100010520 3300005339 Bacteria 6537
12 Ga0070692_10002597 3300005345 Bacteria 7044
13 Ga0070692_10011089 3300005345 Bacteria 4128
14 Ga0070668_100066128 3300005347 Bacteria 2804
15 Ga0070669_100003654 3300005353 Bacteria 11092
16 Ga0070675_100042675 3300005354 Bacteria 3706
17 Ga0070659_100001377 3300005366 Bacteria 17516
18 Ga0070703_10001369 3300005406 Bacteria 7404
19 Ga0070701_10061705 3300005438 Bacteria 1978
20 Ga0070705_100032304 3300005440 Bacteria 2907
21 Ga0070694_100005441 3300005444 Bacteria 7710
22 Ga0070694_100016388 3300005444 Bacteria 4664
23 Ga0070694_100017622 3300005444 Bacteria 4516
24 Ga0070694_100160381 3300005444 Bacteria 1650
25 Ga0070708_100025850 3300005445 Bacteria 5020
26 Ga0070708_100037925 3300005445 Bacteria 4206
27 Ga0070708_100038994 3300005445 Bacteria 4154
28 Ga0070708_100057825 3300005445 Unclassified 3454
29 Ga0070708_100073165 3300005445 Bacteria 3089
30 Ga0070708_100093140 3300005445 Bacteria 2746
31 Ga0070708_100173436 3300005445 Bacteria 2014
32 Ga0068867_100087107 3300005459 Bacteria 2364
33 Ga0070706_100000999 3300005467 Bacteria 30698
34 Ga0070706_100002980 3300005467 Bacteria 16786
35 Ga0070706_100011490 3300005467 Bacteria 8231
36 Ga0070706_100035940 3300005467 Bacteria 4575
37 Ga0070706_100042972 3300005467 Bacteria 4175
38 Ga0070706_100054691 3300005467 Bacteria 3684
39 Ga0070707_100004382 3300005468 Bacteria 13216
40 Ga0070707_100011945 3300005468 Bacteria 8103
41 Ga0070707_100021457 3300005468 Bacteria 6104
42 Ga0070707_100038883 3300005468 Bacteria 4545
43 Ga0070707_100042998 3300005468 Bacteria 4325
44 Ga0070707_100066072 3300005468 Unclassified 3475
45 Ga0070707_100079970 3300005468 Bacteria 3155
46 Ga0070707_100184950 3300005468 Bacteria 2031
47 Ga0070707_100360311 3300005468 Bacteria 1412
48 Ga0070707_100519030 3300005468 Bacteria 1153
49 Ga0070698_100011707 3300005471 Bacteria 9304
50 Ga0070698_100022330 3300005471 Bacteria 6619
51 Ga0070698_100054678 3300005471 Bacteria 4052
52 Ga0070698_100119545 3300005471 Unclassified 2595
53 Ga0070698_100341576 3300005471 Bacteria 1428
54 Ga0070699_100002233 3300005518 Bacteria 17498
55 Ga0070699_100003391 3300005518 Bacteria 14095
56 Ga0070699_100009279 3300005518 Bacteria 8522
57 Ga0070699_100016922 3300005518 Bacteria 6262
58 Ga0070699_100020108 3300005518 Bacteria 5754
59 Ga0070699_100021927 3300005518 Bacteria 5505
60 Ga0070699_100039064 3300005518 Bacteria 4110
61 Ga0070679_100030111 3300005530 Bacteria 5357
62 Ga0070697_100010656 3300005536 Bacteria 7174
63 Ga0070697_100028770 3300005536 Bacteria 4452
64 Ga0070697_100168654 3300005536 Bacteria 1852
65 Ga0068853_100000636 3300005539 Bacteria 24019
66 Ga0070672_100093447 3300005543 Bacteria 2429
67 Ga0070686_100143013 3300005544 Bacteria 1667
68 Ga0070695_100002052 3300005545 Bacteria 11521
69 Ga0070695_100012690 3300005545 Bacteria 5058
70 Ga0070695_100024740 3300005545 Bacteria 3702
71 Ga0070695_100034054 3300005545 Bacteria 3190
72 Ga0070695_100064591 3300005545 Bacteria 2381
73 Ga0070696_100041495 3300005546 Bacteria 3179
74 Ga0070696_100045150 3300005546 Bacteria 3053
75 Ga0070696_100065272 3300005546 Bacteria 2552
76 Ga0070696_100069809 3300005546 Bacteria 2470
77 Ga0070696_100128905 3300005546 Bacteria 1839
78 Ga0070693_100033887 3300005547 Bacteria 2822
79 Ga0070704_100029530 3300005549 Bacteria 3662
80 Ga0070704_100033872 3300005549 Bacteria 3458
81 Ga0070704_100166906 3300005549 Bacteria 1746
82 Ga0068855_100004948 3300005563 Bacteria 16246
83 Ga0070664_100064541 3300005564 Bacteria 3123
84 Ga0068857_100021437 3300005577 Bacteria 5687
85 Ga0068856_100060095 3300005614 Bacteria 3755
86 Ga0070702_100046074 3300005615 Bacteria 2470
87 Ga0068859_100007882 3300005617 Bacteria 10808
88 Ga0068859_100034442 3300005617 Bacteria 5082
89 Ga0068859_100116511 3300005617 Bacteria 2736
90 Ga0068866_10068647 3300005718 Bacteria 1865
91 Ga0068861_100074087 3300005719 Bacteria 2647
92 Ga0068861_100098932 3300005719 Unclassified 2316
93 Ga0068870_10007410 3300005840 Bacteria 4888
94 Ga0068863_100021382 3300005841 Bacteria 6174
95 Ga0068863_100026446 3300005841 Bacteria 5535
96 Ga0068858_100051674 3300005842 Bacteria 3803
97 Ga0068860_100030253 3300005843 Bacteria 5207
98 Ga0068860_100048385 3300005843 Bacteria 4052
99 Ga0068860_100112651 3300005843 Bacteria 2601
100 Ga0068860_100154823 3300005843 Bacteria 2209
101 Ga0068862_100014634 3300005844 Bacteria 6516
102 Ga0068862_100018031 3300005844 Bacteria 5880
103 Ga0068862_100047301 3300005844 Bacteria 3671
104 Ga0081455_10170380 3300005937 Bacteria 1659
105 Ga0081540_1013023 3300005983 Bacteria 5431
106 Ga0081539_10000166 3300005985 Bacteria 153758
107 Ga0070712_100018854 3300006175 Bacteria 4490
108 Ga0075428_100000368 3300006844 Bacteria 44722
109 Ga0075428_100000538 3300006844 Bacteria 38617
110 Ga0075428_100014585 3300006844 Bacteria 8729
111 Ga0075428_100048221 3300006844 Bacteria 4676
112 Ga0075428_100100665 3300006844 Bacteria 3151
113 Ga0075428_100286535 3300006844 Bacteria 1772
114 Ga0075430_100000022 3300006846 Bacteria 81752
115 Ga0075430_100009393 3300006846 Bacteria 8263
116 Ga0075430_100039759 3300006846 Bacteria 3981
117 Ga0075430_100233177 3300006846 Bacteria 1526
118 Ga0075430_100265352 3300006846 Bacteria 1422
119 Ga0075431_100000203 3300006847 Bacteria 43754
120 Ga0075431_100001584 3300006847 Bacteria 21166
121 Ga0075431_100004104 3300006847 Bacteria 14224
122 Ga0075431_100010580 3300006847 Bacteria 9276
123 Ga0075431_100023842 3300006847 Bacteria 6263
124 Ga0075431_100026257 3300006847 Bacteria 5974
125 Ga0075431_100036722 3300006847 Bacteria 5046
126 Ga0075431_100148061 3300006847 Bacteria 2418
127 Ga0075433_10006763 3300006852 Bacteria 9088
128 Ga0075433_10013299 3300006852 Bacteria 6687
129 Ga0075433_10021727 3300006852 Bacteria 5383
130 Ga0075433_10063897 3300006852 Unclassified 3226
131 Ga0075433_10247078 3300006852 Bacteria 1583
132 Ga0075434_100010767 3300006871 Bacteria 8588
133 Ga0075434_100019991 3300006871 Bacteria 6486
134 Ga0075434_100042618 3300006871 Bacteria 4500
135 Ga0075434_100056619 3300006871 Bacteria 3897
136 Ga0075434_100064686 3300006871 Bacteria 3642
137 Ga0075434_100131003 3300006871 Bacteria 2527
138 Ga0075434_100140182 3300006871 Bacteria 2437
139 Ga0075429_100000069 3300006880 Bacteria 51472
140 Ga0075429_100004005 3300006880 Bacteria 12617
141 Ga0075429_100010768 3300006880 Bacteria 7909
142 Ga0075429_100023038 3300006880 Bacteria 5398
143 Ga0075436_100014235 3300006914 Bacteria 5445
144 Ga0075436_100022066 3300006914 Bacteria 4372
145 Ga0075436_100097916 3300006914 Bacteria 2041
146 Ga0097620_100007882 3300006931 Bacteria 10808
147 Ga0097620_100034443 3300006931 Bacteria 5082
148 Ga0097620_100116520 3300006931 Bacteria 2736
149 Ga0075435_100002051 3300007076 Bacteria 13191
150 Ga0075435_100024814 3300007076 Bacteria 4659
151 Ga0075435_100035950 3300007076 Bacteria 3934
152 Ga0075435_100040310 3300007076 Bacteria 3729
153 Ga0075435_100062103 3300007076 Bacteria 3032
154 Ga0075435_100160675 3300007076 Bacteria 1892
155 Ga0099794_10002359 3300007265 Bacteria 6950
156 Ga0099794_10007644 3300007265 Bacteria 4450
157 Ga0099794_10086046 3300007265 Bacteria 1556
158 Ga0111539_10000274 3300009094 Bacteria 61652
159 Ga0111539_10000819 3300009094 Bacteria 40336
160 Ga0111539_10023559 3300009094 Bacteria 7565
161 Ga0111539_10043241 3300009094 Bacteria 5401
162 Ga0111539_10365495 3300009094 Bacteria 1679
163 Ga0105245_10198047 3300009098 Archaea 1928
164 Ga0114129_10001132 3300009147 Bacteria 35229
165 Ga0114129_10003835 3300009147 Bacteria 21188
166 Ga0114129_10004345 3300009147 Bacteria 20018
167 Ga0114129_10006933 3300009147 Bacteria 16118
168 Ga0114129_10015802 3300009147 Bacteria 10732
169 Ga0114129_10016880 3300009147 Bacteria 10394
170 Ga0114129_10021322 3300009147 Bacteria 9199
171 Ga0114129_10033758 3300009147 Bacteria 7228
172 Ga0114129_10042311 3300009147 Bacteria 6415
173 Ga0114129_10089528 3300009147 Bacteria 4266
174 Ga0114129_10188716 3300009147 Bacteria 2800
175 Ga0114129_10213540 3300009147 Bacteria 2607
176 Ga0114129_10268033 3300009147 Bacteria 2286
177 Ga0105243_10013672 3300009148 Bacteria 6141
178 Ga0105241_10034044 3300009174 Bacteria 3826
179 Ga0105241_10064355 3300009174 Bacteria 2831
180 Ga0105249_10015289 3300009553 Bacteria 6793
181 Ga0105249_10019917 3300009553 Bacteria 5990
182 Ga0105249_10423021 3300009553 Bacteria 1366
183 Ga0157369_10028556 3300013105 Bacteria 6173
184 Ga0157378_10129199 3300013297 Unclassified 2337
185 Ga0157375_10130048 3300013308 Unclassified 2636
186 Ga0157375_10433878 3300013308 Unclassified 1480
187 Ga0163163_10395261 3300014325 Bacteria 1440
188 Ga0207653_10002126 3300025885 Bacteria 6311
189 Ga0207653_10016010 3300025885 Bacteria 2354
190 Ga0207653_10040645 3300025885 Bacteria 1525
191 Ga0207688_10107590 3300025901 Bacteria 1616
192 Ga0207680_10189130 3300025903 Bacteria 1396
193 Ga0207645_10001956 3300025907 Bacteria 16583
194 Ga0207643_10000246 3300025908 Bacteria 37821
195 Ga0207684_10001278 3300025910 Bacteria 27767
196 Ga0207684_10002039 3300025910 Bacteria 20805
197 Ga0207684_10005462 3300025910 Bacteria 11714
198 Ga0207684_10008022 3300025910 Bacteria 9432
199 Ga0207684_10008119 3300025910 Bacteria 9358
200 Ga0207684_10009109 3300025910 Bacteria 8792
201 Ga0207684_10033670 3300025910 Bacteria 4358
202 Ga0207684_10135447 3300025910 Bacteria 2115
203 Ga0207684_10166007 3300025910 Bacteria 1902
204 Ga0207684_10185581 3300025910 Bacteria 1793
205 Ga0207684_10207059 3300025910 Bacteria 1692
206 Ga0207654_10013297 3300025911 Bacteria 4233
207 Ga0207707_10000278 3300025912 Bacteria 55246
208 Ga0207693_10036836 3300025915 Bacteria 3857
209 Ga0207660_10001174 3300025917 Bacteria 17526
210 Ga0207660_10039733 3300025917 Bacteria 3290
211 Ga0207660_10063937 3300025917 Bacteria 2655
212 Ga0207657_10000480 3300025919 Bacteria 42161
213 Ga0207652_10036655 3300025921 Bacteria 4146
214 Ga0207646_10000311 3300025922 Bacteria 66146
215 Ga0207646_10004103 3300025922 Bacteria 16045
216 Ga0207646_10007888 3300025922 Bacteria 10745
217 Ga0207646_10008540 3300025922 Bacteria 10250
218 Ga0207646_10012990 3300025922 Bacteria 7981
219 Ga0207646_10013648 3300025922 Bacteria 7758
220 Ga0207646_10030639 3300025922 Bacteria 4874
221 Ga0207646_10117046 3300025922 Bacteria 2394
222 Ga0207646_10134273 3300025922 Bacteria 2228
223 Ga0207646_10262295 3300025922 Bacteria 1561
224 Ga0207650_10125627 3300025925 Unclassified 2002
225 Ga0207687_10172820 3300025927 Bacteria 1668
226 Ga0207690_10018924 3300025932 Bacteria 4229
227 Ga0207706_10005194 3300025933 Bacteria 12150
228 Ga0207706_10023795 3300025933 Bacteria 5495
229 Ga0207709_10122346 3300025935 Bacteria 1759
230 Ga0207709_10148204 3300025935 Bacteria 1622
231 Ga0207665_10008315 3300025939 Bacteria 6850
232 Ga0207689_10000005 3300025942 Bacteria 135458
233 Ga0207689_10083867 3300025942 Bacteria 2620
234 Ga0207679_10002635 3300025945 Bacteria 11070
235 Ga0207667_10008120 3300025949 Bacteria 12507
236 Ga0207712_10015843 3300025961 Bacteria 4871
237 Ga0207712_10201840 3300025961 Bacteria 1577
238 Ga0207640_10013318 3300025981 Bacteria 4709
239 Ga0207639_10224556 3300026041 Unclassified 1624
240 Ga0207708_10094411 3300026075 Bacteria 2309
241 Ga0207702_10010228 3300026078 Bacteria 7855
242 Ga0207641_10095629 3300026088 Unclassified 2608
243 Ga0207641_10130568 3300026088 Bacteria 2255
244 Ga0207641_10277951 3300026088 Bacteria 1574
245 Ga0207641_10288265 3300026088 Bacteria 1547
246 Ga0207648_10018458 3300026089 Bacteria 6314
247 Ga0207676_10260937 3300026095 Bacteria 1564
248 Ga0207674_10006201 3300026116 Bacteria 14089
249 Ga0207675_100034962 3300026118 Bacteria 4686
250 Ga0207675_100145809 3300026118 Bacteria 2251
251 Ga0207428_10000009 3300027907 Bacteria 410565
252 Ga0207428_10017357 3300027907 Bacteria 6178
253 Ga0207428_10026307 3300027907 Bacteria 4857
254 Ga0268265_10011862 3300028380 Bacteria 5891
255 Ga0268265_10015629 3300028380 Bacteria 5198
256 Ga0268264_10188309 3300028381 Unclassified 1879
257 Ga0268264_10301063 3300028381 Bacteria 1510
258 Ga0307408_100049928 3300031548 Unclassified 3007
259 Ga0307408_100215613 3300031548 Bacteria 1563
260 Ga0373940_0002347 3300035088 Bacteria 3661
261 Ga0373939_0034344 3300035114 Bacteria 1487
262 Ga0373961_0033110 3300035241 Bacteria 1454
263 Ga0373931_0053035 3300035691 Bacteria 2163
264 Ga0395899_0081478 3300037312 Bacteria 2355
265 Ga0395900_0003993 3300037418 Bacteria 15757
266 Ga0395898_0003573 3300037466 Bacteria 17332
267 Ga0395901_0029964 3300038443 Bacteria 5605
268 Ga0439441_005994 3300042001 Unclassified 1910
269 Ga0451577_0001787 3300042876 Bacteria 27578
270 Ga0453683_0047682 3300044673 Unclassified 2687
271 Ga0453684_0018578 3300044712 Bacteria 10657
272 Ga0453684_0029088 3300044712 Bacteria 7860
273 Ga0451576_0022804 3300045051 Bacteria 6781
274 Ga0451576_0028024 3300045051 Bacteria 6038
275 Ga0451576_0164053 3300045051 Bacteria 2318
276 Ga0451576_0437563 3300045051 Unclassified 1372
277 Ga0495642_0013953 3300046528 Bacteria 3112
278 Ga0495669_0061301 3300046684 Bacteria 1702
279 Ga0501033_0029143 3300049570 Bacteria 4148
280 Ga0501036_0168777 3300049572 Bacteria 1844
281 Ga0501038_0031273 3300049574 Bacteria 4705
282 Ga0501039_0052649 3300049575 Bacteria 3149
283 Ga0501040_0186442 3300049576 Bacteria 1471
284 Ga0501040_0269807 3300049576 Bacteria 1215
285 Ga0501041_0014816 3300049577 Bacteria 4630
286 Ga0501041_0109634 3300049577 Bacteria 1712
287 Ga0501042_0040668 3300049578 Bacteria 3305
288 Ga0501042_0166270 3300049578 Bacteria 1592
289 Ga0501042_0226001 3300049578 Bacteria 1350
290 Ga0501046_0024249 3300049580 Bacteria 4980
291 Ga0501046_0137259 3300049580 Bacteria 1852
292 Ga0501048_0189911 3300049582 Bacteria 1456
293 Ga0501067_0089604 3300049583 Bacteria 1707
294 Ga0501068_0098712 3300049584 Unclassified 1809
295 Ga0501070_0227750 3300049586 Bacteria 1528
296 Ga0501071_0059350 3300049587 Bacteria 2768
297 Ga0501072_0003591 3300049588 Bacteria 11676
298 Ga0501072_0109830 3300049588 Bacteria 2195
299 Ga0501072_0133913 3300049588 Bacteria 1976
300 Ga0501074_0107321 3300049590 Bacteria 1999
301 Ga0501075_0005174 3300049591 Bacteria 8927
302 Ga0501075_0015797 3300049591 Bacteria 5427
303 Ga0501075_0054304 3300049591 Bacteria 3013
304 Ga0501075_0081463 3300049591 Bacteria 2450
305 Ga0501075_0097022 3300049591 Bacteria 2237
306 Ga0501075_0249672 3300049591 Bacteria 1352
307 Ga0501076_0011011 3300049592 Bacteria 6725
308 Ga0501076_0040241 3300049592 Bacteria 3672
309 Ga0501076_0084085 3300049592 Bacteria 2556
310 Ga0501077_0008370 3300049593 Bacteria 6404
311 Ga0501077_0041902 3300049593 Bacteria 2913
312 Ga0501077_0073622 3300049593 Bacteria 2164
313 Ga0501077_0203276 3300049593 Bacteria 1258
314 Ga0501079_0001714 3300049741 Bacteria 15648
315 Ga0501079_0005724 3300049741 Bacteria 9288
316 Ga0501079_0045646 3300049741 Bacteria 3381
317 Ga0501079_0101493 3300049741 Bacteria 2231
318 Ga0501079_0348713 3300049741 Bacteria 1160
319 Ga0501080_0305596 3300049742 Bacteria 1442
320 Ga0501081_0009252 3300049743 Bacteria 6417
321 Ga0501081_0019775 3300049743 Bacteria 4486
322 Ga0501083_0034663 3300049744 Bacteria 3451
323 Ga0501083_0191736 3300049744 Bacteria 1334
324 Ga0501045_0010976 3300049824 Bacteria 6346
325 Ga0501045_0056738 3300049824 Bacteria 2865
326 Ga0501045_0133555 3300049824 Bacteria 1845
327 nmdc:mga05p37_1381_c1 3300050507 Bacteria 28239
328 nmdc:mga05p37_15775_c1 3300050507 Bacteria 9085
329 nmdc:mga05p37_19298_c1 3300050507 Bacteria 8246
330 nmdc:mga05p37_2156_c1 3300050507 Bacteria 20944
331 nmdc:mga05p37_2162_c1 3300050507 Bacteria 22903
332 nmdc:mga05p37_26375_c1 3300050507 Bacteria 7067
333 nmdc:mga05p37_349510_c1 3300050507 Bacteria 1741
334 nmdc:mga05p37_505260_c1 3300050507 Bacteria 1386
335 nmdc:mga05p37_66743_c1 3300050507 Bacteria 4425
336 nmdc:mga05p37_7751_c1 3300050507 Bacteria 12673
337 nmdc:mga09592_19103_c1 3300050508 Bacteria 5625
338 nmdc:mga09592_24803_c1 3300050508 Bacteria 4959
339 nmdc:mga09592_25141_c1 3300050508 Bacteria 4927
340 nmdc:mga09592_39625_c1 3300050508 Bacteria 3958
341 nmdc:mga09592_405_c1 3300050508 Bacteria 31613
342 nmdc:mga09592_71007_c1 3300050508 Bacteria 2955
343 nmdc:mga09592_7764_c1 3300050508 Bacteria 8717
344 nmdc:mga0qj67_302_c1 3300050509 Bacteria 34246
345 nmdc:mga0qj67_41127_c1 3300050509 Bacteria 3635
346 nmdc:mga0qj67_42771_c1 3300050509 Bacteria 3566
347 nmdc:mga0qj67_50350_c2 3300050509 Bacteria 2452
348 nmdc:mga0qj67_96581_c1 3300050509 Bacteria 2379
349 nmdc:mga06r32_16564_c1 3300050510 Bacteria 6719
350 nmdc:mga06r32_17598_c1 3300050510 Bacteria 6527
351 nmdc:mga06r32_31187_c1 3300050510 Bacteria 5005
352 nmdc:mga06r32_4827_c1 3300050510 Bacteria 12139
353 nmdc:mga06r32_94979_c1 3300050510 Bacteria 2918
354 nmdc:mga06r32_9529_c1 3300050510 Bacteria 8768
355 nmdc:mga08y16_18496_c1 3300050511 Bacteria 7341
356 nmdc:mga08y16_35746_c1 3300050511 Bacteria 5218
357 nmdc:mga08y16_547_c1 3300050511 Bacteria 34801
358 nmdc:mga0n895_111850_c1 3300050512 Unclassified 2748
359 nmdc:mga0n895_113814_c1 3300050512 Bacteria 2723
360 nmdc:mga0n895_17483_c1 3300050512 Bacteria 6609
361 nmdc:mga0n895_200988_c1 3300050512 Bacteria 2024
362 nmdc:mga0n895_26583_c1 3300050512 Bacteria 5484
363 nmdc:mga0n895_32227_c1 3300050512 Bacteria 5029
364 nmdc:mga0n895_330041_c1 3300050512 Bacteria 1546
365 nmdc:mga0n895_471404_c1 3300050512 Bacteria 1266
366 nmdc:mga0n895_50231_c1 3300050512 Bacteria 4088
367 nmdc:mga0n895_6145_c1 3300050512 Bacteria 10147
368 nmdc:mga0rr50_144866_c1 3300050513 Bacteria 1914
369 nmdc:mga0rr50_31573_c1 3300050513 Bacteria 3764
370 nmdc:mga0rr50_61773_c1 3300050513 Bacteria 2824
371 nmdc:mga0rr50_9308_c1 3300050513 Bacteria 6171
372 nmdc:mga08x19_21449_c1 3300050514 Bacteria 3988
373 nmdc:mga08x19_27166_c1 3300050514 Bacteria 3578
374 nmdc:mga08x19_64243_c1 3300050514 Bacteria 2383
375 nmdc:mga08x19_7279_c1 3300050514 Bacteria 6571
376 nmdc:mga08x19_8098_c1 3300050514 Bacteria 6245
377 nmdc:mga08x19_99825_c1 3300050514 Bacteria 1925
378 nmdc:mga0a205_141954_c2 3300050515 Bacteria 1313
379 nmdc:mga0a205_154987_c1 3300050515 Bacteria 2189
380 nmdc:mga0a205_25290_c1 3300050515 Bacteria 5654
381 nmdc:mga0a205_2674_c1 3300050515 Bacteria 15763
382 nmdc:mga0a205_4535_c1 3300050515 Bacteria 12467
383 nmdc:mga0a205_6077_c1 3300050515 Bacteria 10889
384 nmdc:mga0a205_79746_c1 3300050515 Bacteria 3164
385 Ga0501084_0003566 3300054114 Bacteria 12634
386 Ga0501084_0009241 3300054114 Bacteria 8155
387 Ga0501084_0032881 3300054114 Bacteria 4340
388 Ga0501084_0054761 3300054114 Bacteria 3337
389 Ga0501082_0002443 3300060353 Bacteria 16310
390 Ga0501082_0010894 3300060353 Bacteria 7827
391 Ga0501082_0046539 3300060353 Bacteria 3739
392 Ga0501082_0172108 3300060353 Bacteria 1883
393 Ga0530510_0000168 3300061734 Bacteria 39753
394 Ga0530510_0002278 3300061734 Bacteria 13168
395 Ga0530510_0014836 3300061734 Bacteria 5502
396 Ga0530510_0022880 3300061734 Bacteria 4453
397 Ga0530510_0048733 3300061734 Bacteria 3062
398 Ga0530510_0077868 3300061734 Bacteria 2409
399 Ga0530510_0108003 3300061734 Bacteria 2037
400 Ga0530510_0142598 3300061734 Bacteria 1766
401 Ga0307406_10054981
402 Ga0070676_10001613
403 Ga0070676_10097018
404 Ga0070670_100024722
405 Ga0068869_100000186
406 Ga0068869_100016414
407 Ga0068869_100123147
408 Ga0070680_100065629
409 Ga0070680_100162070
410 Ga0070682_100000213
411 Ga0070660_100010520
412 Ga0070692_10002597
413 Ga0070692_10011089
414 Ga0070668_100066128
415 Ga0070669_100003654
416 Ga0070675_100042675
417 Ga0070659_100001377
418 Ga0070703_10001369
419 Ga0070701_10061705
420 Ga0070705_100032304
421 Ga0070694_100005441
422 Ga0070694_100016388
423 Ga0070694_100017622
424 Ga0070694_100160381
425 Ga0070708_100025850
426 Ga0070708_100037925
427 Ga0070708_100038994
428 Ga0070708_100057825
429 Ga0070708_100073165
430 Ga0070708_100093140
431 Ga0070708_100173436
432 Ga0068867_100087107
433 Ga0070706_100000999
434 Ga0070706_100002980
435 Ga0070706_100011490
436 Ga0070706_100035940
437 Ga0070706_100042972
438 Ga0070706_100054691
439 Ga0070707_100004382
440 Ga0070707_100011945
441 Ga0070707_100021457
442 Ga0070707_100038883
443 Ga0070707_100042998
444 Ga0070707_100066072
445 Ga0070707_100079970
446 Ga0070707_100184950
447 Ga0070707_100360311
448 Ga0070707_100519030
449 Ga0070698_100011707
450 Ga0070698_100022330
451 Ga0070698_100054678
452 Ga0070698_100119545
453 Ga0070698_100341576
454 Ga0070699_100002233
455 Ga0070699_100003391
456 Ga0070699_100009279
457 Ga0070699_100016922
458 Ga0070699_100020108
459 Ga0070699_100021927
460 Ga0070699_100039064
461 Ga0070679_100030111
462 Ga0070697_100010656
463 Ga0070697_100028770
464 Ga0070697_100168654
465 Ga0068853_100000636
466 Ga0070672_100093447
467 Ga0070686_100143013
468 Ga0070695_100002052
469 Ga0070695_100012690
470 Ga0070695_100024740
471 Ga0070695_100034054
472 Ga0070695_100064591
473 Ga0070696_100041495
474 Ga0070696_100045150
475 Ga0070696_100065272
476 Ga0070696_100069809
477 Ga0070696_100128905
478 Ga0070693_100033887
479 Ga0070704_100029530
480 Ga0070704_100033872
481 Ga0070704_100166906
482 Ga0068855_100004948
483 Ga0070664_100064541
484 Ga0068857_100021437
485 Ga0068856_100060095
486 Ga0070702_100046074
487 Ga0068859_100007882
488 Ga0068859_100034442
489 Ga0068859_100116511
490 Ga0068866_10068647
491 Ga0068861_100074087
492 Ga0068861_100098932
493 Ga0068870_10007410
494 Ga0068863_100021382
495 Ga0068863_100026446
496 Ga0068858_100051674
497 Ga0068860_100030253
498 Ga0068860_100048385
499 Ga0068860_100112651
500 Ga0068860_100154823
501 Ga0068862_100014634
502 Ga0068862_100018031
503 Ga0068862_100047301
504 Ga0081455_10170380
505 Ga0081540_1013023
506 Ga0081539_10000166
507 Ga0070712_100018854
508 Ga0075428_100000368
509 Ga0075428_100000538
510 Ga0075428_100014585
511 Ga0075428_100048221
512 Ga0075428_100100665
513 Ga0075428_100286535
514 Ga0075430_100000022
515 Ga0075430_100009393
516 Ga0075430_100039759
517 Ga0075430_100233177
518 Ga0075430_100265352
519 Ga0075431_100000203
520 Ga0075431_100001584
521 Ga0075431_100004104
522 Ga0075431_100010580
523 Ga0075431_100023842
524 Ga0075431_100026257
525 Ga0075431_100036722
526 Ga0075431_100148061
527 Ga0075433_10006763
528 Ga0075433_10013299
529 Ga0075433_10021727
530 Ga0075433_10063897
531 Ga0075433_10247078
532 Ga0075434_100010767
533 Ga0075434_100019991
534 Ga0075434_100042618
535 Ga0075434_100056619
536 Ga0075434_100064686
537 Ga0075434_100131003
538 Ga0075434_100140182
539 Ga0075429_100000069
540 Ga0075429_100004005
541 Ga0075429_100010768
542 Ga0075429_100023038
543 Ga0075436_100014235
544 Ga0075436_100022066
545 Ga0075436_100097916
546 Ga0097620_100007882
547 Ga0097620_100034443
548 Ga0097620_100116520
549 Ga0075435_100002051
550 Ga0075435_100024814
551 Ga0075435_100035950
552 Ga0075435_100040310
553 Ga0075435_100062103
554 Ga0075435_100160675
555 Ga0099794_10002359
556 Ga0099794_10007644
557 Ga0099794_10086046
558 Ga0111539_10000274
559 Ga0111539_10000819
560 Ga0111539_10023559
561 Ga0111539_10043241
562 Ga0111539_10365495
563 Ga0105245_10198047
564 Ga0114129_10001132
565 Ga0114129_10003835
566 Ga0114129_10004345
567 Ga0114129_10006933
568 Ga0114129_10015802
569 Ga0114129_10016880
570 Ga0114129_10021322
571 Ga0114129_10033758
572 Ga0114129_10042311
573 Ga0114129_10089528
574 Ga0114129_10188716
575 Ga0114129_10213540
576 Ga0114129_10268033
577 Ga0105243_10013672
578 Ga0105241_10034044
579 Ga0105241_10064355
580 Ga0105249_10015289
581 Ga0105249_10019917
582 Ga0105249_10423021
583 Ga0157369_10028556
584 Ga0157378_10129199
585 Ga0157375_10130048
586 Ga0157375_10433878
587 Ga0163163_10395261
588 Ga0207653_10002126
589 Ga0207653_10016010
590 Ga0207653_10040645
591 Ga0207688_10107590
592 Ga0207680_10189130
593 Ga0207645_10001956
594 Ga0207643_10000246
595 Ga0207684_10001278
596 Ga0207684_10002039
597 Ga0207684_10005462
598 Ga0207684_10008022
599 Ga0207684_10008119
600 Ga0207684_10009109
601 Ga0207684_10033670
602 Ga0207684_10135447
603 Ga0207684_10166007
604 Ga0207684_10185581
605 Ga0207684_10207059
606 Ga0207654_10013297
607 Ga0207707_10000278
608 Ga0207693_10036836
609 Ga0207660_10001174
610 Ga0207660_10039733
611 Ga0207660_10063937
612 Ga0207657_10000480
613 Ga0207652_10036655
614 Ga0207646_10000311
615 Ga0207646_10004103
616 Ga0207646_10007888
617 Ga0207646_10008540
618 Ga0207646_10012990
619 Ga0207646_10013648
620 Ga0207646_10030639
621 Ga0207646_10117046
622 Ga0207646_10134273
623 Ga0207646_10262295
624 Ga0207650_10125627
625 Ga0207687_10172820
626 Ga0207690_10018924
627 Ga0207706_10005194
628 Ga0207706_10023795
629 Ga0207709_10122346
630 Ga0207709_10148204
631 Ga0207665_10008315
632 Ga0207689_10000005
633 Ga0207689_10083867
634 Ga0207679_10002635
635 Ga0207667_10008120
636 Ga0207712_10015843
637 Ga0207712_10201840
638 Ga0207640_10013318
639 Ga0207639_10224556
640 Ga0207708_10094411
641 Ga0207702_10010228
642 Ga0207641_10095629
643 Ga0207641_10130568
644 Ga0207641_10277951
645 Ga0207641_10288265
646 Ga0207648_10018458
647 Ga0207676_10260937
648 Ga0207674_10006201
649 Ga0207675_100034962
650 Ga0207675_100145809
651 Ga0207428_10000009
652 Ga0207428_10017357
653 Ga0207428_10026307
654 Ga0268265_10011862
655 Ga0268265_10015629
656 Ga0268264_10188309
657 Ga0268264_10301063
658 Ga0307408_100049928
659 Ga0307408_100215613
660 Ga0373940_0002347
661 Ga0373939_0034344
662 Ga0373961_0033110
663 Ga0373931_0053035
664 Ga0395899_0081478
665 Ga0395900_0003993
666 Ga0395898_0003573
667 Ga0395901_0029964
668 Ga0439441_005994
669 Ga0451577_0001787
670 Ga0453683_0047682
671 Ga0453684_0018578
672 Ga0453684_0029088
673 Ga0451576_0022804
674 Ga0451576_0028024
675 Ga0451576_0164053
676 Ga0451576_0437563
677 Ga0495642_0013953
678 Ga0495669_0061301
679 Ga0501033_0029143
680 Ga0501036_0168777
681 Ga0501038_0031273
682 Ga0501039_0052649
683 Ga0501040_0186442
684 Ga0501040_0269807
685 Ga0501041_0014816
686 Ga0501041_0109634
687 Ga0501042_0040668
688 Ga0501042_0166270
689 Ga0501042_0226001
690 Ga0501046_0024249
691 Ga0501046_0137259
692 Ga0501048_0189911
693 Ga0501067_0089604
694 Ga0501068_0098712
695 Ga0501070_0227750
696 Ga0501071_0059350
697 Ga0501072_0003591
698 Ga0501072_0109830
699 Ga0501072_0133913
700 Ga0501074_0107321
701 Ga0501075_0005174
702 Ga0501075_0015797
703 Ga0501075_0054304
704 Ga0501075_0081463
705 Ga0501075_0097022
706 Ga0501075_0249672
707 Ga0501076_0011011
708 Ga0501076_0040241
709 Ga0501076_0084085
710 Ga0501077_0008370
711 Ga0501077_0041902
712 Ga0501077_0073622
713 Ga0501077_0203276
714 Ga0501079_0001714
715 Ga0501079_0005724
716 Ga0501079_0045646
717 Ga0501079_0101493
718 Ga0501079_0348713
719 Ga0501080_0305596
720 Ga0501081_0009252
721 Ga0501081_0019775
722 Ga0501083_0034663
723 Ga0501083_0191736
724 Ga0501045_0010976
725 Ga0501045_0056738
726 Ga0501045_0133555
727 nmdc:mga05p37_1381_c1
728 nmdc:mga05p37_15775_c1
729 nmdc:mga05p37_19298_c1
730 nmdc:mga05p37_2156_c1
731 nmdc:mga05p37_2162_c1
732 nmdc:mga05p37_26375_c1
733 nmdc:mga05p37_349510_c1
734 nmdc:mga05p37_505260_c1
735 nmdc:mga05p37_66743_c1
736 nmdc:mga05p37_7751_c1
737 nmdc:mga09592_19103_c1
738 nmdc:mga09592_24803_c1
739 nmdc:mga09592_25141_c1
740 nmdc:mga09592_39625_c1
741 nmdc:mga09592_405_c1
742 nmdc:mga09592_71007_c1
743 nmdc:mga09592_7764_c1
744 nmdc:mga0qj67_302_c1
745 nmdc:mga0qj67_41127_c1
746 nmdc:mga0qj67_42771_c1
747 nmdc:mga0qj67_50350_c2
748 nmdc:mga0qj67_96581_c1
749 nmdc:mga06r32_16564_c1
750 nmdc:mga06r32_17598_c1
751 nmdc:mga06r32_31187_c1
752 nmdc:mga06r32_4827_c1
753 nmdc:mga06r32_94979_c1
754 nmdc:mga06r32_9529_c1
755 nmdc:mga08y16_18496_c1
756 nmdc:mga08y16_35746_c1
757 nmdc:mga08y16_547_c1
758 nmdc:mga0n895_111850_c1
759 nmdc:mga0n895_113814_c1
760 nmdc:mga0n895_17483_c1
761 nmdc:mga0n895_200988_c1
762 nmdc:mga0n895_26583_c1
763 nmdc:mga0n895_32227_c1
764 nmdc:mga0n895_330041_c1
765 nmdc:mga0n895_471404_c1
766 nmdc:mga0n895_50231_c1
767 nmdc:mga0n895_6145_c1
768 nmdc:mga0rr50_144866_c1
769 nmdc:mga0rr50_31573_c1
770 nmdc:mga0rr50_61773_c1
771 nmdc:mga0rr50_9308_c1
772 nmdc:mga08x19_21449_c1
773 nmdc:mga08x19_27166_c1
774 nmdc:mga08x19_64243_c1
775 nmdc:mga08x19_7279_c1
776 nmdc:mga08x19_8098_c1
777 nmdc:mga08x19_99825_c1
778 nmdc:mga0a205_141954_c2
779 nmdc:mga0a205_154987_c1
780 nmdc:mga0a205_25290_c1
781 nmdc:mga0a205_2674_c1
782 nmdc:mga0a205_4535_c1
783 nmdc:mga0a205_6077_c1
784 nmdc:mga0a205_79746_c1
785 Ga0501084_0003566
786 Ga0501084_0009241
787 Ga0501084_0032881
788 Ga0501084_0054761
789 Ga0501082_0002443
790 Ga0501082_0010894
791 Ga0501082_0046539
792 Ga0501082_0172108
793 Ga0530510_0000168
794 Ga0530510_0002278
795 Ga0530510_0014836
796 Ga0530510_0022880
797 Ga0530510_0048733
798 Ga0530510_0077868
799 Ga0530510_0108003
800 Ga0530510_0142598

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01041

DegT_DnrJ_EryC1

DegT/DnrJ/EryC1/StrS aminotransferase family

9

343

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7b0d-assembly1.cif.gz_B sugar transaminase from archaeoglobus veneficus 0.9616 12 354
7n63-assembly1.cif.gz_A-2 x-ray structure of hcan_0200, an aminotransferase from helicobacter canadensis in complex with its external aldimine 0.9498 13 354
3nys-assembly1.cif.gz_A x-ray structure of the k185a mutant of wbpe (wlbe) from pseudomonas aeruginosa in complex with plp at 1.45 angstrom resolution 0.9485 12 351
5u1z-assembly2.cif.gz_C x-ray structure of the wlarg aminotransferase, apo form, from campylobacter jejune 0.9483 13 353
3frk-assembly1.cif.gz_B x-ray structure of qdtb from t. thermosaccharolyticum in complex with a plp:tdp-3-aminoquinovose aldimine 0.9473 1 353
ID Description Score Start End Superfamily
2ogaB02 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9639 239 358 3.90.1150.10
5u1zC02 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9452 239 353 3.90.1150.10
3frkB02 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9439 239 353 3.90.1150.10
af_Q58466_257_386_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9404 241 357 3.90.1150.10
af_Q58466_2_255_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9333 4 236 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A3D4E1S7-F1-model_v4 deleted 0.9852 68 180
AF-A0A2V6U1M7-F1-model_v4 Flavin reductase like domain-containing protein 0.9811 1 356 GO:0000271
GO:0008483
GO:0010181
GO:0016646
GO:0030170
AF-A0A7C2G448-F1-model_v4 DegT/DnrJ/EryC1/StrS family aminotransferase 0.9742 73 189 GO:0000271
GO:0008483
GO:0030170
AF-A0A352WTK3-F1-model_v4 Glutamine--scyllo-inositol aminotransferase 0.9734 40 194 GO:0000271
GO:0008483
GO:0030170
AF-A0A349NWH6-F1-model_v4 deleted 0.9731 72 194

Map