F434571

General Info

Members Datasets Scaffolds Average Seq Length
400 173 400 118

Family's Representative Sequence

Representative Sequence 3300011119|Ga0105246_11025960|Ga0105246_110259602
Length 144
Sequence MDMLSMLVICSLWYNFSTCKTFCDGEAMSQWIYIGLFFIVGLLIPVSAIAVAWILGPKKPNPIKQSTYECGIETVGDSWVQFKAQYYIFALVFLVFDVETVFLFPWAVKLSQLGLFAVVEGIIFILILIAGLVYTWRKGMLEWA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
102 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
103 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
104 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
107 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
108 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
109 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
110 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
113 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
114 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
115 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
124 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
125 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
127 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
128 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
129 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
130 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
131 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
132 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
133 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
134 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
135 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
136 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
137 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
138 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
139 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
140 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
147 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
158 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
159 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
160 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
163 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
164 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
167 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
168 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
171 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
172 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
173 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.75
Metatranscriptomes 1.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.75
Nodule 0
Rhizoplane 0.75
Rhizosphere 96.5
Stem 0
Stem Tuber 0
Unclassified 2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_366991 2162886007 Unclassified 2895
2 JGI25406J46586_10015545 3300003203 Bacteria 3206
3 rootL2_10034859 3300003322 Bacteria 2023
4 Ga0058859_11779417 3300004798 Bacteria 689
5 Ga0058859_11789624 3300004798 Bacteria 1303
6 Ga0058860_12093990 3300004801 Bacteria 764
7 Ga0065704_10089970 3300005289 Bacteria 2820
8 Ga0065712_10350406 3300005290 Unclassified 788
9 Ga0065715_11017631 3300005293 Unclassified 540
10 Ga0065707_10000491 3300005295 Bacteria 31842
11 Ga0065707_10002015 3300005295 Bacteria 5505
12 Ga0065707_10023774 3300005295 Bacteria 1454
13 Ga0065707_10097608 3300005295 Bacteria 3159
14 Ga0065707_10757144 3300005295 Unclassified 616
15 Ga0065707_10783249 3300005295 Bacteria 606
16 Ga0065707_10847647 3300005295 Bacteria 583
17 Ga0070690_100376524 3300005330 Bacteria 1037
18 Ga0068869_101463840 3300005334 Bacteria 606
19 Ga0070666_11086032 3300005335 Unclassified 595
20 Ga0070680_100147137 3300005336 Bacteria 1977
21 Ga0070682_100708390 3300005337 Bacteria 808
22 Ga0070689_100636433 3300005340 Bacteria 927
23 Ga0070689_100917246 3300005340 Bacteria 776
24 Ga0070687_100238784 3300005343 Bacteria 1122
25 Ga0070675_100388671 3300005354 Bacteria 1243
26 Ga0070673_100647020 3300005364 Unclassified 967
27 Ga0070688_100417325 3300005365 Bacteria 997
28 Ga0070667_100960108 3300005367 Bacteria 797
29 Ga0070701_11251690 3300005438 Unclassified 528
30 Ga0070705_100579044 3300005440 Bacteria 865
31 Ga0070705_100786595 3300005440 Bacteria 756
32 Ga0070700_100019187 3300005441 Bacteria 3944
33 Ga0070700_100434571 3300005441 Bacteria 995
34 Ga0070700_101081499 3300005441 Bacteria 664
35 Ga0070694_100162432 3300005444 Bacteria 1640
36 Ga0070694_100164847 3300005444 Bacteria 1629
37 Ga0070694_100306406 3300005444 Bacteria 1218
38 Ga0070694_100609319 3300005444 Bacteria 880
39 Ga0070694_101103994 3300005444 Bacteria 662
40 Ga0070662_101418756 3300005457 Bacteria 598
41 Ga0070662_101469154 3300005457 Bacteria 588
42 Ga0070685_10149705 3300005466 Bacteria 1478
43 Ga0070706_100325647 3300005467 Bacteria 1433
44 Ga0070706_100793946 3300005467 Bacteria 876
45 Ga0070707_100078233 3300005468 Bacteria 3190
46 Ga0070707_100773396 3300005468 Bacteria 924
47 Ga0070707_100777808 3300005468 Bacteria 921
48 Ga0070707_101157185 3300005468 Bacteria 740
49 Ga0070698_100101941 3300005471 Bacteria 2841
50 Ga0070698_100107016 3300005471 Bacteria 2765
51 Ga0070698_100286169 3300005471 Bacteria 1579
52 Ga0070698_100462462 3300005471 Bacteria 1205
53 Ga0070698_100482581 3300005471 Bacteria 1176
54 Ga0070698_102064431 3300005471 Bacteria 523
55 Ga0070699_100011209 3300005518 Bacteria 7745
56 Ga0070699_100085366 3300005518 Bacteria 2755
57 Ga0070699_100100003 3300005518 Bacteria 2542
58 Ga0070699_100380169 3300005518 Bacteria 1275
59 Ga0070699_100536189 3300005518 Bacteria 1065
60 Ga0070699_100852173 3300005518 Bacteria 834
61 Ga0070684_100101906 3300005535 Bacteria 2566
62 Ga0070686_100148195 3300005544 Bacteria 1641
63 Ga0070695_100961928 3300005545 Bacteria 693
64 Ga0070696_100206742 3300005546 Bacteria 1468
65 Ga0070696_100488376 3300005546 Bacteria 978
66 Ga0070696_100687724 3300005546 Bacteria 833
67 Ga0070693_100574489 3300005547 Viruses 810
68 Ga0070693_101143450 3300005547 Bacteria 595
69 Ga0070704_100870551 3300005549 Bacteria 809
70 Ga0070704_101291349 3300005549 Bacteria 668
71 Ga0068857_100122946 3300005577 Unclassified 2338
72 Ga0068857_100520348 3300005577 Bacteria 1118
73 Ga0068859_100441754 3300005617 Bacteria 1397
74 Ga0068859_101076038 3300005617 Bacteria 884
75 Ga0068859_101899234 3300005617 Bacteria 657
76 Ga0068864_100055563 3300005618 Bacteria 3419
77 Ga0068864_100687168 3300005618 Bacteria 999
78 Ga0068864_101781647 3300005618 Unclassified 621
79 Ga0068861_100039538 3300005719 Bacteria 3521
80 Ga0068861_100251345 3300005719 Bacteria 1508
81 Ga0068870_10797528 3300005840 Bacteria 660
82 Ga0068863_100270571 3300005841 Bacteria 1644
83 Ga0068858_100089971 3300005842 Bacteria 2856
84 Ga0068860_101291956 3300005843 Bacteria 750
85 Ga0068860_102452153 3300005843 Unclassified 541
86 Ga0068862_100056783 3300005844 Unclassified 3355
87 Ga0068862_100142214 3300005844 Bacteria 2130
88 Ga0068862_100202908 3300005844 Bacteria 1789
89 Ga0081539_10003721 3300005985 Bacteria 18169
90 Ga0075365_11130773 3300006038 Bacteria 551
91 Ga0075427_10004767 3300006194 Bacteria 1914
92 Ga0075370_11021416 3300006353 Bacteria 507
93 Ga0068871_101704055 3300006358 Bacteria 598
94 Ga0075428_100133422 3300006844 Bacteria 2700
95 Ga0075428_100241026 3300006844 Bacteria 1951
96 Ga0075428_100602417 3300006844 Bacteria 1173
97 Ga0075428_101980910 3300006844 Unclassified 604
98 Ga0075430_100229064 3300006846 Bacteria 1541
99 Ga0075430_100233341 3300006846 Bacteria 1525
100 Ga0075430_100482026 3300006846 Bacteria 1023
101 Ga0075431_100103380 3300006847 Bacteria 2940
102 Ga0075431_100160740 3300006847 Bacteria 2310
103 Ga0075431_100890678 3300006847 Bacteria 860
104 Ga0075431_101120784 3300006847 Bacteria 751
105 Ga0075431_101542592 3300006847 Bacteria 622
106 Ga0075433_10054511 3300006852 Bacteria 3488
107 Ga0075433_10096788 3300006852 Bacteria 2612
108 Ga0075433_10122082 3300006852 Bacteria 2314
109 Ga0075433_10728596 3300006852 Bacteria 868
110 Ga0075433_10839849 3300006852 Unclassified 802
111 Ga0075434_100574378 3300006871 Bacteria 1147
112 Ga0075434_101443481 3300006871 Bacteria 698
113 Ga0075434_101776655 3300006871 Bacteria 624
114 Ga0075429_100021228 3300006880 Bacteria 5629
115 Ga0075429_100025585 3300006880 Bacteria 5123
116 Ga0075429_100299468 3300006880 Unclassified 1408
117 Ga0075429_100400795 3300006880 Bacteria 1202
118 Ga0075429_100607279 3300006880 Bacteria 958
119 Ga0097620_100441796 3300006931 Bacteria 1397
120 Ga0097620_101076097 3300006931 Bacteria 884
121 Ga0097620_101899294 3300006931 Bacteria 657
122 Ga0105240_11031568 3300009093 Bacteria 878
123 Ga0111539_12232822 3300009094 Bacteria 635
124 Ga0105245_10543006 3300009098 Bacteria 1184
125 Ga0105245_12357486 3300009098 Bacteria 586
126 Ga0105247_10282188 3300009101 Bacteria 1146
127 Ga0105247_10802026 3300009101 Bacteria 718
128 Ga0105247_11491849 3300009101 Bacteria 551
129 Ga0114129_10009980 3300009147 Bacteria 13532
130 Ga0114129_10040697 3300009147 Bacteria 6551
131 Ga0114129_10133573 3300009147 Bacteria 3407
132 Ga0114129_10272890 3300009147 Bacteria 2262
133 Ga0114129_10279912 3300009147 Unclassified 2229
134 Ga0114129_10293459 3300009147 Unclassified 2169
135 Ga0114129_10471676 3300009147 Bacteria 1643
136 Ga0114129_10547848 3300009147 Bacteria 1505
137 Ga0114129_10967809 3300009147 Unclassified 1074
138 Ga0114129_10996381 3300009147 Bacteria 1055
139 Ga0114129_11017192 3300009147 Bacteria 1043
140 Ga0114129_11159836 3300009147 Bacteria 964
141 Ga0114129_11389198 3300009147 Bacteria 867
142 Ga0114129_12196980 3300009147 Bacteria 664
143 Ga0114129_12226107 3300009147 Unclassified 659
144 Ga0114129_12336991 3300009147 Unclassified 641
145 Ga0105243_10179229 3300009148 Bacteria 1841
146 Ga0105243_10265042 3300009148 Bacteria 1540
147 Ga0105243_10609166 3300009148 Bacteria 1052
148 Ga0105243_10964958 3300009148 Bacteria 852
149 Ga0105243_11537952 3300009148 Unclassified 690
150 Ga0105243_12387477 3300009148 Bacteria 567
151 Ga0105243_12986221 3300009148 Unclassified 513
152 Ga0105241_11640312 3300009174 Unclassified 623
153 Ga0105242_10141131 3300009176 Unclassified 2090
154 Ga0105242_10892666 3300009176 Unclassified 888
155 Ga0105237_11967668 3300009545 Bacteria 593
156 Ga0105249_10025036 3300009553 Bacteria 5370
157 Ga0105249_10080556 3300009553 Bacteria 3025
158 Ga0105249_10216695 3300009553 Bacteria 1882
159 Ga0105249_10722471 3300009553 Bacteria 1057
160 Ga0105249_11342933 3300009553 Bacteria 787
161 Ga0105249_11573347 3300009553 Unclassified 730
162 Ga0105246_10014667 3300011119 Bacteria 4931
163 Ga0105246_10585024 3300011119 Bacteria 962
164 Ga0105246_11025960 3300011119 Bacteria 748
165 Ga0157374_10253800 3300013296 Bacteria 1731
166 Ga0157378_10166699 3300013297 Bacteria 2064
167 Ga0163163_11333260 3300014325 Bacteria 779
168 Ga0157380_10108254 3300014326 Bacteria 2329
169 Ga0157380_11226880 3300014326 Bacteria 794
170 Ga0157379_10960706 3300014968 Bacteria 813
171 Ga0157376_10643686 3300014969 Bacteria 1060
172 Ga0213875_10144187 3300021388 Bacteria 1115
173 Ga0207710_10777940 3300025900 Bacteria 503
174 Ga0207643_10219038 3300025908 Bacteria 1164
175 Ga0207684_10710289 3300025910 Bacteria 854
176 Ga0207646_10307576 3300025922 Bacteria 1432
177 Ga0207646_10936980 3300025922 Bacteria 767
178 Ga0207646_11135780 3300025922 Bacteria 687
179 Ga0207681_11035530 3300025923 Bacteria 689
180 Ga0207650_10716117 3300025925 Bacteria 846
181 Ga0207650_11561516 3300025925 Bacteria 561
182 Ga0207659_11009922 3300025926 Unclassified 716
183 Ga0207687_10829680 3300025927 Bacteria 789
184 Ga0207644_10417617 3300025931 Bacteria 1099
185 Ga0207706_10869477 3300025933 Bacteria 763
186 Ga0207706_11577868 3300025933 Unclassified 533
187 Ga0207709_10297515 3300025935 Bacteria 1199
188 Ga0207709_10335955 3300025935 Bacteria 1135
189 Ga0207709_10404820 3300025935 Bacteria 1044
190 Ga0207709_10574380 3300025935 Bacteria 890
191 Ga0207709_10868051 3300025935 Bacteria 732
192 Ga0207670_10314777 3300025936 Bacteria 1230
193 Ga0207670_11201994 3300025936 Bacteria 642
194 Ga0207712_10046046 3300025961 Bacteria 3022
195 Ga0207712_10116811 3300025961 Bacteria 2011
196 Ga0207712_10164799 3300025961 Bacteria 1726
197 Ga0207712_10241304 3300025961 Bacteria 1456
198 Ga0207677_11635171 3300026023 Bacteria 597
199 Ga0207703_10611534 3300026035 Bacteria 1031
200 Ga0207703_10631555 3300026035 Bacteria 1015
201 Ga0207678_10391151 3300026067 Bacteria 1203
202 Ga0207708_10395611 3300026075 Bacteria 1142
203 Ga0207648_10203523 3300026089 Unclassified 1756
204 Ga0207676_10073976 3300026095 Bacteria 2744
205 Ga0207676_10519589 3300026095 Bacteria 1133
206 Ga0207674_10114036 3300026116 Unclassified 2675
207 Ga0207674_10894201 3300026116 Unclassified 856
208 Ga0207674_10894420 3300026116 Bacteria 856
209 Ga0207675_100109822 3300026118 Bacteria 2602
210 Ga0207675_100145490 3300026118 Bacteria 2253
211 Ga0207675_101248314 3300026118 Bacteria 763
212 Ga0209996_1078402 3300027395 Unclassified 517
213 Ga0209966_1050196 3300027695 Bacteria 886
214 Ga0268265_10264811 3300028380 Unclassified 1530
215 Ga0268265_10331662 3300028380 Bacteria 1382
216 Ga0268265_10465086 3300028380 Bacteria 1184
217 Ga0268265_11352384 3300028380 Bacteria 713
218 Ga0268264_10595989 3300028381 Bacteria 1089
219 Ga0268264_10673570 3300028381 Bacteria 1025
220 Ga0268264_12593115 3300028381 Unclassified 511
221 Ga0265326_10123707 3300028558 Bacteria 736
222 Ga0265334_10013913 3300028573 Bacteria 3362
223 Ga0265323_10023161 3300028653 Archaea 2369
224 Ga0265322_10011617 3300028654 Bacteria 2550
225 Ga0265338_10010498 3300028800 Bacteria 10845
226 Ga0307512_10455618 3300030522 Bacteria 515
227 Ga0265320_10065045 3300031240 Unclassified 1731
228 Ga0265340_10010681 3300031247 Bacteria 4906
229 Ga0265331_10272000 3300031250 Unclassified 759
230 Ga0265327_10011415 3300031251 Bacteria 6117
231 Ga0307408_100530173 3300031548 Unclassified 1036
232 Ga0265313_10324426 3300031595 Unclassified 614
233 Ga0316575_10055393 3300031665 Bacteria 1579
234 Ga0316576_10036124 3300031727 Bacteria 3531
235 Ga0316578_10271463 3300031728 Bacteria 1016
236 Ga0316578_10374524 3300031728 Unclassified 846
237 Ga0307405_10228858 3300031731 Unclassified 1369
238 Ga0316577_10011981 3300031733 Bacteria 4714
239 Ga0316577_10528778 3300031733 Bacteria 671
240 Ga0316577_10670604 3300031733 Unclassified 589
241 Ga0307406_10652309 3300031901 Bacteria 874
242 Ga0307407_10030880 3300031903 Bacteria 2895
243 Ga0307412_10038527 3300031911 Bacteria 3079
244 Ga0307409_101908957 3300031995 Unclassified 623
245 Ga0307416_100062838 3300032002 Bacteria 3038
246 Ga0307411_10121529 3300032005 Bacteria 1891
247 Ga0307415_100153692 3300032126 Bacteria 1774
248 Ga0316592_1055716 3300033524 Bacteria 885
249 Ga0373949_0140318 3300035090 Bacteria 692
250 Ga0373932_0124121 3300035112 Bacteria 864
251 Ga0373939_0154126 3300035114 Bacteria 839
252 Ga0373961_0151388 3300035241 Bacteria 791
253 Ga0316574_0717927 3300035398 Bacteria 612
254 Ga0373933_0494702 3300035724 Bacteria 801
255 Ga0316582_0604292 3300036647 Unclassified 755
256 Ga0316582_0857696 3300036647 Bacteria 622
257 Ga0316584_0346241 3300036712 Bacteria 1068
258 Ga0436364_0980478 3300037853 Bacteria 1518
259 Ga0451791_0447273 3300041451 Unclassified 592
260 Ga0451853_2903633 3300041512 Bacteria 1136
261 Ga0439446_0356481 3300042156 Bacteria 522
262 Ga0451577_0003127 3300042876 Bacteria 18678
263 Ga0451577_0010692 3300042876 Bacteria 8738
264 Ga0451577_0024147 3300042876 Bacteria 5532
265 Ga0451577_0131466 3300042876 Bacteria 2245
266 Ga0451577_0151934 3300042876 Bacteria 2083
267 Ga0451577_0174877 3300042876 Bacteria 1935
268 Ga0451577_0191912 3300042876 Bacteria 1843
269 Ga0451577_0299149 3300042876 Bacteria 1458
270 Ga0451577_0323875 3300042876 Bacteria 1398
271 Ga0451577_0961829 3300042876 Unclassified 768
272 Ga0451577_1144456 3300042876 Bacteria 695
273 Ga0453683_0002264 3300044673 Bacteria 15201
274 Ga0453683_0008026 3300044673 Bacteria 7111
275 Ga0453683_0069525 3300044673 Bacteria 2201
276 Ga0453683_0265684 3300044673 Bacteria 1095
277 Ga0453683_0328126 3300044673 Unclassified 981
278 Ga0453683_0333202 3300044673 Unclassified 973
279 Ga0453683_1049115 3300044673 Bacteria 542
280 Ga0453684_0000007 3300044712 Bacteria 1301482
281 Ga0453684_0000044 3300044712 Bacteria 585643
282 Ga0453684_0000047 3300044712 Bacteria 560243
283 Ga0453684_0000458 3300044712 Bacteria 163146
284 Ga0453684_0005135 3300044712 Bacteria 26338
285 Ga0453684_0006285 3300044712 Bacteria 22725
286 Ga0453684_0006496 3300044712 Bacteria 22177
287 Ga0453684_0009709 3300044712 Bacteria 16743
288 Ga0453684_0009852 3300044712 Bacteria 16545
289 Ga0453684_0015867 3300044712 Bacteria 11842
290 Ga0453684_0018370 3300044712 Bacteria 10736
291 Ga0453684_0022347 3300044712 Bacteria 9388
292 Ga0453684_0028663 3300044712 Bacteria 7934
293 Ga0453684_0039678 3300044712 Bacteria 6409
294 Ga0453684_0041567 3300044712 Bacteria 6215
295 Ga0453684_0045678 3300044712 Bacteria 5838
296 Ga0453684_0100666 3300044712 Bacteria 3537
297 Ga0453684_0100881 3300044712 Unclassified 3533
298 Ga0453684_0112267 3300044712 Bacteria 3309
299 Ga0453684_0117222 3300044712 Bacteria 3223
300 Ga0453684_0188196 3300044712 Bacteria 2417
301 Ga0453684_0194746 3300044712 Bacteria 2368
302 Ga0453684_0239814 3300044712 Unclassified 2088
303 Ga0453684_0244769 3300044712 Bacteria 2063
304 Ga0453684_0260611 3300044712 Bacteria 1986
305 Ga0453684_0268816 3300044712 Archaea 1949
306 Ga0453684_0308681 3300044712 Bacteria 1796
307 Ga0453684_0347642 3300044712 Bacteria 1673
308 Ga0453684_0446397 3300044712 Bacteria 1440
309 Ga0453684_0487320 3300044712 Unclassified 1367
310 Ga0453684_0488337 3300044712 Bacteria 1365
311 Ga0453684_0524584 3300044712 Bacteria 1308
312 Ga0453684_0536211 3300044712 Bacteria 1291
313 Ga0453684_0555051 3300044712 Bacteria 1265
314 Ga0453684_0584719 3300044712 Bacteria 1226
315 Ga0453684_0645396 3300044712 Bacteria 1156
316 Ga0453684_0799502 3300044712 Bacteria 1017
317 Ga0453684_1237063 3300044712 Bacteria 782
318 Ga0453684_1319267 3300044712 Bacteria 752
319 Ga0453684_1438353 3300044712 Bacteria 713
320 Ga0453684_1741182 3300044712 Bacteria 635
321 Ga0453684_1955652 3300044712 Bacteria 592
322 Ga0453684_2056572 3300044712 Bacteria 574
323 Ga0453684_2397964 3300044712 Unclassified 523
324 Ga0451576_0000009 3300045051 Bacteria 712666
325 Ga0451576_0019360 3300045051 Bacteria 7429
326 Ga0451576_0026063 3300045051 Bacteria 6290
327 Ga0451576_0032891 3300045051 Bacteria 5514
328 Ga0451576_0208907 3300045051 Bacteria 2039
329 Ga0451576_0228086 3300045051 Bacteria 1945
330 Ga0451576_0476842 3300045051 Bacteria 1310
331 Ga0451576_0546798 3300045051 Bacteria 1216
332 Ga0451576_2265092 3300045051 Bacteria 557
333 Ga0495686_0457598 3300047472 Bacteria 677
334 Ga0496106_0955554 3300048909 Unclassified 675
335 Ga0496108_0000219 3300048911 Bacteria 51931
336 Ga0501308_084698 3300049128 Unclassified 509
337 Ga0501298_080578 3300049521 Bacteria 716
338 Ga0501299_019981 3300049522 Bacteria 1217
339 Ga0501034_0013458 3300049571 Bacteria 8420
340 Ga0501036_1369818 3300049572 Bacteria 574
341 Ga0501041_0169736 3300049577 Bacteria 1365
342 Ga0501041_0890615 3300049577 Unclassified 572
343 Ga0501042_0550204 3300049578 Bacteria 839
344 Ga0501071_0628137 3300049587 Unclassified 826
345 Ga0501072_0272608 3300049588 Unclassified 1346
346 Ga0501073_0018075 3300049589 Bacteria 5098
347 Ga0501073_0048492 3300049589 Bacteria 2981
348 Ga0501073_0119071 3300049589 Bacteria 1830
349 Ga0501073_0886556 3300049589 Unclassified 614
350 Ga0501075_0079705 3300049591 Unclassified 2478
351 Ga0501075_0660007 3300049591 Unclassified 797
352 Ga0501076_0059655 3300049592 Bacteria 3035
353 Ga0501076_0452707 3300049592 Bacteria 1057
354 Ga0501198_044515 3300049649 Bacteria 777
355 Ga0501243_069114 3300049675 Bacteria 668
356 Ga0501257_006691 3300049686 Bacteria 2561
357 Ga0501257_026154 3300049686 Bacteria 1391
358 Ga0501079_0013494 3300049741 Bacteria 6230
359 Ga0501079_1383732 3300049741 Bacteria 554
360 Ga0501080_0301872 3300049742 Bacteria 1452
361 Ga0501080_1719297 3300049742 Unclassified 529
362 Ga0501081_0155476 3300049743 Bacteria 1645
363 Ga0501045_1288398 3300049824 Bacteria 532
364 nmdc:mga0yw44_941434_c1 3300050492 Bacteria 585
365 nmdc:mga05p37_1692219_c1 3300050507 Bacteria 617
366 nmdc:mga05p37_241286_c1 3300050507 Unclassified 2173
367 nmdc:mga05p37_269626_c1 3300050507 Bacteria 2034
368 nmdc:mga05p37_32947_c1 3300050507 Bacteria 6343
369 nmdc:mga05p37_64238_c1 3300050507 Bacteria 4517
370 nmdc:mga05p37_674384_c1 3300050507 Bacteria 1153
371 nmdc:mga05p37_681489_c1 3300050507 Bacteria 1145
372 nmdc:mga05p37_885911_c1 3300050507 Bacteria 964
373 nmdc:mga05p37_97715_c1 3300050507 Bacteria 3617
374 nmdc:mga09592_123236_c1 3300050508 Bacteria 2227
375 nmdc:mga09592_369994_c1 3300050508 Bacteria 1240
376 nmdc:mga09592_42154_c1 3300050508 Unclassified 3839
377 nmdc:mga09592_73693_c1 3300050508 Bacteria 2901
378 nmdc:mga09592_913005_c1 3300050508 Bacteria 738
379 nmdc:mga0qj67_211707_c1 3300050509 Bacteria 1574
380 nmdc:mga0qj67_491097_c1 3300050509 Bacteria 987
381 nmdc:mga06r32_1024369_c1 3300050510 Bacteria 777
382 nmdc:mga06r32_165144_c1 3300050510 Bacteria 2197
383 nmdc:mga06r32_634736_c1 3300050510 Bacteria 1037
384 nmdc:mga06r32_763123_c1 3300050510 Bacteria 930
385 nmdc:mga06r32_885980_c1 3300050510 Bacteria 849
386 nmdc:mga0n895_804698_c1 3300050512 Bacteria 930
387 nmdc:mga0n895_816986_c1 3300050512 Unclassified 922
388 nmdc:mga0n895_915270_c1 3300050512 Bacteria 862
389 nmdc:mga0a205_1362931_c1 3300050515 Bacteria 557
390 nmdc:mga0a205_1458632_c1 3300050515 Bacteria 532
391 nmdc:mga0a205_1563_c2 3300050515 Bacteria 14343
392 nmdc:mga0a205_21296_c2 3300050515 Bacteria 3998
393 nmdc:mga0a205_300224_c1 3300050515 Bacteria 1479
394 Ga0501084_0004268 3300054114 Bacteria 11631
395 Ga0501084_0136465 3300054114 Bacteria 2065
396 Ga0501084_1450399 3300054114 Bacteria 575
397 Ga0501082_0986076 3300060353 Bacteria 737
398 Ga0501082_1037125 3300060353 Unclassified 717
399 Ga0530510_0009728 3300061734 Bacteria 6746
400 Ga0530510_0124277 3300061734 Unclassified 1896

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050510 nmdc:mga06r32_885980_c1 nmdc:mga06r32_885980_c1_291_686 112
2 3300031728 Ga0316578_10374524 Ga0316578_103745242 116
3 2162886007 SwRhRL2b_contig_366991 SwRhRL2b_0193.00006010 117
4 3300003203 JGI25406J46586_10015545 JGI25406J46586_100155452 117
5 3300003322 rootL2_10034859 rootL2_100348591 117
6 3300004798 Ga0058859_11779417 Ga0058859_117794172 117
7 3300004798 Ga0058859_11789624 Ga0058859_117896242 117
8 3300004801 Ga0058860_12093990 Ga0058860_120939901 117
9 3300005289 Ga0065704_10089970 Ga0065704_100899702 117
10 3300005290 Ga0065712_10350406 Ga0065712_103504062 117
11 3300005293 Ga0065715_11017631 Ga0065715_110176311 117
12 3300005295 Ga0065707_10000491 Ga0065707_100004912 117
13 3300005295 Ga0065707_10002015 Ga0065707_100020154 117
14 3300005295 Ga0065707_10023774 Ga0065707_100237741 117
15 3300005295 Ga0065707_10097608 Ga0065707_100976082 117
16 3300005295 Ga0065707_10757144 Ga0065707_107571441 117
17 3300005295 Ga0065707_10783249 Ga0065707_107832491 117
18 3300005295 Ga0065707_10847647 Ga0065707_108476471 117
19 3300005330 Ga0070690_100376524 Ga0070690_1003765241 117
20 3300005334 Ga0068869_101463840 Ga0068869_1014638402 117
21 3300005335 Ga0070666_11086032 Ga0070666_110860321 117
22 3300005336 Ga0070680_100147137 Ga0070680_1001471372 117
23 3300005337 Ga0070682_100708390 Ga0070682_1007083901 117
24 3300005340 Ga0070689_100636433 Ga0070689_1006364331 117
25 3300005340 Ga0070689_100917246 Ga0070689_1009172462 117
26 3300005343 Ga0070687_100238784 Ga0070687_1002387842 117
27 3300005354 Ga0070675_100388671 Ga0070675_1003886712 117
28 3300005364 Ga0070673_100647020 Ga0070673_1006470202 117
29 3300005365 Ga0070688_100417325 Ga0070688_1004173252 117
30 3300005367 Ga0070667_100960108 Ga0070667_1009601082 117
31 3300005438 Ga0070701_11251690 Ga0070701_112516901 117
32 3300005440 Ga0070705_100579044 Ga0070705_1005790442 117
33 3300005440 Ga0070705_100786595 Ga0070705_1007865952 117
34 3300005441 Ga0070700_100019187 Ga0070700_1000191872 117
35 3300005441 Ga0070700_100434571 Ga0070700_1004345712 117
36 3300005441 Ga0070700_101081499 Ga0070700_1010814991 117
37 3300005444 Ga0070694_100162432 Ga0070694_1001624322 117
38 3300005444 Ga0070694_100164847 Ga0070694_1001648472 117
39 3300005444 Ga0070694_100306406 Ga0070694_1003064062 117
40 3300005444 Ga0070694_100609319 Ga0070694_1006093192 117
41 3300005444 Ga0070694_101103994 Ga0070694_1011039941 117
42 3300005457 Ga0070662_101418756 Ga0070662_1014187561 117
43 3300005457 Ga0070662_101469154 Ga0070662_1014691541 117
44 3300005466 Ga0070685_10149705 Ga0070685_101497051 117
45 3300005467 Ga0070706_100325647 Ga0070706_1003256472 117
46 3300005467 Ga0070706_100793946 Ga0070706_1007939461 117
47 3300005468 Ga0070707_100078233 Ga0070707_1000782331 117
48 3300005468 Ga0070707_100773396 Ga0070707_1007733961 117
49 3300005468 Ga0070707_100777808 Ga0070707_1007778081 117
50 3300005468 Ga0070707_101157185 Ga0070707_1011571852 117
51 3300005471 Ga0070698_100101941 Ga0070698_1001019413 117
52 3300005471 Ga0070698_100107016 Ga0070698_1001070164 117
53 3300005471 Ga0070698_100286169 Ga0070698_1002861692 117
54 3300005471 Ga0070698_100462462 Ga0070698_1004624622 117
55 3300005471 Ga0070698_100482581 Ga0070698_1004825812 117
56 3300005471 Ga0070698_102064431 Ga0070698_1020644311 117
57 3300005518 Ga0070699_100011209 Ga0070699_1000112095 117
58 3300005518 Ga0070699_100085366 Ga0070699_1000853663 117
59 3300005518 Ga0070699_100100003 Ga0070699_1001000032 117
60 3300005518 Ga0070699_100380169 Ga0070699_1003801691 117
61 3300005518 Ga0070699_100536189 Ga0070699_1005361892 117
62 3300005518 Ga0070699_100852173 Ga0070699_1008521731 117
63 3300005535 Ga0070684_100101906 Ga0070684_1001019062 117
64 3300005544 Ga0070686_100148195 Ga0070686_1001481952 117
65 3300005545 Ga0070695_100961928 Ga0070695_1009619282 117
66 3300005546 Ga0070696_100206742 Ga0070696_1002067421 117
67 3300005546 Ga0070696_100488376 Ga0070696_1004883762 117
68 3300005546 Ga0070696_100687724 Ga0070696_1006877242 117
69 3300005547 Ga0070693_100574489 Ga0070693_1005744892 117
70 3300005547 Ga0070693_101143450 Ga0070693_1011434501 117
71 3300005549 Ga0070704_100870551 Ga0070704_1008705511 117
72 3300005549 Ga0070704_101291349 Ga0070704_1012913491 117
73 3300005577 Ga0068857_100122946 Ga0068857_1001229463 117
74 3300005577 Ga0068857_100520348 Ga0068857_1005203482 117
75 3300005617 Ga0068859_100441754 Ga0068859_1004417542 117
76 3300005617 Ga0068859_101076038 Ga0068859_1010760382 117
77 3300005617 Ga0068859_101899234 Ga0068859_1018992343 117
78 3300005618 Ga0068864_100055563 Ga0068864_1000555632 117
79 3300005618 Ga0068864_100687168 Ga0068864_1006871682 117
80 3300005618 Ga0068864_101781647 Ga0068864_1017816471 117
81 3300005719 Ga0068861_100039538 Ga0068861_1000395383 117
82 3300005719 Ga0068861_100251345 Ga0068861_1002513452 117
83 3300005840 Ga0068870_10797528 Ga0068870_107975282 117
84 3300005841 Ga0068863_100270571 Ga0068863_1002705711 117
85 3300005842 Ga0068858_100089971 Ga0068858_1000899712 117
86 3300005843 Ga0068860_101291956 Ga0068860_1012919562 117
87 3300005843 Ga0068860_102452153 Ga0068860_1024521532 117
88 3300005844 Ga0068862_100056783 Ga0068862_1000567832 117
89 3300005844 Ga0068862_100142214 Ga0068862_1001422143 117
90 3300005844 Ga0068862_100202908 Ga0068862_1002029082 117
91 3300005985 Ga0081539_10003721 Ga0081539_100037216 117
92 3300006038 Ga0075365_11130773 Ga0075365_111307731 117
93 3300006194 Ga0075427_10004767 Ga0075427_100047673 117
94 3300006353 Ga0075370_11021416 Ga0075370_110214161 117
95 3300006358 Ga0068871_101704055 Ga0068871_1017040551 117
96 3300006844 Ga0075428_100133422 Ga0075428_1001334224 117
97 3300006844 Ga0075428_100241026 Ga0075428_1002410262 117
98 3300006844 Ga0075428_100602417 Ga0075428_1006024172 117
99 3300006844 Ga0075428_101980910 Ga0075428_1019809102 117
100 3300006846 Ga0075430_100229064 Ga0075430_1002290642 117
101 3300006846 Ga0075430_100233341 Ga0075430_1002333412 117
102 3300006846 Ga0075430_100482026 Ga0075430_1004820262 117
103 3300006847 Ga0075431_100103380 Ga0075431_1001033801 117
104 3300006847 Ga0075431_100160740 Ga0075431_1001607403 117
105 3300006847 Ga0075431_100890678 Ga0075431_1008906782 117
106 3300006847 Ga0075431_101120784 Ga0075431_1011207842 117
107 3300006847 Ga0075431_101542592 Ga0075431_1015425921 117
108 3300006852 Ga0075433_10054511 Ga0075433_100545112 117
109 3300006852 Ga0075433_10096788 Ga0075433_100967884 117
110 3300006852 Ga0075433_10122082 Ga0075433_101220823 117
111 3300006852 Ga0075433_10728596 Ga0075433_107285961 117
112 3300006852 Ga0075433_10839849 Ga0075433_108398491 117
113 3300006871 Ga0075434_100574378 Ga0075434_1005743782 117
114 3300006871 Ga0075434_101443481 Ga0075434_1014434812 117
115 3300006871 Ga0075434_101776655 Ga0075434_1017766551 117
116 3300006880 Ga0075429_100021228 Ga0075429_1000212285 117
117 3300006880 Ga0075429_100025585 Ga0075429_1000255853 117
118 3300006880 Ga0075429_100299468 Ga0075429_1002994682 117
119 3300006880 Ga0075429_100400795 Ga0075429_1004007952 117
120 3300006880 Ga0075429_100607279 Ga0075429_1006072791 117
121 3300006931 Ga0097620_100441796 Ga0097620_1004417962 117
122 3300006931 Ga0097620_101076097 Ga0097620_1010760972 117
123 3300006931 Ga0097620_101899294 Ga0097620_1018992943 117
124 3300009093 Ga0105240_11031568 Ga0105240_110315682 117
125 3300009094 Ga0111539_12232822 Ga0111539_122328222 117
126 3300009098 Ga0105245_10543006 Ga0105245_105430061 117
127 3300009098 Ga0105245_12357486 Ga0105245_123574861 117
128 3300009101 Ga0105247_10282188 Ga0105247_102821882 117
129 3300009101 Ga0105247_10802026 Ga0105247_108020262 117
130 3300009101 Ga0105247_11491849 Ga0105247_114918491 117
131 3300009147 Ga0114129_10009980 Ga0114129_1000998010 117
132 3300009147 Ga0114129_10040697 Ga0114129_100406972 117
133 3300009147 Ga0114129_10133573 Ga0114129_101335733 117
134 3300009147 Ga0114129_10272890 Ga0114129_102728903 117
135 3300009147 Ga0114129_10279912 Ga0114129_102799121 117
136 3300009147 Ga0114129_10293459 Ga0114129_102934592 117
137 3300009147 Ga0114129_10471676 Ga0114129_104716762 117
138 3300009147 Ga0114129_10547848 Ga0114129_105478482 117
139 3300009147 Ga0114129_10967809 Ga0114129_109678091 117
140 3300009147 Ga0114129_10996381 Ga0114129_109963811 117
141 3300009147 Ga0114129_11017192 Ga0114129_110171923 117
142 3300009147 Ga0114129_11159836 Ga0114129_111598362 117
143 3300009147 Ga0114129_11389198 Ga0114129_113891981 117
144 3300009147 Ga0114129_12196980 Ga0114129_121969802 117
145 3300009147 Ga0114129_12226107 Ga0114129_122261071 117
146 3300009147 Ga0114129_12336991 Ga0114129_123369911 117
147 3300009148 Ga0105243_10179229 Ga0105243_101792294 117
148 3300009148 Ga0105243_10265042 Ga0105243_102650422 117
149 3300009148 Ga0105243_10609166 Ga0105243_106091662 117
150 3300009148 Ga0105243_10964958 Ga0105243_109649582 117
151 3300009148 Ga0105243_11537952 Ga0105243_115379522 117
152 3300009148 Ga0105243_12387477 Ga0105243_123874771 117
153 3300009148 Ga0105243_12986221 Ga0105243_129862211 117
154 3300009174 Ga0105241_11640312 Ga0105241_116403121 117
155 3300009176 Ga0105242_10141131 Ga0105242_101411312 117
156 3300009176 Ga0105242_10892666 Ga0105242_108926662 117
157 3300009545 Ga0105237_11967668 Ga0105237_119676682 117
158 3300009553 Ga0105249_10025036 Ga0105249_100250366 117
159 3300009553 Ga0105249_10080556 Ga0105249_100805562 117
160 3300009553 Ga0105249_10216695 Ga0105249_102166952 117
161 3300009553 Ga0105249_10722471 Ga0105249_107224712 117
162 3300009553 Ga0105249_11342933 Ga0105249_113429332 117
163 3300009553 Ga0105249_11573347 Ga0105249_115733472 117
164 3300011119 Ga0105246_10014667 Ga0105246_100146672 117
165 3300011119 Ga0105246_10585024 Ga0105246_105850242 117
166 3300011119 Ga0105246_11025960 Ga0105246_110259602 117
167 3300013296 Ga0157374_10253800 Ga0157374_102538002 117
168 3300013297 Ga0157378_10166699 Ga0157378_101666993 117
169 3300014325 Ga0163163_11333260 Ga0163163_113332601 117
170 3300014326 Ga0157380_10108254 Ga0157380_101082543 117
171 3300014326 Ga0157380_11226880 Ga0157380_112268802 117
172 3300014968 Ga0157379_10960706 Ga0157379_109607062 117
173 3300014969 Ga0157376_10643686 Ga0157376_106436861 117
174 3300021388 Ga0213875_10144187 Ga0213875_101441872 117
175 3300025900 Ga0207710_10777940 Ga0207710_107779401 117
176 3300025908 Ga0207643_10219038 Ga0207643_102190382 117
177 3300025910 Ga0207684_10710289 Ga0207684_107102891 117
178 3300025922 Ga0207646_10307576 Ga0207646_103075762 117
179 3300025922 Ga0207646_10936980 Ga0207646_109369802 117
180 3300025922 Ga0207646_11135780 Ga0207646_111357802 117
181 3300025923 Ga0207681_11035530 Ga0207681_110355301 117
182 3300025925 Ga0207650_10716117 Ga0207650_107161172 117
183 3300025925 Ga0207650_11561516 Ga0207650_115615161 117
184 3300025926 Ga0207659_11009922 Ga0207659_110099221 117
185 3300025927 Ga0207687_10829680 Ga0207687_108296802 117
186 3300025931 Ga0207644_10417617 Ga0207644_104176172 117
187 3300025933 Ga0207706_10869477 Ga0207706_108694771 117
188 3300025933 Ga0207706_11577868 Ga0207706_115778681 117
189 3300025935 Ga0207709_10297515 Ga0207709_102975152 117
190 3300025935 Ga0207709_10335955 Ga0207709_103359551 117
191 3300025935 Ga0207709_10404820 Ga0207709_104048202 117
192 3300025935 Ga0207709_10574380 Ga0207709_105743802 117
193 3300025935 Ga0207709_10868051 Ga0207709_108680511 117
194 3300025936 Ga0207670_10314777 Ga0207670_103147772 117
195 3300025936 Ga0207670_11201994 Ga0207670_112019941 117
196 3300025961 Ga0207712_10046046 Ga0207712_100460462 117
197 3300025961 Ga0207712_10116811 Ga0207712_101168112 117
198 3300025961 Ga0207712_10164799 Ga0207712_101647992 117
199 3300025961 Ga0207712_10241304 Ga0207712_102413042 117
200 3300026023 Ga0207677_11635171 Ga0207677_116351711 117
201 3300026035 Ga0207703_10611534 Ga0207703_106115342 117
202 3300026035 Ga0207703_10631555 Ga0207703_106315552 117
203 3300026067 Ga0207678_10391151 Ga0207678_103911512 117
204 3300026075 Ga0207708_10395611 Ga0207708_103956112 117
205 3300026089 Ga0207648_10203523 Ga0207648_102035233 117
206 3300026095 Ga0207676_10073976 Ga0207676_100739762 117
207 3300026095 Ga0207676_10519589 Ga0207676_105195891 117
208 3300026116 Ga0207674_10114036 Ga0207674_101140363 117
209 3300026116 Ga0207674_10894201 Ga0207674_108942012 117
210 3300026116 Ga0207674_10894420 Ga0207674_108944201 117
211 3300026118 Ga0207675_100109822 Ga0207675_1001098222 117
212 3300026118 Ga0207675_100145490 Ga0207675_1001454902 117
213 3300026118 Ga0207675_101248314 Ga0207675_1012483141 117
214 3300027395 Ga0209996_1078402 Ga0209996_10784021 117
215 3300027695 Ga0209966_1050196 Ga0209966_10501962 117
216 3300028380 Ga0268265_10264811 Ga0268265_102648112 117
217 3300028380 Ga0268265_10331662 Ga0268265_103316623 117
218 3300028380 Ga0268265_10465086 Ga0268265_104650862 117
219 3300028380 Ga0268265_11352384 Ga0268265_113523842 117
220 3300028381 Ga0268264_10595989 Ga0268264_105959892 117
221 3300028381 Ga0268264_10673570 Ga0268264_106735701 117
222 3300028381 Ga0268264_12593115 Ga0268264_125931152 117
223 3300028558 Ga0265326_10123707 Ga0265326_101237071 117
224 3300028573 Ga0265334_10013913 Ga0265334_100139132 117
225 3300028653 Ga0265323_10023161 Ga0265323_100231611 117
226 3300028654 Ga0265322_10011617 Ga0265322_100116173 117
227 3300028800 Ga0265338_10010498 Ga0265338_100104982 117
228 3300030522 Ga0307512_10455618 Ga0307512_104556181 117
229 3300031240 Ga0265320_10065045 Ga0265320_100650452 117
230 3300031247 Ga0265340_10010681 Ga0265340_100106812 117
231 3300031250 Ga0265331_10272000 Ga0265331_102720001 117
232 3300031251 Ga0265327_10011415 Ga0265327_100114155 117
233 3300031548 Ga0307408_100530173 Ga0307408_1005301732 117
234 3300031595 Ga0265313_10324426 Ga0265313_103244261 117
235 3300031665 Ga0316575_10055393 Ga0316575_100553932 117
236 3300031727 Ga0316576_10036124 Ga0316576_100361242 117
237 3300031728 Ga0316578_10271463 Ga0316578_102714632 117
238 3300031731 Ga0307405_10228858 Ga0307405_102288582 117
239 3300031733 Ga0316577_10011981 Ga0316577_100119812 117
240 3300031733 Ga0316577_10528778 Ga0316577_105287781 117
241 3300031733 Ga0316577_10670604 Ga0316577_106706041 117
242 3300031901 Ga0307406_10652309 Ga0307406_106523092 117
243 3300031903 Ga0307407_10030880 Ga0307407_100308803 117
244 3300031911 Ga0307412_10038527 Ga0307412_100385272 117
245 3300031995 Ga0307409_101908957 Ga0307409_1019089571 117
246 3300032002 Ga0307416_100062838 Ga0307416_1000628383 117
247 3300032005 Ga0307411_10121529 Ga0307411_101215292 117
248 3300032126 Ga0307415_100153692 Ga0307415_1001536922 117
249 3300033524 Ga0316592_1055716 Ga0316592_10557162 117
250 3300035090 Ga0373949_0140318 Ga0373949_0140318_133_489 117
251 3300035112 Ga0373932_0124121 Ga0373932_0124121_11_364 117
252 3300035114 Ga0373939_0154126 Ga0373939_0154126_297_653 117
253 3300035241 Ga0373961_0151388 Ga0373961_0151388_238_591 117
254 3300035398 Ga0316574_0717927 Ga0316574_0717927_104_460 117
255 3300035724 Ga0373933_0494702 Ga0373933_0494702_386_745 117
256 3300036647 Ga0316582_0604292 Ga0316582_0604292_64_423 117
257 3300036647 Ga0316582_0857696 Ga0316582_0857696_68_424 117
258 3300036712 Ga0316584_0346241 Ga0316584_0346241_426_785 117
259 3300037853 Ga0436364_0980478 Ga0436364_0980478_92_448 117
260 3300041451 Ga0451791_0447273 Ga0451791_0447273_100_453 117
261 3300041512 Ga0451853_2903633 Ga0451853_2903633_428_781 117
262 3300042156 Ga0439446_0356481 Ga0439446_0356481_19_372 117
263 3300042876 Ga0451577_0003127 Ga0451577_0003127_4599_4952 117
264 3300042876 Ga0451577_0010692 Ga0451577_0010692_6365_6721 117
265 3300042876 Ga0451577_0024147 Ga0451577_0024147_218_574 117
266 3300042876 Ga0451577_0131466 Ga0451577_0131466_1626_1979 117
267 3300042876 Ga0451577_0151934 Ga0451577_0151934_1368_1721 117
268 3300042876 Ga0451577_0174877 Ga0451577_0174877_887_1240 117
269 3300042876 Ga0451577_0191912 Ga0451577_0191912_222_575 117
270 3300042876 Ga0451577_0299149 Ga0451577_0299149_385_738 117
271 3300042876 Ga0451577_0323875 Ga0451577_0323875_544_900 117
272 3300042876 Ga0451577_0961829 Ga0451577_0961829_294_650 117
273 3300042876 Ga0451577_1144456 Ga0451577_1144456_309_662 117
274 3300044673 Ga0453683_0002264 Ga0453683_0002264_5581_5934 117
275 3300044673 Ga0453683_0008026 Ga0453683_0008026_1089_1445 117
276 3300044673 Ga0453683_0069525 Ga0453683_0069525_575_928 117
277 3300044673 Ga0453683_0265684 Ga0453683_0265684_382_735 117
278 3300044673 Ga0453683_0328126 Ga0453683_0328126_69_422 117
279 3300044673 Ga0453683_0333202 Ga0453683_0333202_610_963 117
280 3300044673 Ga0453683_1049115 Ga0453683_1049115_149_508 117
281 3300044712 Ga0453684_0000007 Ga0453684_0000007_921993_922349 117
282 3300044712 Ga0453684_0000044 Ga0453684_0000044_12191_12544 117
283 3300044712 Ga0453684_0000047 Ga0453684_0000047_207844_208206 117
284 3300044712 Ga0453684_0000458 Ga0453684_0000458_155383_155739 117
285 3300044712 Ga0453684_0005135 Ga0453684_0005135_6800_7153 117
286 3300044712 Ga0453684_0006285 Ga0453684_0006285_164_517 117
287 3300044712 Ga0453684_0006496 Ga0453684_0006496_946_1302 117
288 3300044712 Ga0453684_0009709 Ga0453684_0009709_3568_3921 117
289 3300044712 Ga0453684_0009852 Ga0453684_0009852_10088_10441 117
290 3300044712 Ga0453684_0015867 Ga0453684_0015867_75_431 117
291 3300044712 Ga0453684_0018370 Ga0453684_0018370_103_459 117
292 3300044712 Ga0453684_0022347 Ga0453684_0022347_1850_2203 117
293 3300044712 Ga0453684_0028663 Ga0453684_0028663_7176_7529 117
294 3300044712 Ga0453684_0039678 Ga0453684_0039678_294_647 117
295 3300044712 Ga0453684_0041567 Ga0453684_0041567_2342_2695 117
296 3300044712 Ga0453684_0045678 Ga0453684_0045678_170_523 117
297 3300044712 Ga0453684_0100666 Ga0453684_0100666_2345_2698 117
298 3300044712 Ga0453684_0100881 Ga0453684_0100881_2588_2944 117
299 3300044712 Ga0453684_0112267 Ga0453684_0112267_1406_1765 117
300 3300044712 Ga0453684_0117222 Ga0453684_0117222_1099_1455 117
301 3300044712 Ga0453684_0188196 Ga0453684_0188196_1218_1574 117
302 3300044712 Ga0453684_0194746 Ga0453684_0194746_1170_1523 117
303 3300044712 Ga0453684_0239814 Ga0453684_0239814_326_709 117
304 3300044712 Ga0453684_0244769 Ga0453684_0244769_1607_1960 117
305 3300044712 Ga0453684_0260611 Ga0453684_0260611_1112_1465 117
306 3300044712 Ga0453684_0268816 Ga0453684_0268816_61_414 117
307 3300044712 Ga0453684_0308681 Ga0453684_0308681_1072_1425 117
308 3300044712 Ga0453684_0347642 Ga0453684_0347642_511_867 117
309 3300044712 Ga0453684_0446397 Ga0453684_0446397_916_1275 117
310 3300044712 Ga0453684_0487320 Ga0453684_0487320_652_1005 117
311 3300044712 Ga0453684_0488337 Ga0453684_0488337_44_397 117
312 3300044712 Ga0453684_0524584 Ga0453684_0524584_337_693 117
313 3300044712 Ga0453684_0536211 Ga0453684_0536211_384_755 117
314 3300044712 Ga0453684_0555051 Ga0453684_0555051_608_964 117
315 3300044712 Ga0453684_0584719 Ga0453684_0584719_34_390 117
316 3300044712 Ga0453684_0645396 Ga0453684_0645396_224_577 117
317 3300044712 Ga0453684_0799502 Ga0453684_0799502_226_579 117
318 3300044712 Ga0453684_1237063 Ga0453684_1237063_379_735 117
319 3300044712 Ga0453684_1319267 Ga0453684_1319267_83_436 117
320 3300044712 Ga0453684_1438353 Ga0453684_1438353_90_446 117
321 3300044712 Ga0453684_1741182 Ga0453684_1741182_81_488 117
322 3300044712 Ga0453684_1955652 Ga0453684_1955652_148_504 117
323 3300044712 Ga0453684_2056572 Ga0453684_2056572_131_484 117
324 3300044712 Ga0453684_2397964 Ga0453684_2397964_160_513 117
325 3300045051 Ga0451576_0000009 Ga0451576_0000009_580781_581137 117
326 3300045051 Ga0451576_0019360 Ga0451576_0019360_3496_3852 117
327 3300045051 Ga0451576_0026063 Ga0451576_0026063_5243_5596 117
328 3300045051 Ga0451576_0032891 Ga0451576_0032891_5044_5397 117
329 3300045051 Ga0451576_0208907 Ga0451576_0208907_1110_1463 117
330 3300045051 Ga0451576_0228086 Ga0451576_0228086_520_873 117
331 3300045051 Ga0451576_0476842 Ga0451576_0476842_172_525 117
332 3300045051 Ga0451576_0546798 Ga0451576_0546798_757_1110 117
333 3300045051 Ga0451576_2265092 Ga0451576_2265092_95_448 117
334 3300047472 Ga0495686_0457598 Ga0495686_0457598_28_384 117
335 3300048909 Ga0496106_0955554 Ga0496106_0955554_20_373 117
336 3300048911 Ga0496108_0000219 Ga0496108_0000219_29904_30260 117
337 3300049128 Ga0501308_084698 Ga0501308_084698_61_417 117
338 3300049521 Ga0501298_080578 Ga0501298_080578_212_565 117
339 3300049522 Ga0501299_019981 Ga0501299_019981_46_399 117
340 3300049571 Ga0501034_0013458 Ga0501034_0013458_4082_4465 117
341 3300049572 Ga0501036_1369818 Ga0501036_1369818_42_422 117
342 3300049577 Ga0501041_0169736 Ga0501041_0169736_940_1293 117
343 3300049577 Ga0501041_0890615 Ga0501041_0890615_19_372 117
344 3300049578 Ga0501042_0550204 Ga0501042_0550204_378_731 117
345 3300049587 Ga0501071_0628137 Ga0501071_0628137_414_767 117
346 3300049588 Ga0501072_0272608 Ga0501072_0272608_233_586 117
347 3300049589 Ga0501073_0018075 Ga0501073_0018075_3207_3563 117
348 3300049589 Ga0501073_0048492 Ga0501073_0048492_1754_2110 117
349 3300049589 Ga0501073_0119071 Ga0501073_0119071_228_584 117
350 3300049589 Ga0501073_0886556 Ga0501073_0886556_115_471 117
351 3300049591 Ga0501075_0079705 Ga0501075_0079705_1125_1478 117
352 3300049591 Ga0501075_0660007 Ga0501075_0660007_30_383 117
353 3300049592 Ga0501076_0059655 Ga0501076_0059655_1378_1731 117
354 3300049592 Ga0501076_0452707 Ga0501076_0452707_386_742 117
355 3300049649 Ga0501198_044515 Ga0501198_044515_200_553 117
356 3300049675 Ga0501243_069114 Ga0501243_069114_107_463 117
357 3300049686 Ga0501257_006691 Ga0501257_006691_908_1264 117
358 3300049686 Ga0501257_026154 Ga0501257_026154_578_934 117
359 3300049741 Ga0501079_0013494 Ga0501079_0013494_534_887 117
360 3300049741 Ga0501079_1383732 Ga0501079_1383732_91_447 117
361 3300049742 Ga0501080_0301872 Ga0501080_0301872_613_966 117
362 3300049742 Ga0501080_1719297 Ga0501080_1719297_147_500 117
363 3300049743 Ga0501081_0155476 Ga0501081_0155476_1041_1394 117
364 3300049824 Ga0501045_1288398 Ga0501045_1288398_18_371 117
365 3300050492 nmdc:mga0yw44_941434_c1 nmdc:mga0yw44_941434_c1_132_488 117
366 3300050507 nmdc:mga05p37_1692219_c1 nmdc:mga05p37_1692219_c1_20_376 117
367 3300050507 nmdc:mga05p37_241286_c1 nmdc:mga05p37_241286_c1_1676_2029 117
368 3300050507 nmdc:mga05p37_269626_c1 nmdc:mga05p37_269626_c1_1367_1720 117
369 3300050507 nmdc:mga05p37_32947_c1 nmdc:mga05p37_32947_c1_3068_3490 117
370 3300050507 nmdc:mga05p37_64238_c1 nmdc:mga05p37_64238_c1_1509_1862 117
371 3300050507 nmdc:mga05p37_674384_c1 nmdc:mga05p37_674384_c1_257_613 117
372 3300050507 nmdc:mga05p37_681489_c1 nmdc:mga05p37_681489_c1_523_879 117
373 3300050507 nmdc:mga05p37_885911_c1 nmdc:mga05p37_885911_c1_304_723 117
374 3300050507 nmdc:mga05p37_97715_c1 nmdc:mga05p37_97715_c1_883_1236 117
375 3300050508 nmdc:mga09592_123236_c1 nmdc:mga09592_123236_c1_103_456 117
376 3300050508 nmdc:mga09592_369994_c1 nmdc:mga09592_369994_c1_676_1029 117
377 3300050508 nmdc:mga09592_42154_c1 nmdc:mga09592_42154_c1_2469_2822 117
378 3300050508 nmdc:mga09592_73693_c1 nmdc:mga09592_73693_c1_516_869 117
379 3300050508 nmdc:mga09592_913005_c1 nmdc:mga09592_913005_c1_360_713 117
380 3300050509 nmdc:mga0qj67_211707_c1 nmdc:mga0qj67_211707_c1_1010_1363 117
381 3300050509 nmdc:mga0qj67_491097_c1 nmdc:mga0qj67_491097_c1_243_596 117
382 3300050510 nmdc:mga06r32_1024369_c1 nmdc:mga06r32_1024369_c1_212_565 117
383 3300050510 nmdc:mga06r32_165144_c1 nmdc:mga06r32_165144_c1_1586_1939 117
384 3300050510 nmdc:mga06r32_634736_c1 nmdc:mga06r32_634736_c1_354_707 117
385 3300050510 nmdc:mga06r32_763123_c1 nmdc:mga06r32_763123_c1_209_562 117
386 3300050512 nmdc:mga0n895_804698_c1 nmdc:mga0n895_804698_c1_266_619 117
387 3300050512 nmdc:mga0n895_816986_c1 nmdc:mga0n895_816986_c1_103_456 117
388 3300050512 nmdc:mga0n895_915270_c1 nmdc:mga0n895_915270_c1_147_503 117
389 3300050515 nmdc:mga0a205_1362931_c1 nmdc:mga0a205_1362931_c1_100_465 117
390 3300050515 nmdc:mga0a205_1458632_c1 nmdc:mga0a205_1458632_c1_110_463 117
391 3300050515 nmdc:mga0a205_1563_c2 nmdc:mga0a205_1563_c2_6799_7155 117
392 3300050515 nmdc:mga0a205_21296_c2 nmdc:mga0a205_21296_c2_2756_3178 117
393 3300050515 nmdc:mga0a205_300224_c1 nmdc:mga0a205_300224_c1_819_1172 117
394 3300054114 Ga0501084_0004268 Ga0501084_0004268_8596_8952 117
395 3300054114 Ga0501084_0136465 Ga0501084_0136465_1535_1888 117
396 3300054114 Ga0501084_1450399 Ga0501084_1450399_98_451 117
397 3300060353 Ga0501082_0986076 Ga0501082_0986076_185_538 117
398 3300060353 Ga0501082_1037125 Ga0501082_1037125_317_670 117
399 3300061734 Ga0530510_0009728 Ga0530510_0009728_13_366 117
400 3300061734 Ga0530510_0124277 Ga0530510_0124277_490_843 117

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00507

Oxidored_q4

NADH-ubiquinone/plastoquinone oxidoreductase, chain 3

45

143

0.98

Feature Viewer

pLDDT pTM Quality
72.69 0.37 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map