F434551

General Info

Members Datasets Scaffolds Average Seq Length
400 199 400 238

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100833776|Ga0075431_1008337761
Length 259
Sequence VYLLPLGVPVLPPASSYWRASREPRHSLLFALPLLLFYEVLAFALSGTELGQVRNGADVLLKSVFVALGGRYGVTAFSVVLLGVGTWLILRDRRIHGEIRPRIFPGMFFESVVYALLLGGVTSALTSLLLNGRLALVAQSGAVQGMESFALPTQLMISLGAGIYEELVFRVILVSGLAALARGLFKWRPLPAGVFAALAGALIFSMFHYVGAYGDVLTLGSFTFRAIAGVLFSGLYLLRGFGVAAWTHALYDVFLSVAR

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
142 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
151 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
152 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
153 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
154 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
155 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
156 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
157 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
179 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
180 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
181 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
182 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
183 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
184 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
185 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
188 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
199 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.5
Rhizosphere 91.25
Stem 0
Stem Tuber 0
Unclassified 0.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10001697 3300003322 Bacteria 5587
2 Ga0070690_100013587 3300005330 Unclassified 4816
3 Ga0068869_100109526 3300005334 Unclassified 2099
4 Ga0070666_10152863 3300005335 Unclassified 1610
5 Ga0070680_100317619 3300005336 Bacteria 1322
6 Ga0070689_100331042 3300005340 Unclassified 1274
7 Ga0070691_10008630 3300005341 Unclassified 4665
8 Ga0070687_100144693 3300005343 Unclassified 1388
9 Ga0070661_100140751 3300005344 Unclassified 1818
10 Ga0070668_100108216 3300005347 Bacteria 2210
11 Ga0070669_100092896 3300005353 Bacteria 2265
12 Ga0070674_100000166 3300005356 Bacteria 30558
13 Ga0070674_100263569 3300005356 Bacteria 1359
14 Ga0070673_100029823 3300005364 Bacteria 4073
15 Ga0070659_100012845 3300005366 Bacteria 6221
16 Ga0070667_100083098 3300005367 Bacteria 2743
17 Ga0070703_10021713 3300005406 Bacteria 1879
18 Ga0070714_100237307 3300005435 Bacteria 1682
19 Ga0070713_100430113 3300005436 Bacteria 1237
20 Ga0070710_10155869 3300005437 Unclassified 1412
21 Ga0070701_10056802 3300005438 Bacteria 2049
22 Ga0070711_100000067 3300005439 Bacteria 59923
23 Ga0070711_100013297 3300005439 Bacteria 5166
24 Ga0070705_100001623 3300005440 Bacteria 11764
25 Ga0070705_100008021 3300005440 Bacteria 5221
26 Ga0070705_100019333 3300005440 Bacteria 3584
27 Ga0070705_100043979 3300005440 Bacteria 2563
28 Ga0070705_100125345 3300005440 Unclassified 1666
29 Ga0070705_100324465 3300005440 Unclassified 1113
30 Ga0070694_100002340 3300005444 Bacteria 11199
31 Ga0070694_100015699 3300005444 Bacteria 4761
32 Ga0070694_100081644 3300005444 Bacteria 2249
33 Ga0070708_100008970 3300005445 Bacteria 8057
34 Ga0070708_100137843 3300005445 Bacteria 2261
35 Ga0070663_100207042 3300005455 Bacteria 1534
36 Ga0070678_100002390 3300005456 Bacteria 10269
37 Ga0070662_100000235 3300005457 Bacteria 32681
38 Ga0070662_100213742 3300005457 Unclassified 1536
39 Ga0070681_10221831 3300005458 Bacteria 1805
40 Ga0068867_100000212 3300005459 Bacteria 38648
41 Ga0068867_100137057 3300005459 Bacteria 1909
42 Ga0070706_100019275 3300005467 Bacteria 6292
43 Ga0070706_100080026 3300005467 Bacteria 3025
44 Ga0070706_100435151 3300005467 Bacteria 1221
45 Ga0070707_100000266 3300005468 Bacteria 51948
46 Ga0070707_100118288 3300005468 Bacteria 2572
47 Ga0070707_100137828 3300005468 Bacteria 2374
48 Ga0070707_100166666 3300005468 Unclassified 2147
49 Ga0070707_100527151 3300005468 Unclassified 1143
50 Ga0070707_100571758 3300005468 Unclassified 1092
51 Ga0070698_100001502 3300005471 Bacteria 25919
52 Ga0070698_100003190 3300005471 Bacteria 18084
53 Ga0070698_100037510 3300005471 Unclassified 4996
54 Ga0070698_100257120 3300005471 Bacteria 1679
55 Ga0070698_100269777 3300005471 Bacteria 1633
56 Ga0070698_100401659 3300005471 Bacteria 1304
57 Ga0070699_100001124 3300005518 Bacteria 24927
58 Ga0070699_100006746 3300005518 Bacteria 9982
59 Ga0070699_100012129 3300005518 Bacteria 7439
60 Ga0070699_100042548 3300005518 Bacteria 3931
61 Ga0070699_100044788 3300005518 Bacteria 3830
62 Ga0070699_100139600 3300005518 Unclassified 2139
63 Ga0070699_100238512 3300005518 Bacteria 1622
64 Ga0070699_100490820 3300005518 Bacteria 1115
65 Ga0070699_100565209 3300005518 Bacteria 1036
66 Ga0070679_100106636 3300005530 Bacteria 2788
67 Ga0070679_100590413 3300005530 Unclassified 1054
68 Ga0070684_100546236 3300005535 Bacteria 1075
69 Ga0070697_100189858 3300005536 Bacteria 1743
70 Ga0070697_100234616 3300005536 Bacteria 1565
71 Ga0070697_100271378 3300005536 Bacteria 1454
72 Ga0068853_100237087 3300005539 Bacteria 1671
73 Ga0070672_100100751 3300005543 Bacteria 2343
74 Ga0070672_100136246 3300005543 Unclassified 2022
75 Ga0070695_100000600 3300005545 Bacteria 19071
76 Ga0070695_100016898 3300005545 Bacteria 4422
77 Ga0070695_100076211 3300005545 Bacteria 2208
78 Ga0070696_100022168 3300005546 Unclassified 4314
79 Ga0070696_100031165 3300005546 Bacteria 3653
80 Ga0070696_100110454 3300005546 Bacteria 1979
81 Ga0070704_100000053 3300005549 Bacteria 37727
82 Ga0070704_100015264 3300005549 Bacteria 4821
83 Ga0070704_100016916 3300005549 Bacteria 4624
84 Ga0070704_100046251 3300005549 Bacteria 3033
85 Ga0070704_100049040 3300005549 Bacteria 2959
86 Ga0070704_100134036 3300005549 Bacteria 1924
87 Ga0070704_100684522 3300005549 Bacteria 908
88 Ga0068855_100069522 3300005563 Unclassified 4098
89 Ga0070664_100027081 3300005564 Unclassified 4763
90 Ga0070664_100217058 3300005564 Bacteria 1710
91 Ga0068857_100015465 3300005577 Bacteria 6666
92 Ga0068854_100000686 3300005578 Bacteria 20183
93 Ga0068859_100027308 3300005617 Bacteria 5725
94 Ga0068859_100290283 3300005617 Bacteria 1729
95 Ga0068864_100002767 3300005618 Bacteria 14475
96 Ga0068864_100272159 3300005618 Bacteria 1578
97 Ga0068866_10000544 3300005718 Bacteria 17230
98 Ga0068861_100165056 3300005719 Bacteria 1830
99 Ga0068870_10071531 3300005840 Unclassified 1893
100 Ga0068863_100056129 3300005841 Unclassified 3729
101 Ga0068863_100715804 3300005841 Bacteria 995
102 Ga0068863_100823114 3300005841 Bacteria 926
103 Ga0068858_100045153 3300005842 Unclassified 4083
104 Ga0068858_100093703 3300005842 Bacteria 2796
105 Ga0068860_100018596 3300005843 Bacteria 6758
106 Ga0068862_100621296 3300005844 Bacteria 1039
107 Ga0068862_100711681 3300005844 Unclassified 974
108 Ga0068862_100903396 3300005844 Unclassified 868
109 Ga0081455_10062952 3300005937 Bacteria 3115
110 Ga0081538_10002415 3300005981 Bacteria 18322
111 Ga0081538_10008285 3300005981 Bacteria 8855
112 Ga0081538_10010487 3300005981 Bacteria 7598
113 Ga0070712_100348907 3300006175 Bacteria 1211
114 Ga0097621_100023627 3300006237 Bacteria 4788
115 Ga0068871_100107725 3300006358 Bacteria 2341
116 Ga0068871_100299534 3300006358 Unclassified 1411
117 Ga0075428_100021272 3300006844 Bacteria 7184
118 Ga0075428_100046550 3300006844 Bacteria 4764
119 Ga0075428_100136982 3300006844 Unclassified 2662
120 Ga0075430_100040709 3300006846 Unclassified 3933
121 Ga0075430_100077251 3300006846 Bacteria 2791
122 Ga0075430_100202824 3300006846 Unclassified 1646
123 Ga0075431_100043182 3300006847 Bacteria 4652
124 Ga0075431_100130540 3300006847 Bacteria 2592
125 Ga0075431_100267072 3300006847 Bacteria 1735
126 Ga0075431_100833776 3300006847 Bacteria 894
127 Ga0075433_10010644 3300006852 Bacteria 7396
128 Ga0075433_10038696 3300006852 Bacteria 4121
129 Ga0075433_10096690 3300006852 Bacteria 2613
130 Ga0075433_10388425 3300006852 Bacteria 1232
131 Ga0075434_100017368 3300006871 Bacteria 6930
132 Ga0075434_100071116 3300006871 Bacteria 3470
133 Ga0075434_100078049 3300006871 Bacteria 3307
134 Ga0075434_100082491 3300006871 Bacteria 3212
135 Ga0075434_100088082 3300006871 Bacteria 3105
136 Ga0075434_100167674 3300006871 Bacteria 2216
137 Ga0075429_100000196 3300006880 Bacteria 40118
138 Ga0075429_100074888 3300006880 Bacteria 2949
139 Ga0075429_100118677 3300006880 Bacteria 2312
140 Ga0075429_100344477 3300006880 Bacteria 1305
141 Ga0075436_100008026 3300006914 Bacteria 7227
142 Ga0075436_100029809 3300006914 Unclassified 3752
143 Ga0075436_100040378 3300006914 Bacteria 3220
144 Ga0075436_100068752 3300006914 Unclassified 2447
145 Ga0075436_100150019 3300006914 Bacteria 1640
146 Ga0075436_100290237 3300006914 Unclassified 1171
147 Ga0075436_100421455 3300006914 Bacteria 969
148 Ga0097620_100027306 3300006931 Bacteria 5725
149 Ga0097620_100290301 3300006931 Bacteria 1729
150 Ga0075435_100568036 3300007076 Unclassified 983
151 Ga0099794_10098009 3300007265 Bacteria 1461
152 Ga0105240_10042685 3300009093 Bacteria 5777
153 Ga0111539_10014271 3300009094 Bacteria 9924
154 Ga0111539_10524773 3300009094 Bacteria 1380
155 Ga0111539_10806472 3300009094 Bacteria 1092
156 Ga0105245_10162446 3300009098 Unclassified 2121
157 Ga0114129_10000967 3300009147 Bacteria 37553
158 Ga0114129_10163155 3300009147 Bacteria 3042
159 Ga0114129_10163452 3300009147 Bacteria 3040
160 Ga0114129_10225624 3300009147 Unclassified 2525
161 Ga0114129_10435051 3300009147 Unclassified 1723
162 Ga0114129_11176204 3300009147 Unclassified 956
163 Ga0105243_10001173 3300009148 Bacteria 23730
164 Ga0105243_10373960 3300009148 Unclassified 1316
165 Ga0105241_10043516 3300009174 Bacteria 3401
166 Ga0105242_10016474 3300009176 Bacteria 5746
167 Ga0105248_10013713 3300009177 Bacteria 8923
168 Ga0105248_10016304 3300009177 Bacteria 8178
169 Ga0105248_10449407 3300009177 Bacteria 1452
170 Ga0105248_10472847 3300009177 Unclassified 1413
171 Ga0105237_11252167 3300009545 Bacteria 748
172 Ga0105249_10359355 3300009553 Unclassified 1477
173 Ga0105239_10009754 3300010375 Bacteria 10796
174 Ga0105239_10031070 3300010375 Bacteria 5875
175 Ga0105239_10743851 3300010375 Bacteria 1122
176 Ga0105246_10005394 3300011119 Bacteria 7786
177 Ga0105246_10894709 3300011119 Bacteria 796
178 Ga0157371_10113805 3300013102 Bacteria 1921
179 Ga0157378_10005668 3300013297 Bacteria 10926
180 Ga0163162_10463639 3300013306 Unclassified 1398
181 Ga0163162_10817585 3300013306 Bacteria 1048
182 Ga0157375_10399557 3300013308 Bacteria 1541
183 Ga0157375_10491992 3300013308 Bacteria 1391
184 Ga0157375_10819839 3300013308 Bacteria 1078
185 Ga0163163_10132769 3300014325 Bacteria 2530
186 Ga0163163_11068681 3300014325 Unclassified 870
187 Ga0157380_10058259 3300014326 Bacteria 3079
188 Ga0157379_10028628 3300014968 Bacteria 4955
189 Ga0157379_10118108 3300014968 Bacteria 2385
190 Ga0157376_10010839 3300014969 Bacteria 6692
191 Ga0157376_10461816 3300014969 Unclassified 1241
192 Ga0163161_10021597 3300017792 Bacteria 4523
193 Ga0207653_10004553 3300025885 Bacteria 4348
194 Ga0207642_10000329 3300025899 Bacteria 14301
195 Ga0207680_10135766 3300025903 Bacteria 1626
196 Ga0207645_10001622 3300025907 Bacteria 18353
197 Ga0207643_10013182 3300025908 Unclassified 4473
198 Ga0207684_10004607 3300025910 Bacteria 12951
199 Ga0207684_10053991 3300025910 Bacteria 3409
200 Ga0207684_10575702 3300025910 Bacteria 963
201 Ga0207654_10011913 3300025911 Bacteria 4446
202 Ga0207695_10304571 3300025913 Unclassified 1484
203 Ga0207693_10188232 3300025915 Bacteria 1625
204 Ga0207663_10000171 3300025916 Bacteria 29130
205 Ga0207663_10105755 3300025916 Bacteria 1900
206 Ga0207660_10399048 3300025917 Bacteria 1107
207 Ga0207662_10289663 3300025918 Unclassified 1086
208 Ga0207652_10075271 3300025921 Bacteria 2942
209 Ga0207652_10603717 3300025921 Unclassified 984
210 Ga0207646_10005263 3300025922 Bacteria 13644
211 Ga0207646_10008221 3300025922 Bacteria 10486
212 Ga0207646_10015709 3300025922 Bacteria 7135
213 Ga0207646_10121901 3300025922 Bacteria 2342
214 Ga0207646_10125493 3300025922 Bacteria 2308
215 Ga0207646_10181816 3300025922 Unclassified 1899
216 Ga0207646_10197206 3300025922 Bacteria 1818
217 Ga0207646_10268906 3300025922 Unclassified 1541
218 Ga0207646_10296139 3300025922 Bacteria 1462
219 Ga0207646_10356167 3300025922 Bacteria 1322
220 Ga0207646_10470547 3300025922 Unclassified 1133
221 Ga0207681_10304833 3300025923 Unclassified 1261
222 Ga0207687_10327999 3300025927 Unclassified 1241
223 Ga0207706_10000005 3300025933 Bacteria 224460
224 Ga0207706_10429858 3300025933 Unclassified 1144
225 Ga0207686_10000296 3300025934 Bacteria 36674
226 Ga0207709_10007525 3300025935 Bacteria 6053
227 Ga0207669_10002752 3300025937 Bacteria 7540
228 Ga0207665_10013137 3300025939 Bacteria 5443
229 Ga0207665_10047733 3300025939 Bacteria 2872
230 Ga0207691_10045193 3300025940 Unclassified 4050
231 Ga0207691_10072116 3300025940 Bacteria 3115
232 Ga0207711_10003456 3300025941 Bacteria 13673
233 Ga0207711_10490929 3300025941 Unclassified 1144
234 Ga0207711_10638200 3300025941 Bacteria 993
235 Ga0207689_10004020 3300025942 Bacteria 13369
236 Ga0207679_10661851 3300025945 Unclassified 945
237 Ga0207668_10082403 3300025972 Bacteria 2337
238 Ga0207640_10001479 3300025981 Bacteria 12675
239 Ga0207658_10073447 3300025986 Bacteria 2596
240 Ga0207703_10009540 3300026035 Bacteria 7617
241 Ga0207708_10110088 3300026075 Bacteria 2137
242 Ga0207708_10119861 3300026075 Bacteria 2050
243 Ga0207641_10156975 3300026088 Bacteria 2065
244 Ga0207641_10222178 3300026088 Bacteria 1752
245 Ga0207648_10000008 3300026089 Bacteria 208822
246 Ga0207648_10058731 3300026089 Bacteria 3354
247 Ga0207676_10002075 3300026095 Bacteria 14548
248 Ga0207676_10148137 3300026095 Bacteria 2018
249 Ga0207676_10310805 3300026095 Bacteria 1443
250 Ga0207674_10022324 3300026116 Bacteria 6796
251 Ga0207675_100036084 3300026118 Bacteria 4611
252 Ga0207675_100920055 3300026118 Unclassified 891
253 Ga0207683_10024897 3300026121 Bacteria 5158
254 Ga0209588_1097409 3300027671 Bacteria 947
255 Ga0268265_10892209 3300028380 Unclassified 872
256 Ga0307408_100008565 3300031548 Bacteria 6756
257 Ga0307408_100028894 3300031548 Unclassified 3836
258 Ga0307405_10065308 3300031731 Unclassified 2316
259 Ga0307405_10080025 3300031731 Unclassified 2132
260 Ga0307405_10255504 3300031731 Bacteria 1306
261 Ga0307405_10256364 3300031731 Unclassified 1304
262 Ga0307413_10004704 3300031824 Bacteria 5988
263 Ga0307413_10015109 3300031824 Unclassified 3947
264 Ga0307413_10020705 3300031824 Unclassified 3505
265 Ga0307413_10031323 3300031824 Bacteria 3000
266 Ga0307413_10135456 3300031824 Bacteria 1693
267 Ga0307413_10162199 3300031824 Bacteria 1572
268 Ga0307410_10005211 3300031852 Bacteria 6849
269 Ga0307410_10080393 3300031852 Unclassified 2286
270 Ga0307410_10158369 3300031852 Unclassified 1694
271 Ga0307410_10579961 3300031852 Bacteria 933
272 Ga0307406_10031245 3300031901 Unclassified 3241
273 Ga0307406_10078662 3300031901 Bacteria 2185
274 Ga0307406_10193942 3300031901 Bacteria 1490
275 Ga0307406_10205184 3300031901 Bacteria 1454
276 Ga0307406_10226454 3300031901 Bacteria 1393
277 Ga0307407_10004470 3300031903 Bacteria 5942
278 Ga0307407_10012697 3300031903 Unclassified 4060
279 Ga0307407_10035779 3300031903 Bacteria 2731
280 Ga0307412_10044615 3300031911 Unclassified 2893
281 Ga0307412_10166708 3300031911 Unclassified 1643
282 Ga0307409_100059929 3300031995 Unclassified 2965
283 Ga0307409_100210503 3300031995 Unclassified 1747
284 Ga0307409_100263285 3300031995 Bacteria 1584
285 Ga0307416_100004930 3300032002 Bacteria 8128
286 Ga0307416_100022993 3300032002 Unclassified 4513
287 Ga0307416_100054452 3300032002 Bacteria 3216
288 Ga0307414_10093356 3300032004 Unclassified 2243
289 Ga0307414_10104535 3300032004 Bacteria 2139
290 Ga0307411_10004102 3300032005 Bacteria 6909
291 Ga0307415_100013078 3300032126 Unclassified 4829
292 Ga0307415_100021544 3300032126 Unclassified 3963
293 Ga0307415_100198914 3300032126 Bacteria 1588
294 Ga0307415_100437695 3300032126 Bacteria 1127
295 Ga0373930_0033959 3300034816 Bacteria 1061
296 Ga0373932_0071825 3300035112 Bacteria 1075
297 Ga0373937_0128683 3300036401 Unclassified 2364
298 Ga0242420_034548 3300038996 Unclassified 948
299 Ga0451577_0053015 3300042876 Bacteria 3622
300 Ga0451577_0053677 3300042876 Unclassified 3597
301 Ga0453684_0366562 3300044712 Bacteria 1621
302 Ga0451576_0053444 3300045051 Unclassified 4231
303 Ga0451576_0481430 3300045051 Unclassified 1304
304 Ga0495603_0036660 3300046455 Unclassified 2944
305 Ga0495580_0288297 3300046472 Bacteria 1119
306 Ga0495582_0010755 3300046473 Bacteria 5036
307 Ga0495664_0017174 3300046477 Bacteria 4134
308 Ga0495594_0081032 3300046499 Unclassified 1812
309 Ga0495618_0013488 3300046514 Bacteria 4971
310 Ga0495630_0013975 3300046517 Bacteria 5841
311 Ga0495666_0037752 3300046526 Bacteria 2349
312 Ga0495640_0109998 3300046533 Unclassified 1801
313 Ga0495586_0005940 3300046535 Bacteria 6534
314 Ga0495634_0017400 3300046642 Bacteria 5128
315 Ga0495613_0072238 3300046689 Bacteria 2515
316 Ga0495636_0040270 3300047318 Bacteria 1937
317 Ga0495674_0020120 3300047319 Bacteria 6184
318 Ga0495674_0141548 3300047319 Unclassified 2022
319 Ga0495684_0020091 3300047471 Bacteria 5145
320 Ga0496101_0282841 3300048904 Bacteria 1297
321 Ga0496102_0013492 3300048905 Bacteria 7078
322 Ga0496102_0087473 3300048905 Bacteria 2879
323 Ga0496102_0141537 3300048905 Bacteria 2256
324 Ga0496103_0006333 3300048906 Bacteria 7075
325 Ga0496104_0140580 3300048907 Bacteria 2319
326 Ga0496104_0146278 3300048907 Bacteria 2269
327 Ga0496104_0345265 3300048907 Bacteria 1401
328 Ga0496105_0227996 3300048908 Bacteria 1515
329 Ga0496106_0011448 3300048909 Bacteria 6562
330 Ga0496106_0012057 3300048909 Bacteria 6378
331 Ga0496107_0009544 3300048910 Bacteria 6731
332 Ga0496108_0001805 3300048911 Bacteria 17067
333 Ga0496108_0003715 3300048911 Bacteria 12238
334 Ga0496108_0064094 3300048911 Bacteria 3095
335 Ga0496108_0405219 3300048911 Bacteria 1191
336 Ga0496109_0010712 3300048912 Bacteria 7845
337 Ga0496109_0027330 3300048912 Bacteria 5093
338 Ga0496109_0034092 3300048912 Bacteria 4582
339 Ga0496109_0050782 3300048912 Bacteria 3776
340 Ga0496109_0072974 3300048912 Unclassified 3154
341 Ga0496110_0306148 3300048913 Bacteria 1447
342 Ga0496110_0319828 3300048913 Unclassified 1413
343 Ga0496111_0011554 3300048914 Bacteria 5954
344 Ga0496111_0170752 3300048914 Unclassified 1616
345 Ga0496111_0403113 3300048914 Unclassified 1010
346 Ga0496112_0075574 3300048915 Bacteria 3332
347 Ga0496112_0252867 3300048915 Bacteria 1713
348 Ga0496112_0432975 3300048915 Bacteria 1253
349 Ga0496113_0022604 3300048916 Bacteria 4451
350 Ga0496113_0105166 3300048916 Bacteria 2191
351 Ga0496113_0334062 3300048916 Bacteria 1215
352 Ga0496114_0048939 3300048917 Bacteria 3517
353 Ga0496115_0688384 3300048918 Bacteria 805
354 Ga0501290_022120 3300049513 Bacteria 876
355 Ga0501067_0029435 3300049583 Bacteria 3044
356 Ga0501067_0064811 3300049583 Bacteria 2022
357 Ga0501247_026073 3300049677 Unclassified 779
358 Ga0501249_031532 3300049679 Unclassified 1183
359 Ga0501249_033839 3300049679 Bacteria 1145
360 Ga0501257_080498 3300049686 Unclassified 839
361 Ga0501219_006979 3300049703 Unclassified 813
362 Ga0501225_0020028 3300049705 Bacteria 1850
363 Ga0501229_016821 3300049706 Bacteria 953
364 Ga0501080_0491903 3300049742 Bacteria 1097
365 Ga0501081_0622567 3300049743 Unclassified 808
366 Ga0501083_0223204 3300049744 Unclassified 1227
367 nmdc:mga05p37_190224_c1 3300050507 Bacteria 2492
368 nmdc:mga05p37_20705_c1 3300050507 Bacteria 7958
369 nmdc:mga05p37_26116_c1 3300050507 Bacteria 7102
370 nmdc:mga09592_114152_c1 3300050508 Unclassified 2318
371 nmdc:mga09592_328481_c1 3300050508 Bacteria 1324
372 nmdc:mga09592_51876_c1 3300050508 Unclassified 3461
373 nmdc:mga0qj67_292262_c1 3300050509 Bacteria 1320
374 nmdc:mga0qj67_34803_c1 3300050509 Unclassified 3936
375 nmdc:mga0qj67_937287_c1 3300050509 Bacteria 681
376 nmdc:mga06r32_169621_c1 3300050510 Unclassified 2166
377 nmdc:mga06r32_332458_c1 3300050510 Bacteria 1504
378 nmdc:mga06r32_891372_c1 3300050510 Bacteria 846
379 nmdc:mga08y16_359286_c1 3300050511 Bacteria 1495
380 nmdc:mga08y16_71994_c1 3300050511 Bacteria 3602
381 nmdc:mga0n895_23414_c1 3300050512 Bacteria 5805
382 nmdc:mga0n895_2889_c1 3300050512 Bacteria 13632
383 nmdc:mga0n895_3079_c1 3300050512 Bacteria 13270
384 nmdc:mga0n895_49496_c1 3300050512 Bacteria 4117
385 nmdc:mga0n895_61233_c1 3300050512 Bacteria 3715
386 nmdc:mga0n895_74450_c1 3300050512 Unclassified 3373
387 nmdc:mga0rr50_35854_c1 3300050513 Unclassified 3567
388 nmdc:mga08x19_12172_c1 3300050514 Bacteria 5178
389 nmdc:mga08x19_190825_c1 3300050514 Bacteria 1402
390 nmdc:mga08x19_279438_c1 3300050514 Unclassified 1157
391 nmdc:mga08x19_298627_c1 3300050514 Bacteria 1118
392 nmdc:mga08x19_864_c1 3300050514 Bacteria 19216
393 nmdc:mga0a205_1422_c1 3300050515 Bacteria 20347
394 nmdc:mga0a205_231420_c1 3300050515 Bacteria 1731
395 nmdc:mga0a205_254864_c1 3300050515 Unclassified 1634
396 nmdc:mga0a205_25890_c1 3300050515 Bacteria 5588
397 nmdc:mga0a205_51174_c1 3300050515 Bacteria 3987
398 Ga0590071_054229 3300059421 Unclassified 975
399 Ga0501082_0305403 3300060353 Bacteria 1386
400 Ga0501082_0768319 3300060353 Unclassified 843

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050509 nmdc:mga0qj67_937287_c1 nmdc:mga0qj67_937287_c1_19_639 186
2 3300009147 Ga0114129_10225624 Ga0114129_102256243 196
3 3300005536 Ga0070697_100234616 Ga0070697_1002346162 200
4 3300005546 Ga0070696_100110454 Ga0070696_1001104541 200
5 3300006852 Ga0075433_10038696 Ga0075433_100386962 200
6 3300006871 Ga0075434_100167674 Ga0075434_1001676742 200
7 3300050515 nmdc:mga0a205_231420_c1 nmdc:mga0a205_231420_c1_71_814 200
8 3300011119 Ga0105246_10894709 Ga0105246_108947091 201
9 3300032126 Ga0307415_100198914 Ga0307415_1001989141 203
10 3300006844 Ga0075428_100046550 Ga0075428_1000465505 204
11 3300006847 Ga0075431_100130540 Ga0075431_1001305403 204
12 3300006880 Ga0075429_100118677 Ga0075429_1001186773 204
13 3300006914 Ga0075436_100421455 Ga0075436_1004214551 204
14 3300007076 Ga0075435_100568036 Ga0075435_1005680361 204
15 3300050508 nmdc:mga09592_328481_c1 nmdc:mga09592_328481_c1_85_798 204
16 3300009147 Ga0114129_10000967 Ga0114129_100009677 205
17 3300050507 nmdc:mga05p37_20705_c1 nmdc:mga05p37_20705_c1_1648_2361 205
18 3300050512 nmdc:mga0n895_74450_c1 nmdc:mga0n895_74450_c1_2145_2858 205
19 3300050515 nmdc:mga0a205_25890_c1 nmdc:mga0a205_25890_c1_3619_4332 205
20 3300005439 Ga0070711_100000067 Ga0070711_10000006714 206
21 3300005440 Ga0070705_100019333 Ga0070705_1000193334 206
22 3300025916 Ga0207663_10000171 Ga0207663_1000017113 206
23 3300050510 nmdc:mga06r32_169621_c1 nmdc:mga06r32_169621_c1_220_900 206
24 3300006914 Ga0075436_100290237 Ga0075436_1002902371 208
25 3300005436 Ga0070713_100430113 Ga0070713_1004301132 210
26 3300005981 Ga0081538_10010487 Ga0081538_100104876 210
27 3300048907 Ga0496104_0345265 Ga0496104_0345265_230_970 210
28 3300048911 Ga0496108_0405219 Ga0496108_0405219_282_1022 210
29 3300048912 Ga0496109_0072974 Ga0496109_0072974_571_1311 210
30 3300005467 Ga0070706_100080026 Ga0070706_1000800263 211
31 3300005468 Ga0070707_100118288 Ga0070707_1001182882 211
32 3300005468 Ga0070707_100137828 Ga0070707_1001378282 211
33 3300005471 Ga0070698_100003190 Ga0070698_1000031905 211
34 3300005518 Ga0070699_100565209 Ga0070699_1005652091 211
35 3300006846 Ga0075430_100040709 Ga0075430_1000407094 211
36 3300009177 Ga0105248_10472847 Ga0105248_104728471 211
37 3300013308 Ga0157375_10819839 Ga0157375_108198391 211
38 3300025922 Ga0207646_10356167 Ga0207646_103561671 211
39 3300025941 Ga0207711_10638200 Ga0207711_106382001 211
40 3300050509 nmdc:mga0qj67_34803_c1 nmdc:mga0qj67_34803_c1_1342_2064 211
41 3300005435 Ga0070714_100237307 Ga0070714_1002373072 212
42 3300005437 Ga0070710_10155869 Ga0070710_101558692 212
43 3300005440 Ga0070705_100324465 Ga0070705_1003244651 212
44 3300005444 Ga0070694_100002340 Ga0070694_1000023407 212
45 3300005518 Ga0070699_100012129 Ga0070699_1000121295 212
46 3300005981 Ga0081538_10002415 Ga0081538_100024159 212
47 3300005330 Ga0070690_100013587 Ga0070690_1000135875 213
48 3300005334 Ga0068869_100109526 Ga0068869_1001095262 213
49 3300005335 Ga0070666_10152863 Ga0070666_101528632 213
50 3300005341 Ga0070691_10008630 Ga0070691_100086304 213
51 3300005343 Ga0070687_100144693 Ga0070687_1001446932 213
52 3300005353 Ga0070669_100092896 Ga0070669_1000928963 213
53 3300005356 Ga0070674_100000166 Ga0070674_1000001667 213
54 3300005364 Ga0070673_100029823 Ga0070673_1000298234 213
55 3300005367 Ga0070667_100083098 Ga0070667_1000830982 213
56 3300005440 Ga0070705_100001623 Ga0070705_10000162310 213
57 3300005456 Ga0070678_100002390 Ga0070678_1000023905 213
58 3300005457 Ga0070662_100000235 Ga0070662_10000023518 213
59 3300005459 Ga0068867_100000212 Ga0068867_10000021228 213
60 3300005530 Ga0070679_100590413 Ga0070679_1005904131 213
61 3300005539 Ga0068853_100237087 Ga0068853_1002370871 213
62 3300005543 Ga0070672_100136246 Ga0070672_1001362462 213
63 3300005545 Ga0070695_100000600 Ga0070695_1000006008 213
64 3300005546 Ga0070696_100022168 Ga0070696_1000221685 213
65 3300005549 Ga0070704_100016916 Ga0070704_1000169166 213
66 3300005563 Ga0068855_100069522 Ga0068855_1000695225 213
67 3300005578 Ga0068854_100000686 Ga0068854_1000006867 213
68 3300005718 Ga0068866_10000544 Ga0068866_100005447 213
69 3300005842 Ga0068858_100045153 Ga0068858_1000451535 213
70 3300005843 Ga0068860_100018596 Ga0068860_1000185961 213
71 3300005844 Ga0068862_100711681 Ga0068862_1007116811 213
72 3300006237 Ga0097621_100023627 Ga0097621_1000236273 213
73 3300006358 Ga0068871_100107725 Ga0068871_1001077252 213
74 3300006846 Ga0075430_100077251 Ga0075430_1000772512 213
75 3300006847 Ga0075431_100043182 Ga0075431_1000431824 213
76 3300009093 Ga0105240_10042685 Ga0105240_100426853 213
77 3300009098 Ga0105245_10162446 Ga0105245_101624462 213
78 3300009148 Ga0105243_10001173 Ga0105243_1000117314 213
79 3300009174 Ga0105241_10043516 Ga0105241_100435161 213
80 3300009176 Ga0105242_10016474 Ga0105242_100164747 213
81 3300009177 Ga0105248_10013713 Ga0105248_100137131 213
82 3300009553 Ga0105249_10359355 Ga0105249_103593551 213
83 3300010375 Ga0105239_10031070 Ga0105239_100310705 213
84 3300013102 Ga0157371_10113805 Ga0157371_101138052 213
85 3300013297 Ga0157378_10005668 Ga0157378_1000566810 213
86 3300013306 Ga0163162_10463639 Ga0163162_104636392 213
87 3300013308 Ga0157375_10491992 Ga0157375_104919922 213
88 3300014326 Ga0157380_10058259 Ga0157380_100582594 213
89 3300014968 Ga0157379_10118108 Ga0157379_101181081 213
90 3300017792 Ga0163161_10021597 Ga0163161_100215975 213
91 3300025899 Ga0207642_10000329 Ga0207642_1000032910 213
92 3300025903 Ga0207680_10135766 Ga0207680_101357661 213
93 3300025907 Ga0207645_10001622 Ga0207645_1000162221 213
94 3300025911 Ga0207654_10011913 Ga0207654_100119133 213
95 3300025913 Ga0207695_10304571 Ga0207695_103045712 213
96 3300025918 Ga0207662_10289663 Ga0207662_102896631 213
97 3300025921 Ga0207652_10603717 Ga0207652_106037171 213
98 3300025922 Ga0207646_10268906 Ga0207646_102689061 213
99 3300025923 Ga0207681_10304833 Ga0207681_103048332 213
100 3300025927 Ga0207687_10327999 Ga0207687_103279991 213
101 3300025933 Ga0207706_10000005 Ga0207706_10000005115 213
102 3300025934 Ga0207686_10000296 Ga0207686_1000029627 213
103 3300025935 Ga0207709_10007525 Ga0207709_100075252 213
104 3300025937 Ga0207669_10002752 Ga0207669_100027523 213
105 3300025940 Ga0207691_10072116 Ga0207691_100721162 213
106 3300025941 Ga0207711_10003456 Ga0207711_1000345611 213
107 3300025942 Ga0207689_10004020 Ga0207689_100040208 213
108 3300025981 Ga0207640_10001479 Ga0207640_1000147911 213
109 3300025986 Ga0207658_10073447 Ga0207658_100734472 213
110 3300026035 Ga0207703_10009540 Ga0207703_100095405 213
111 3300026075 Ga0207708_10119861 Ga0207708_101198611 213
112 3300026089 Ga0207648_10000008 Ga0207648_10000008165 213
113 3300026118 Ga0207675_100036084 Ga0207675_1000360842 213
114 3300026121 Ga0207683_10024897 Ga0207683_100248974 213
115 3300031901 Ga0307406_10078662 Ga0307406_100786623 213
116 3300048909 Ga0496106_0011448 Ga0496106_0011448_2671_3396 213
117 3300048917 Ga0496114_0048939 Ga0496114_0048939_679_1404 213
118 3300049677 Ga0501247_026073 Ga0501247_026073_41_718 213
119 3300005336 Ga0070680_100317619 Ga0070680_1003176192 214
120 3300005366 Ga0070659_100012845 Ga0070659_1000128458 214
121 3300005458 Ga0070681_10221831 Ga0070681_102218311 214
122 3300005530 Ga0070679_100106636 Ga0070679_1001066362 214
123 3300005617 Ga0068859_100290283 Ga0068859_1002902831 214
124 3300006931 Ga0097620_100290301 Ga0097620_1002903011 214
125 3300025917 Ga0207660_10399048 Ga0207660_103990481 214
126 3300025921 Ga0207652_10075271 Ga0207652_100752712 214
127 3300031901 Ga0307406_10226454 Ga0307406_102264542 214
128 3300042876 Ga0451577_0053677 Ga0451577_0053677_409_1134 214
129 3300044712 Ga0453684_0366562 Ga0453684_0366562_410_1135 214
130 3300045051 Ga0451576_0053444 Ga0451576_0053444_739_1464 214
131 3300046455 Ga0495603_0036660 Ga0495603_0036660_1555_2280 214
132 3300046472 Ga0495580_0288297 Ga0495580_0288297_353_1063 214
133 3300046499 Ga0495594_0081032 Ga0495594_0081032_1049_1774 214
134 3300005468 Ga0070707_100527151 Ga0070707_1005271512 215
135 3300025922 Ga0207646_10470547 Ga0207646_104705471 215
136 3300047318 Ga0495636_0040270 Ga0495636_0040270_78_803 215
137 3300048905 Ga0496102_0087473 Ga0496102_0087473_15_794 215
138 3300050509 nmdc:mga0qj67_292262_c1 nmdc:mga0qj67_292262_c1_133_795 215
139 3300050510 nmdc:mga06r32_332458_c1 nmdc:mga06r32_332458_c1_235_897 215
140 3300005618 Ga0068864_100272159 Ga0068864_1002721592 218
141 3300005841 Ga0068863_100823114 Ga0068863_1008231141 218
142 3300034816 Ga0373930_0033959 Ga0373930_0033959_210_992 218
143 3300048905 Ga0496102_0141537 Ga0496102_0141537_934_1668 218
144 3300048907 Ga0496104_0146278 Ga0496104_0146278_369_1151 218
145 3300048908 Ga0496105_0227996 Ga0496105_0227996_606_1388 218
146 3300048911 Ga0496108_0001805 Ga0496108_0001805_9620_10402 218
147 3300048912 Ga0496109_0010712 Ga0496109_0010712_6716_7498 218
148 3300048914 Ga0496111_0403113 Ga0496111_0403113_46_828 218
149 3300048915 Ga0496112_0432975 Ga0496112_0432975_126_908 218
150 3300048916 Ga0496113_0022604 Ga0496113_0022604_93_875 218
151 3300005455 Ga0070663_100207042 Ga0070663_1002070422 219
152 3300005549 Ga0070704_100046251 Ga0070704_1000462513 219
153 3300005937 Ga0081455_10062952 Ga0081455_100629522 219
154 3300009094 Ga0111539_10806472 Ga0111539_108064721 220
155 3300009147 Ga0114129_10163452 Ga0114129_101634522 220
156 3300025922 Ga0207646_10181816 Ga0207646_101818161 220
157 3300048911 Ga0496108_0003715 Ga0496108_0003715_824_1567 220
158 3300048916 Ga0496113_0105166 Ga0496113_0105166_875_1618 220
159 3300050507 nmdc:mga05p37_190224_c1 nmdc:mga05p37_190224_c1_413_1192 220
160 3300050508 nmdc:mga09592_51876_c1 nmdc:mga09592_51876_c1_500_1195 220
161 3300050511 nmdc:mga08y16_359286_c1 nmdc:mga08y16_359286_c1_318_1052 220
162 3300005841 Ga0068863_100056129 Ga0068863_1000561294 221
163 3300005842 Ga0068858_100093703 Ga0068858_1000937032 221
164 3300014325 Ga0163163_11068681 Ga0163163_110686811 221
165 3300026088 Ga0207641_10156975 Ga0207641_101569752 221
166 3300026095 Ga0207676_10310805 Ga0207676_103108052 221
167 3300031548 Ga0307408_100028894 Ga0307408_1000288943 221
168 3300031731 Ga0307405_10065308 Ga0307405_100653082 221
169 3300031852 Ga0307410_10158369 Ga0307410_101583692 221
170 3300031824 Ga0307413_10162199 Ga0307413_101621991 222
171 3300031901 Ga0307406_10193942 Ga0307406_101939421 222
172 3300006844 Ga0075428_100021272 Ga0075428_1000212723 223
173 3300006846 Ga0075430_100202824 Ga0075430_1002028241 223
174 3300005841 Ga0068863_100715804 Ga0068863_1007158042 224
175 3300026088 Ga0207641_10222178 Ga0207641_102221782 224
176 3300048911 Ga0496108_0064094 Ga0496108_0064094_2188_2970 224
177 3300048912 Ga0496109_0050782 Ga0496109_0050782_2819_3601 224
178 3300048913 Ga0496110_0306148 Ga0496110_0306148_114_896 224
179 3300048916 Ga0496113_0334062 Ga0496113_0334062_287_1069 224
180 3300005440 Ga0070705_100008021 Ga0070705_1000080217 225
181 3300005444 Ga0070694_100015699 Ga0070694_1000156992 225
182 3300005535 Ga0070684_100546236 Ga0070684_1005462361 225
183 3300025939 Ga0207665_10047733 Ga0207665_100477332 226
184 3300005344 Ga0070661_100140751 Ga0070661_1001407511 227
185 3300005564 Ga0070664_100027081 Ga0070664_1000270814 227
186 3300050512 nmdc:mga0n895_3079_c1 nmdc:mga0n895_3079_c1_11084_11797 228
187 3300050514 nmdc:mga08x19_279438_c1 nmdc:mga08x19_279438_c1_423_1142 228
188 3300050514 nmdc:mga08x19_864_c1 nmdc:mga08x19_864_c1_378_1091 228
189 3300005577 Ga0068857_100015465 Ga0068857_1000154652 229
190 3300005618 Ga0068864_100002767 Ga0068864_10000276713 229
191 3300005719 Ga0068861_100165056 Ga0068861_1001650563 229
192 3300005840 Ga0068870_10071531 Ga0068870_100715312 229
193 3300005844 Ga0068862_100621296 Ga0068862_1006212961 229
194 3300005981 Ga0081538_10008285 Ga0081538_100082853 229
195 3300006847 Ga0075431_100267072 Ga0075431_1002670722 229
196 3300010375 Ga0105239_10743851 Ga0105239_107438512 229
197 3300011119 Ga0105246_10005394 Ga0105246_100053946 229
198 3300013306 Ga0163162_10817585 Ga0163162_108175851 229
199 3300014969 Ga0157376_10461816 Ga0157376_104618161 229
200 3300025908 Ga0207643_10013182 Ga0207643_100131824 229
201 3300026075 Ga0207708_10110088 Ga0207708_101100882 229
202 3300026095 Ga0207676_10002075 Ga0207676_1000207513 229
203 3300026116 Ga0207674_10022324 Ga0207674_100223242 229
204 3300026118 Ga0207675_100920055 Ga0207675_1009200551 229
205 3300005564 Ga0070664_100217058 Ga0070664_1002170582 231
206 3300025945 Ga0207679_10661851 Ga0207679_106618512 231
207 3300049743 Ga0501081_0622567 Ga0501081_0622567_66_791 231
208 3300060353 Ga0501082_0768319 Ga0501082_0768319_50_775 231
209 3300005340 Ga0070689_100331042 Ga0070689_1003310421 232
210 3300005440 Ga0070705_100125345 Ga0070705_1001253452 232
211 3300005457 Ga0070662_100213742 Ga0070662_1002137423 232
212 3300005549 Ga0070704_100049040 Ga0070704_1000490401 232
213 3300006852 Ga0075433_10388425 Ga0075433_103884251 232
214 3300006871 Ga0075434_100017368 Ga0075434_1000173687 232
215 3300006871 Ga0075434_100078049 Ga0075434_1000780495 232
216 3300006914 Ga0075436_100040378 Ga0075436_1000403781 232
217 3300006914 Ga0075436_100068752 Ga0075436_1000687522 232
218 3300009094 Ga0111539_10524773 Ga0111539_105247732 232
219 3300009545 Ga0105237_11252167 Ga0105237_112521671 232
220 3300010375 Ga0105239_10009754 Ga0105239_100097541 232
221 3300025910 Ga0207684_10575702 Ga0207684_105757021 232
222 3300025922 Ga0207646_10125493 Ga0207646_101254932 232
223 3300025933 Ga0207706_10429858 Ga0207706_104298581 232
224 3300031995 Ga0307409_100210503 Ga0307409_1002105031 232
225 3300032002 Ga0307416_100054452 Ga0307416_1000544523 232
226 3300048905 Ga0496102_0013492 Ga0496102_0013492_1524_2240 232
227 3300048906 Ga0496103_0006333 Ga0496103_0006333_560_1276 232
228 3300048907 Ga0496104_0140580 Ga0496104_0140580_1548_2264 232
229 3300048909 Ga0496106_0012057 Ga0496106_0012057_728_1444 232
230 3300048910 Ga0496107_0009544 Ga0496107_0009544_82_798 232
231 3300048912 Ga0496109_0034092 Ga0496109_0034092_3556_4272 232
232 3300048913 Ga0496110_0319828 Ga0496110_0319828_220_936 232
233 3300048914 Ga0496111_0170752 Ga0496111_0170752_478_1194 232
234 3300048915 Ga0496112_0075574 Ga0496112_0075574_2227_2943 232
235 3300048918 Ga0496115_0688384 Ga0496115_0688384_37_753 232
236 3300049679 Ga0501249_031532 Ga0501249_031532_360_1106 232
237 3300049705 Ga0501225_0020028 Ga0501225_0020028_40_786 232
238 3300049706 Ga0501229_016821 Ga0501229_016821_125_871 232
239 3300050512 nmdc:mga0n895_23414_c1 nmdc:mga0n895_23414_c1_3586_4302 232
240 3300050512 nmdc:mga0n895_49496_c1 nmdc:mga0n895_49496_c1_3226_3942 232
241 3300050514 nmdc:mga08x19_12172_c1 nmdc:mga08x19_12172_c1_1445_2161 232
242 3300050514 nmdc:mga08x19_298627_c1 nmdc:mga08x19_298627_c1_347_1063 232
243 3300005347 Ga0070668_100108216 Ga0070668_1001082162 233
244 3300005356 Ga0070674_100263569 Ga0070674_1002635692 233
245 3300005445 Ga0070708_100137843 Ga0070708_1001378431 233
246 3300005459 Ga0068867_100137057 Ga0068867_1001370572 233
247 3300005467 Ga0070706_100435151 Ga0070706_1004351512 233
248 3300005518 Ga0070699_100238512 Ga0070699_1002385122 233
249 3300005536 Ga0070697_100271378 Ga0070697_1002713782 233
250 3300005543 Ga0070672_100100751 Ga0070672_1001007512 233
251 3300006358 Ga0068871_100299534 Ga0068871_1002995342 233
252 3300009177 Ga0105248_10016304 Ga0105248_100163047 233
253 3300009177 Ga0105248_10449407 Ga0105248_104494071 233
254 3300014325 Ga0163163_10132769 Ga0163163_101327692 233
255 3300014968 Ga0157379_10028628 Ga0157379_100286285 233
256 3300014969 Ga0157376_10010839 Ga0157376_100108395 233
257 3300025922 Ga0207646_10121901 Ga0207646_101219012 233
258 3300025922 Ga0207646_10197206 Ga0207646_101972062 233
259 3300025940 Ga0207691_10045193 Ga0207691_100451932 233
260 3300025941 Ga0207711_10490929 Ga0207711_104909291 233
261 3300025972 Ga0207668_10082403 Ga0207668_100824032 233
262 3300026089 Ga0207648_10058731 Ga0207648_100587312 233
263 3300031548 Ga0307408_100008565 Ga0307408_1000085657 233
264 3300031731 Ga0307405_10080025 Ga0307405_100800252 233
265 3300031731 Ga0307405_10256364 Ga0307405_102563642 233
266 3300031824 Ga0307413_10004704 Ga0307413_100047042 233
267 3300031824 Ga0307413_10015109 Ga0307413_100151092 233
268 3300031824 Ga0307413_10020705 Ga0307413_100207053 233
269 3300031852 Ga0307410_10080393 Ga0307410_100803933 233
270 3300031852 Ga0307410_10579961 Ga0307410_105799611 233
271 3300031901 Ga0307406_10031245 Ga0307406_100312454 233
272 3300031901 Ga0307406_10205184 Ga0307406_102051842 233
273 3300031903 Ga0307407_10004470 Ga0307407_100044707 233
274 3300031903 Ga0307407_10012697 Ga0307407_100126974 233
275 3300031911 Ga0307412_10166708 Ga0307412_101667082 233
276 3300031995 Ga0307409_100059929 Ga0307409_1000599292 233
277 3300031995 Ga0307409_100263285 Ga0307409_1002632852 233
278 3300032002 Ga0307416_100004930 Ga0307416_1000049306 233
279 3300032002 Ga0307416_100022993 Ga0307416_1000229932 233
280 3300032004 Ga0307414_10093356 Ga0307414_100933561 233
281 3300032126 Ga0307415_100013078 Ga0307415_1000130786 233
282 3300032126 Ga0307415_100021544 Ga0307415_1000215445 233
283 3300047319 Ga0495674_0141548 Ga0495674_0141548_1050_1775 233
284 3300048904 Ga0496101_0282841 Ga0496101_0282841_525_1268 233
285 3300048912 Ga0496109_0027330 Ga0496109_0027330_453_1196 233
286 3300048914 Ga0496111_0011554 Ga0496111_0011554_790_1533 233
287 3300049513 Ga0501290_022120 Ga0501290_022120_52_801 233
288 3300049679 Ga0501249_033839 Ga0501249_033839_31_780 233
289 3300049686 Ga0501257_080498 Ga0501257_080498_77_826 233
290 3300049703 Ga0501219_006979 Ga0501219_006979_31_780 233
291 3300049742 Ga0501080_0491903 Ga0501080_0491903_131_856 233
292 3300059421 Ga0590071_054229 Ga0590071_054229_108_860 233
293 3300005406 Ga0070703_10021713 Ga0070703_100217132 234
294 3300005440 Ga0070705_100043979 Ga0070705_1000439792 234
295 3300005444 Ga0070694_100081644 Ga0070694_1000816443 234
296 3300005445 Ga0070708_100008970 Ga0070708_1000089703 234
297 3300005467 Ga0070706_100019275 Ga0070706_1000192753 234
298 3300005468 Ga0070707_100571758 Ga0070707_1005717581 234
299 3300005471 Ga0070698_100001502 Ga0070698_10000150224 234
300 3300005471 Ga0070698_100269777 Ga0070698_1002697771 234
301 3300005518 Ga0070699_100042548 Ga0070699_1000425482 234
302 3300005518 Ga0070699_100044788 Ga0070699_1000447883 234
303 3300005518 Ga0070699_100490820 Ga0070699_1004908202 234
304 3300005536 Ga0070697_100189858 Ga0070697_1001898581 234
305 3300005545 Ga0070695_100016898 Ga0070695_1000168982 234
306 3300005545 Ga0070695_100076211 Ga0070695_1000762112 234
307 3300005546 Ga0070696_100031165 Ga0070696_1000311653 234
308 3300005549 Ga0070704_100015264 Ga0070704_1000152644 234
309 3300005549 Ga0070704_100134036 Ga0070704_1001340362 234
310 3300006852 Ga0075433_10010644 Ga0075433_100106443 234
311 3300006852 Ga0075433_10096690 Ga0075433_100966902 234
312 3300006871 Ga0075434_100071116 Ga0075434_1000711163 234
313 3300006871 Ga0075434_100082491 Ga0075434_1000824913 234
314 3300006871 Ga0075434_100088082 Ga0075434_1000880823 234
315 3300006880 Ga0075429_100074888 Ga0075429_1000748882 234
316 3300006880 Ga0075429_100344477 Ga0075429_1003444772 234
317 3300006914 Ga0075436_100008026 Ga0075436_1000080265 234
318 3300006914 Ga0075436_100029809 Ga0075436_1000298092 234
319 3300006914 Ga0075436_100150019 Ga0075436_1001500192 234
320 3300007265 Ga0099794_10098009 Ga0099794_100980091 234
321 3300009094 Ga0111539_10014271 Ga0111539_100142714 234
322 3300009147 Ga0114129_10163155 Ga0114129_101631552 234
323 3300009147 Ga0114129_10435051 Ga0114129_104350511 234
324 3300009147 Ga0114129_11176204 Ga0114129_111762041 234
325 3300025885 Ga0207653_10004553 Ga0207653_100045534 234
326 3300025910 Ga0207684_10004607 Ga0207684_1000460713 234
327 3300025910 Ga0207684_10053991 Ga0207684_100539913 234
328 3300025922 Ga0207646_10005263 Ga0207646_100052635 234
329 3300025922 Ga0207646_10008221 Ga0207646_100082213 234
330 3300025939 Ga0207665_10013137 Ga0207665_100131373 234
331 3300026095 Ga0207676_10148137 Ga0207676_101481372 234
332 3300027671 Ga0209588_1097409 Ga0209588_10974091 234
333 3300031731 Ga0307405_10255504 Ga0307405_102555042 234
334 3300031824 Ga0307413_10135456 Ga0307413_101354562 234
335 3300031911 Ga0307412_10044615 Ga0307412_100446152 234
336 3300035112 Ga0373932_0071825 Ga0373932_0071825_146_925 234
337 3300036401 Ga0373937_0128683 Ga0373937_0128683_1031_1774 234
338 3300038996 Ga0242420_034548 Ga0242420_034548_136_915 234
339 3300046473 Ga0495582_0010755 Ga0495582_0010755_236_979 234
340 3300046477 Ga0495664_0017174 Ga0495664_0017174_99_842 234
341 3300046514 Ga0495618_0013488 Ga0495618_0013488_1825_2568 234
342 3300046517 Ga0495630_0013975 Ga0495630_0013975_4642_5385 234
343 3300046526 Ga0495666_0037752 Ga0495666_0037752_63_806 234
344 3300046533 Ga0495640_0109998 Ga0495640_0109998_29_772 234
345 3300046535 Ga0495586_0005940 Ga0495586_0005940_5386_6129 234
346 3300046642 Ga0495634_0017400 Ga0495634_0017400_450_1193 234
347 3300046689 Ga0495613_0072238 Ga0495613_0072238_1683_2426 234
348 3300047319 Ga0495674_0020120 Ga0495674_0020120_57_800 234
349 3300047471 Ga0495684_0020091 Ga0495684_0020091_4106_4849 234
350 3300048915 Ga0496112_0252867 Ga0496112_0252867_829_1578 234
351 3300049583 Ga0501067_0064811 Ga0501067_0064811_82_834 234
352 3300049744 Ga0501083_0223204 Ga0501083_0223204_434_1180 234
353 3300050507 nmdc:mga05p37_26116_c1 nmdc:mga05p37_26116_c1_4229_4993 234
354 3300050508 nmdc:mga09592_114152_c1 nmdc:mga09592_114152_c1_1167_1901 234
355 3300050511 nmdc:mga08y16_71994_c1 nmdc:mga08y16_71994_c1_1054_1821 234
356 3300050512 nmdc:mga0n895_2889_c1 nmdc:mga0n895_2889_c1_7010_7774 234
357 3300050512 nmdc:mga0n895_61233_c1 nmdc:mga0n895_61233_c1_1716_2471 234
358 3300050513 nmdc:mga0rr50_35854_c1 nmdc:mga0rr50_35854_c1_1059_1805 234
359 3300050514 nmdc:mga08x19_190825_c1 nmdc:mga08x19_190825_c1_191_955 234
360 3300050515 nmdc:mga0a205_1422_c1 nmdc:mga0a205_1422_c1_9373_10128 234
361 3300050515 nmdc:mga0a205_254864_c1 nmdc:mga0a205_254864_c1_175_921 234
362 3300050515 nmdc:mga0a205_51174_c1 nmdc:mga0a205_51174_c1_2036_2800 234
363 3300060353 Ga0501082_0305403 Ga0501082_0305403_415_1149 234
364 3300003322 rootL2_10001697 rootL2_100016976 235
365 3300005438 Ga0070701_10056802 Ga0070701_100568022 235
366 3300005439 Ga0070711_100013297 Ga0070711_1000132971 235
367 3300005468 Ga0070707_100000266 Ga0070707_1000002668 235
368 3300005468 Ga0070707_100166666 Ga0070707_1001666662 235
369 3300005471 Ga0070698_100037510 Ga0070698_1000375102 235
370 3300005471 Ga0070698_100257120 Ga0070698_1002571202 235
371 3300005471 Ga0070698_100401659 Ga0070698_1004016592 235
372 3300005518 Ga0070699_100001124 Ga0070699_10000112421 235
373 3300005518 Ga0070699_100006746 Ga0070699_1000067463 235
374 3300005518 Ga0070699_100139600 Ga0070699_1001396002 235
375 3300005549 Ga0070704_100000053 Ga0070704_10000005331 235
376 3300005549 Ga0070704_100684522 Ga0070704_1006845221 235
377 3300005617 Ga0068859_100027308 Ga0068859_1000273082 235
378 3300005844 Ga0068862_100903396 Ga0068862_1009033961 235
379 3300006175 Ga0070712_100348907 Ga0070712_1003489071 235
380 3300006844 Ga0075428_100136982 Ga0075428_1001369822 235
381 3300006847 Ga0075431_100833776 Ga0075431_1008337761 235
382 3300006880 Ga0075429_100000196 Ga0075429_10000019631 235
383 3300006931 Ga0097620_100027306 Ga0097620_1000273062 235
384 3300009148 Ga0105243_10373960 Ga0105243_103739601 235
385 3300013308 Ga0157375_10399557 Ga0157375_103995572 235
386 3300025915 Ga0207693_10188232 Ga0207693_101882322 235
387 3300025916 Ga0207663_10105755 Ga0207663_101057552 235
388 3300025922 Ga0207646_10015709 Ga0207646_100157092 235
389 3300025922 Ga0207646_10296139 Ga0207646_102961392 235
390 3300028380 Ga0268265_10892209 Ga0268265_108922091 235
391 3300031824 Ga0307413_10031323 Ga0307413_100313233 235
392 3300031852 Ga0307410_10005211 Ga0307410_100052113 235
393 3300031903 Ga0307407_10035779 Ga0307407_100357794 235
394 3300032004 Ga0307414_10104535 Ga0307414_101045351 235
395 3300032005 Ga0307411_10004102 Ga0307411_100041022 235
396 3300032126 Ga0307415_100437695 Ga0307415_1004376952 235
397 3300042876 Ga0451577_0053015 Ga0451577_0053015_2796_3545 235
398 3300045051 Ga0451576_0481430 Ga0451576_0481430_50_799 235
399 3300049583 Ga0501067_0029435 Ga0501067_0029435_1176_1931 235
400 3300050510 nmdc:mga06r32_891372_c1 nmdc:mga06r32_891372_c1_55_813 235

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02517

Rce1-like

Type II CAAX prenyl endopeptidase Rce1-like

147

254

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6u0o-assembly1.cif.gz_A crystal structure of a peptidoglycan release complex, sagb-spdc, in lipidic cubic phase 0.486 15 231
6u0o-assembly1.cif.gz_A crystal structure of a peptidoglycan release complex, sagb-spdc, in lipidic cubic phase 0.4353 15 231
7zmh-assembly1.cif.gz_J cryoem structure of mitochondrial complex i from chaetomium thermophilum (state 1) - membrane arm 0.3653 93 216
5eik-assembly1.cif.gz_A structure of a trimeric intracellular cation channel from c. elegans in the absence of ca2+ 0.3653 127 234
8oyw-assembly1.cif.gz_A de novo designed rhomboid protease-like fold rpf_9 0.3301 109 231
ID Description Score Start End Superfamily
af_Q2FVI8_12_124_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.5534 131 233 1.20.1280.290
af_P77219_8_153_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.5172 87 235 1.20.1080.10
af_Q2FVI8_12_124_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.5115 131 233 1.20.1280.290
af_P77219_8_153_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.4626 87 235 1.20.1080.10
af_Q9NAQ9_87_204_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.4377 98 207 1.10.10.1740
ID Description Score Start End GO Terms
AF-A0A7V2UFF7-F1-model_v4 CPBP family intramembrane metalloprotease 0.9239 2 235 GO:0004222
GO:0016020
GO:0071586
AF-A0A6N9AGE3-F1-model_v4 CPBP family intramembrane metalloprotease 0.9233 136 234 GO:0004222
GO:0016020
GO:0071586
AF-A0A2N1W9I9-F1-model_v4 CPBP family intramembrane metalloprotease 0.9163 4 200 GO:0004222
GO:0016020
GO:0071586
AF-A0A7V8VU48-F1-model_v4 CPBP family intramembrane metalloprotease 0.9158 1 234 GO:0004222
GO:0016020
GO:0071586
AF-A0A1V4AT84-F1-model_v4 Abortive infection protein 0.9146 96 233 GO:0004222
GO:0016020
GO:0071586

Feature Viewer

pLDDT pTM Quality
89.3 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map