F434521

General Info

Members Datasets Scaffolds Average Seq Length
400 233 800 333

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100029507|Ga0070706_1000295074
Length 348
Sequence MNLHAQTMNSSRLRGRSLLKEIDLTADEFLYLVDLGDRARRAKEMGFHQHRLAGRNIALIFEKASTRTRSAFEVAAHDEGAHVTYIGPDESQLGYKESMKDTARVLGRMYDGIEYRGSSQEAVEILGAHAGVPVWNGLTDTWHPTQMLADVLTMRDCIAADHPRRRLRDVTLCYLGDGRNNVADSLLVTGAMLGMDVRICTADALQPPAAVWEIAARLAEDSGSRLTITDEVAAGVRGADFLYTDVWLSMGEPAGDWDKRIDQLLPYQVNAEVMAATGNPDVRFMHCLPALHNRETEIGRQVYERRGLEALEVTEEVFESPQSVVFEQAANRMHTIKALMVATIGVRE

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
60 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
61 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
62 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
63 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
64 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
65 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
66 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
67 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
68 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
69 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
70 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
71 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
72 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
73 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
74 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
75 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
76 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
77 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
78 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
79 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
80 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
81 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
82 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
83 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
84 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
85 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
86 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
87 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
88 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
89 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
90 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
91 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
92 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
93 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
94 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
95 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
96 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
102 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
107 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
108 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
109 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
110 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
111 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
112 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
113 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
117 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
118 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
119 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
120 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
121 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
122 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
123 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
124 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
125 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
126 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
127 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
128 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
129 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
130 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
131 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
132 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
133 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
136 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
138 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
139 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
140 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
141 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
142 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
143 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
144 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
145 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
146 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
147 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
150 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
151 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
152 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
153 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
156 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
157 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
158 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
159 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
160 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
161 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
162 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
163 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
164 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
165 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
166 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
167 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
168 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
169 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
182 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
190 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
193 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
194 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
195 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
196 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
202 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
203 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
204 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
205 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
206 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
207 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
208 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
209 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
210 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
211 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
212 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
213 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
214 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
215 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
216 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
217 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
218 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
219 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
220 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
221 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
222 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
223 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
224 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
225 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
226 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
227 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
228 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
229 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
230 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
231 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
232 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
233 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.5
Metatranscriptomes 0.25
Isolates 4.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2
Nodule 0
Rhizoplane 1.75
Rhizosphere 90.75
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100029507 3300005467 Bacteria 5054
2 Ga0070682_100039370 3300005337 Bacteria 2905
3 Ga0068868_100134001 3300005338 Bacteria 2029
4 Ga0070709_10001484 3300005434 Bacteria 12666
5 Ga0070709_10105580 3300005434 Bacteria 1884
6 Ga0070709_10141338 3300005434 Bacteria 1654
7 Ga0070714_100023094 3300005435 Bacteria 5106
8 Ga0070714_100029459 3300005435 Bacteria 4563
9 Ga0070714_100167188 3300005435 Bacteria 1994
10 Ga0070714_100302504 3300005435 Bacteria 1491
11 Ga0070714_100424189 3300005435 Bacteria 1260
12 Ga0070713_100014044 3300005436 Bacteria 5930
13 Ga0070710_10001100 3300005437 Bacteria 12801
14 Ga0070710_10013436 3300005437 Bacteria 4102
15 Ga0070710_10106573 3300005437 Bacteria 1677
16 Ga0070710_10212268 3300005437 Bacteria 1227
17 Ga0070711_100035929 3300005439 Bacteria 3317
18 Ga0070711_100163083 3300005439 Bacteria 1691
19 Ga0070711_100185370 3300005439 Bacteria 1595
20 Ga0070708_100124811 3300005445 Bacteria 2378
21 Ga0070678_100007181 3300005456 Bacteria 6590
22 Ga0070706_100002901 3300005467 Bacteria 17066
23 Ga0070706_100063659 3300005467 Bacteria 3408
24 Ga0070706_100094175 3300005467 Bacteria 2779
25 Ga0070707_100000166 3300005468 Bacteria 63590
26 Ga0070707_100011896 3300005468 Bacteria 8122
27 Ga0070707_100016513 3300005468 Bacteria 6927
28 Ga0070698_100000006 3300005471 Bacteria 129236
29 Ga0070698_100020871 3300005471 Bacteria 6864
30 Ga0070698_100098889 3300005471 Bacteria 2891
31 Ga0070679_100224063 3300005530 Bacteria 1841
32 Ga0070684_100169977 3300005535 Bacteria 1980
33 Ga0070697_100007934 3300005536 Bacteria 8274
34 Ga0070697_100036703 3300005536 Bacteria 3959
35 Ga0070665_100191364 3300005548 Bacteria 2047
36 Ga0068855_100579506 3300005563 Bacteria 1212
37 Ga0068856_100033391 3300005614 Bacteria 5038
38 Ga0068856_100240332 3300005614 Bacteria 1826
39 Ga0068859_100633277 3300005617 Bacteria 1162
40 Ga0081455_10116640 3300005937 Bacteria 2111
41 Ga0070717_10046333 3300006028 Bacteria 3558
42 Ga0070717_10060223 3300006028 Bacteria 3143
43 Ga0070717_10391484 3300006028 Bacteria 1247
44 Ga0070716_100000846 3300006173 Bacteria 13188
45 Ga0070712_100001434 3300006175 Bacteria 14533
46 Ga0070712_100038599 3300006175 Bacteria 3264
47 Ga0070712_100050582 3300006175 Bacteria 2891
48 Ga0070712_100050894 3300006175 Bacteria 2884
49 Ga0070712_100052584 3300006175 Bacteria 2841
50 Ga0068871_100009662 3300006358 Bacteria 7002
51 Ga0075428_100000450 3300006844 Bacteria 41111
52 Ga0075433_10024155 3300006852 Bacteria 5126
53 Ga0075434_100001250 3300006871 Bacteria 21174
54 Ga0075436_100006875 3300006914 Bacteria 7781
55 Ga0097620_100633306 3300006931 Bacteria 1162
56 Ga0105247_10035633 3300009101 Bacteria 3034
57 Ga0105241_10012709 3300009174 Bacteria 6178
58 Ga0105242_10547268 3300009176 Bacteria 1109
59 Ga0105248_10047818 3300009177 Bacteria 4798
60 Ga0105237_10203820 3300009545 Bacteria 1978
61 Ga0105238_10120936 3300009551 Bacteria 2598
62 Ga0105239_10169794 3300010375 Bacteria 2439
63 Ga0157369_10262921 3300013105 Bacteria 1799
64 Ga0157374_10309181 3300013296 Bacteria 1564
65 Ga0157378_10129230 3300013297 Bacteria 2337
66 Ga0157375_10037893 3300013308 Bacteria 4625
67 Ga0157379_10066520 3300014968 Bacteria 3222
68 Ga0157376_10004270 3300014969 Bacteria 9920
69 Ga0207692_10000294 3300025898 Bacteria 17332
70 Ga0207692_10046431 3300025898 Bacteria 2177
71 Ga0207692_10114957 3300025898 Bacteria 1498
72 Ga0207692_10204710 3300025898 Bacteria 1162
73 Ga0207710_10019108 3300025900 Bacteria 2921
74 Ga0207699_10139739 3300025906 Bacteria 1591
75 Ga0207699_10228222 3300025906 Bacteria 1274
76 Ga0207684_10002440 3300025910 Bacteria 18754
77 Ga0207684_10013843 3300025910 Bacteria 6968
78 Ga0207684_10043924 3300025910 Bacteria 3790
79 Ga0207684_10054153 3300025910 Bacteria 3404
80 Ga0207684_10291773 3300025910 Bacteria 1406
81 Ga0207671_10175698 3300025914 Bacteria 1665
82 Ga0207693_10051063 3300025915 Bacteria 3246
83 Ga0207693_10054650 3300025915 Bacteria 3132
84 Ga0207693_10070988 3300025915 Bacteria 2725
85 Ga0207663_10018409 3300025916 Bacteria 3914
86 Ga0207663_10037133 3300025916 Bacteria 2935
87 Ga0207652_10133895 3300025921 Bacteria 2212
88 Ga0207646_10000049 3300025922 Bacteria 171680
89 Ga0207646_10001629 3300025922 Bacteria 27402
90 Ga0207646_10021297 3300025922 Bacteria 5992
91 Ga0207700_10002241 3300025928 Bacteria 11094
92 Ga0207700_10004441 3300025928 Bacteria 8271
93 Ga0207700_10029942 3300025928 Bacteria 3848
94 Ga0207700_10084354 3300025928 Bacteria 2490
95 Ga0207700_10251693 3300025928 Bacteria 1509
96 Ga0207664_10001824 3300025929 Bacteria 14044
97 Ga0207664_10016800 3300025929 Bacteria 5347
98 Ga0207664_10022938 3300025929 Bacteria 4669
99 Ga0207664_10027979 3300025929 Bacteria 4280
100 Ga0207665_10000940 3300025939 Bacteria 19700
101 Ga0207689_10303752 3300025942 Bacteria 1323
102 Ga0207702_10022901 3300026078 Bacteria 5183
103 Ga0207702_10041850 3300026078 Bacteria 3842
104 Ga0207683_10030860 3300026121 Bacteria 4647
105 Ga0268266_10213668 3300028379 Bacteria 1770
106 Ga0265337_1000377 3300028556 Bacteria 23918
107 Ga0265326_10000999 3300028558 Bacteria 10160
108 Ga0265334_10001075 3300028573 Bacteria 13356
109 Ga0265336_10001880 3300028666 Bacteria 9079
110 Ga0265336_10006331 3300028666 Bacteria 4276
111 Ga0265336_10012321 3300028666 Bacteria 2880
112 Ga0307517_10048402 3300028786 Bacteria 4374
113 Ga0307515_10026647 3300028794 Bacteria 9933
114 Ga0307515_10084317 3300028794 Bacteria 4083
115 Ga0265338_10003014 3300028800 Bacteria 24307
116 Ga0265338_10007749 3300028800 Bacteria 13213
117 Ga0265338_10072167 3300028800 Bacteria 2949
118 Ga0265324_10006541 3300029957 Bacteria 4838
119 Ga0307511_10002580 3300030521 Bacteria 18930
120 Ga0265332_10005192 3300031238 Bacteria 6025
121 Ga0265320_10020253 3300031240 Bacteria 3610
122 Ga0265325_10004192 3300031241 Bacteria 9161
123 Ga0265340_10005027 3300031247 Bacteria 7355
124 Ga0265339_10009861 3300031249 Bacteria 5966
125 Ga0265316_10013754 3300031344 Bacteria 7171
126 Ga0307513_10018194 3300031456 Bacteria 8407
127 Ga0307509_10004570 3300031507 Bacteria 19849
128 Ga0307509_10014847 3300031507 Bacteria 9130
129 Ga0307508_10028550 3300031616 Bacteria 5043
130 Ga0307514_10033977 3300031649 Bacteria 4065
131 Ga0265342_10008936 3300031712 Bacteria 7116
132 Ga0307516_10117000 3300031730 Bacteria 2460
133 Ga0307518_10061030 3300031838 Bacteria 2738
134 Ga0307507_10180775 3300033179 Bacteria 1508
135 Ga0307510_10004499 3300033180 Bacteria 16395
136 Ga0373926_0019615 3300035083 Bacteria 2331
137 Ga0373926_0045479 3300035083 Bacteria 1574
138 Ga0373934_0020967 3300035086 Bacteria 2515
139 Ga0373934_0030004 3300035086 Bacteria 2125
140 Ga0373944_0002013 3300035089 Bacteria 5154
141 Ga0373944_0028181 3300035089 Bacteria 1670
142 Ga0373923_0002792 3300035111 Bacteria 5467
143 Ga0373923_0035787 3300035111 Bacteria 2023
144 Ga0373923_0074474 3300035111 Bacteria 1463
145 Ga0373936_0013730 3300035113 Bacteria 3091
146 Ga0373936_0042101 3300035113 Bacteria 1832
147 Ga0373945_0000861 3300035116 Bacteria 8944
148 Ga0373953_0038710 3300035117 Bacteria 1887
149 Ga0373954_0029836 3300035118 Bacteria 2514
150 Ga0373954_0043933 3300035118 Bacteria 2084
151 Ga0373954_0116796 3300035118 Bacteria 1293
152 Ga0373956_0075725 3300035119 Bacteria 1539
153 Ga0373957_0004512 3300035120 Bacteria 4238
154 Ga0373946_0000034 3300035171 Bacteria 36345
155 Ga0373946_0000467 3300035171 Bacteria 13372
156 Ga0373946_0054373 3300035171 Bacteria 1685
157 Ga0373955_0022935 3300035172 Bacteria 3173
158 Ga0373955_0220218 3300035172 Bacteria 1133
159 Ga0373924_0016708 3300035410 Bacteria 2805
160 Ga0373924_0017693 3300035410 Bacteria 2737
161 Ga0373935_0000871 3300035692 Bacteria 16284
162 Ga0373935_0004623 3300035692 Bacteria 8088
163 Ga0373935_0018963 3300035692 Bacteria 4193
164 Ga0373927_0000594 3300035695 Bacteria 27587
165 Ga0373933_0011023 3300035724 Bacteria 4966
166 Ga0373933_0049711 3300035724 Bacteria 2501
167 Ga0373933_0207924 3300035724 Bacteria 1253
168 Ga0373947_0000001 3300035725 Bacteria 510932
169 Ga0373947_0008882 3300035725 Bacteria 5782
170 Ga0373947_0120537 3300035725 Bacteria 1666
171 Ga0373937_0014234 3300036401 Bacteria 7021
172 Ga0372808_010510 3300036459 Bacteria 1303
173 Ga0373925_0008123 3300037068 Bacteria 7643
174 Ga0395898_0239860 3300037466 Bacteria 1729
175 Ga0436364_0229196 3300037853 Bacteria 3301
176 Ga0436364_0613092 3300037853 Bacteria 1166
177 Ga0395901_0078778 3300038443 Bacteria 3441
178 Ga0436360_0320843 3300039438 Bacteria 1577
179 Ga0436361_1211156 3300039447 Bacteria 1354
180 Ga0436363_1454820 3300039450 Bacteria 4587
181 Ga0439448_0048365 3300042005 Bacteria 1388
182 Ga0450903_000341 3300042138 Bacteria 10267
183 Ga0439458_0000336 3300042157 Bacteria 11755
184 Ga0466963_0069319 3300044694 Bacteria 2370
185 Ga0466968_0036100 3300044735 Bacteria 2070
186 Ga0466959_0151364 3300045049 Bacteria 1635
187 Ga0466967_0022583 3300045976 Bacteria 5137
188 Ga0466967_0239424 3300045976 Bacteria 1731
189 Ga0495627_057432 3300046453 Bacteria 1158
190 Ga0495592_0030894 3300046454 Bacteria 4052
191 Ga0495592_0080101 3300046454 Bacteria 2363
192 Ga0495592_0129532 3300046454 Bacteria 1766
193 Ga0495592_0150070 3300046454 Bacteria 1613
194 Ga0495592_0241171 3300046454 Bacteria 1199
195 Ga0495603_0001880 3300046455 Bacteria 12386
196 Ga0495603_0010380 3300046455 Bacteria 5639
197 Ga0495629_0002265 3300046459 Bacteria 14832
198 Ga0495629_0003925 3300046459 Bacteria 11185
199 Ga0495629_0025475 3300046459 Bacteria 4203
200 Ga0495629_0033792 3300046459 Bacteria 3616
201 Ga0495629_0038384 3300046459 Bacteria 3373
202 Ga0495641_0002211 3300046461 Bacteria 15517
203 Ga0495641_0008628 3300046461 Bacteria 6174
204 Ga0495641_0016721 3300046461 Bacteria 3854
205 Ga0495651_0001067 3300046462 Bacteria 21168
206 Ga0495651_0021268 3300046462 Bacteria 5041
207 Ga0495653_0003019 3300046463 Bacteria 13492
208 Ga0495653_0005723 3300046463 Bacteria 10162
209 Ga0495580_0040735 3300046472 Bacteria 3316
210 Ga0495580_0101044 3300046472 Bacteria 2006
211 Ga0495582_0004205 3300046473 Bacteria 8096
212 Ga0495582_0019526 3300046473 Bacteria 3706
213 Ga0495582_0109492 3300046473 Bacteria 1551
214 Ga0495662_0002921 3300046476 Bacteria 8635
215 Ga0495662_0015480 3300046476 Bacteria 3701
216 Ga0495664_0062572 3300046477 Bacteria 2217
217 Ga0495664_0134905 3300046477 Bacteria 1495
218 Ga0495664_0146000 3300046477 Bacteria 1434
219 Ga0495664_0176167 3300046477 Bacteria 1297
220 Ga0495585_0004755 3300046492 Bacteria 8740
221 Ga0495585_0110265 3300046492 Bacteria 1464
222 Ga0495594_0053674 3300046499 Bacteria 2220
223 Ga0495594_0075180 3300046499 Bacteria 1883
224 Ga0495608_0011925 3300046511 Bacteria 6045
225 Ga0495608_0035745 3300046511 Bacteria 3348
226 Ga0495608_0072329 3300046511 Bacteria 2250
227 Ga0495608_0103601 3300046511 Bacteria 1833
228 Ga0495616_0096470 3300046513 Bacteria 1392
229 Ga0495618_0019854 3300046514 Bacteria 4137
230 Ga0495618_0022197 3300046514 Bacteria 3918
231 Ga0495618_0165059 3300046514 Bacteria 1410
232 Ga0495620_0014027 3300046515 Bacteria 4085
233 Ga0495628_0024917 3300046516 Bacteria 4893
234 Ga0495628_0041668 3300046516 Bacteria 3665
235 Ga0495628_0168586 3300046516 Bacteria 1661
236 Ga0495630_0129481 3300046517 Bacteria 1916
237 Ga0495630_0148606 3300046517 Bacteria 1782
238 Ga0495643_0005031 3300046522 Bacteria 9050
239 Ga0495643_0010828 3300046522 Bacteria 5591
240 Ga0495648_0039110 3300046524 Bacteria 3023
241 Ga0495652_0061010 3300046529 Bacteria 3184
242 Ga0495652_0087222 3300046529 Bacteria 2560
243 Ga0495652_0187490 3300046529 Bacteria 1581
244 Ga0495665_0013999 3300046531 Bacteria 4332
245 Ga0495640_0012981 3300046533 Bacteria 6347
246 Ga0495640_0024879 3300046533 Bacteria 4350
247 Ga0495586_0010026 3300046535 Bacteria 5047
248 Ga0495586_0126288 3300046535 Bacteria 1431
249 Ga0495586_0161235 3300046535 Bacteria 1265
250 Ga0495586_0185770 3300046535 Bacteria 1177
251 Ga0495587_0001989 3300046536 Bacteria 13643
252 Ga0495597_0009289 3300046542 Bacteria 4867
253 Ga0495645_0032301 3300046543 Bacteria 3817
254 Ga0495645_0035896 3300046543 Bacteria 3615
255 Ga0495645_0088532 3300046543 Bacteria 2214
256 Ga0495645_0100600 3300046543 Bacteria 2056
257 Ga0495622_0002062 3300046557 Bacteria 9820
258 Ga0495667_0004723 3300046559 Bacteria 9209
259 Ga0495634_0000948 3300046642 Bacteria 27438
260 Ga0495634_0023083 3300046642 Bacteria 4378
261 Ga0495634_0052123 3300046642 Bacteria 2743
262 Ga0495625_0039395 3300046660 Bacteria 3451
263 Ga0495635_0009602 3300046663 Bacteria 6764
264 Ga0495635_0086084 3300046663 Bacteria 2150
265 Ga0495635_0168363 3300046663 Bacteria 1490
266 Ga0495588_0013619 3300046674 Bacteria 3877
267 Ga0495657_0001737 3300046675 Bacteria 18655
268 Ga0495657_0004339 3300046675 Bacteria 11332
269 Ga0495657_0026685 3300046675 Bacteria 4087
270 Ga0495657_0087582 3300046675 Bacteria 2003
271 Ga0495599_0052347 3300046678 Bacteria 2557
272 Ga0495599_0075223 3300046678 Bacteria 2109
273 Ga0495623_0054695 3300046679 Bacteria 2517
274 Ga0495646_0002198 3300046680 Bacteria 11879
275 Ga0495613_0000794 3300046689 Bacteria 24570
276 Ga0495613_0003419 3300046689 Bacteria 11862
277 Ga0495613_0039700 3300046689 Bacteria 3489
278 Ga0495613_0039870 3300046689 Bacteria 3480
279 Ga0495613_0053026 3300046689 Bacteria 2985
280 Ga0495613_0097396 3300046689 Bacteria 2126
281 Ga0495613_0125303 3300046689 Bacteria 1843
282 Ga0495624_0019552 3300046690 Bacteria 4518
283 Ga0495624_0026080 3300046690 Bacteria 3832
284 Ga0495624_0041569 3300046690 Bacteria 2939
285 Ga0495670_0008044 3300046691 Bacteria 5184
286 Ga0495671_0087521 3300046692 Bacteria 1526
287 Ga0495589_0098347 3300046794 Bacteria 1417
288 Ga0495589_0122019 3300046794 Bacteria 1254
289 Ga0495600_0003273 3300046809 Bacteria 9488
290 Ga0495600_0004938 3300046809 Bacteria 8009
291 Ga0495600_0114553 3300046809 Bacteria 1755
292 Ga0495581_0002299 3300047315 Bacteria 10757
293 Ga0495581_0002775 3300047315 Bacteria 9983
294 Ga0495581_0019034 3300047315 Bacteria 3985
295 Ga0495581_0054978 3300047315 Bacteria 2298
296 Ga0495581_0185453 3300047315 Bacteria 1217
297 Ga0495604_0011850 3300047317 Bacteria 6935
298 Ga0495604_0014338 3300047317 Bacteria 6321
299 Ga0495604_0046981 3300047317 Bacteria 3364
300 Ga0495604_0082023 3300047317 Bacteria 2412
301 Ga0495674_0038651 3300047319 Bacteria 4282
302 Ga0495674_0063624 3300047319 Bacteria 3209
303 Ga0495674_0105839 3300047319 Bacteria 2389
304 Ga0495674_0115657 3300047319 Bacteria 2270
305 Ga0495674_0257805 3300047319 Bacteria 1433
306 Ga0495676_0031958 3300047321 Bacteria 4447
307 Ga0495680_0050328 3300047322 Bacteria 3258
308 Ga0495680_0114952 3300047322 Bacteria 1991
309 Ga0495680_0166939 3300047322 Bacteria 1595
310 Ga0495683_0001104 3300047323 Bacteria 18634
311 Ga0495683_0031813 3300047323 Bacteria 2688
312 Ga0495687_004628 3300047443 Bacteria 9190
313 Ga0495687_009235 3300047443 Bacteria 5539
314 Ga0495687_018725 3300047443 Bacteria 3414
315 Ga0495687_020517 3300047443 Bacteria 3217
316 Ga0495687_030710 3300047443 Bacteria 2472
317 Ga0495675_0034418 3300047444 Bacteria 3234
318 Ga0495675_0087375 3300047444 Bacteria 1959
319 Ga0495675_0100035 3300047444 Bacteria 1815
320 Ga0495675_0112115 3300047444 Bacteria 1702
321 Ga0495675_0138677 3300047444 Bacteria 1508
322 Ga0495685_000495 3300047447 Bacteria 12193
323 Ga0495685_006083 3300047447 Bacteria 3948
324 Ga0495681_0010445 3300047470 Bacteria 5619
325 Ga0495684_0003882 3300047471 Bacteria 11647
326 Ga0495684_0011720 3300047471 Bacteria 6768
327 Ga0495593_0000756 3300047673 Bacteria 18734
328 Ga0495593_0001906 3300047673 Bacteria 12433
329 Ga0495602_0101306 3300048088 Bacteria 2362
330 Ga0495602_0302396 3300048088 Bacteria 1170
331 Ga0495614_0001683 3300048089 Bacteria 9652
332 Ga0495614_0013317 3300048089 Bacteria 3607
333 Ga0495614_0035026 3300048089 Bacteria 2157
334 Ga0495614_0039702 3300048089 Bacteria 2020
335 Ga0496106_0021662 3300048909 Bacteria 4772
336 Ga0496108_0021972 3300048911 Bacteria 5244
337 Ga0496109_0038411 3300048912 Bacteria 4328
338 Ga0496110_0045435 3300048913 Bacteria 3839
339 Ga0496111_0027963 3300048914 Bacteria 3994
340 Ga0496113_0038813 3300048916 Bacteria 3502
341 Ga0496115_0058164 3300048918 Bacteria 3110
342 Ga0496126_0019794 3300048929 Bacteria 6622
343 Ga0501033_0204392 3300049570 Bacteria 1410
344 Ga0501036_0271633 3300049572 Bacteria 1419
345 Ga0501040_0040169 3300049576 Bacteria 3183
346 Ga0501040_0297498 3300049576 Bacteria 1154
347 Ga0501043_0169450 3300049579 Bacteria 1704
348 Ga0501046_0104195 3300049580 Bacteria 2174
349 Ga0501047_0017546 3300049581 Bacteria 6857
350 Ga0501048_0112525 3300049582 Bacteria 1922
351 Ga0501048_0148176 3300049582 Bacteria 1660
352 Ga0501068_0092309 3300049584 Bacteria 1869
353 Ga0501070_0072583 3300049586 Bacteria 2849
354 Ga0501072_0006432 3300049588 Bacteria 8950
355 Ga0501076_0056224 3300049592 Bacteria 3122
356 Ga0501077_0051500 3300049593 Bacteria 2616
357 Ga0501079_0136687 3300049741 Bacteria 1908
358 Ga0501081_0025674 3300049743 Bacteria 3966
359 Ga0501083_0100051 3300049744 Bacteria 1912
360 Ga0501035_0015137 3300049822 Bacteria 7119
361 Ga0501035_0067496 3300049822 Bacteria 3173
362 Ga0501044_0009167 3300049823 Bacteria 10809
363 Ga0501045_0018513 3300049824 Bacteria 4955
364 Ga0501045_0210418 3300049824 Bacteria 1449
365 nmdc:mga0n895_51972_c1 3300050512 Bacteria 4022
366 nmdc:mga08x19_34472_c1 3300050514 Bacteria 3200
367 nmdc:mga0a205_100643_c1 3300050515 Bacteria 2789
368 Ga0495601_0033164 3300053077 Bacteria 3216
369 Ga0495612_0003828 3300053078 Bacteria 6250
370 Ga0495612_0061246 3300053078 Bacteria 1559
371 Ga0495595_0000677 3300053084 Bacteria 13048
372 Ga0495595_0009834 3300053084 Bacteria 3965
373 Ga0495619_0008240 3300053085 Bacteria 6595
374 Ga0500569_008507 3300053109 Bacteria 2349
375 Ga0500580_045801 3300053113 Bacteria 1847
376 Ga0500628_003943 3300053129 Bacteria 2449
377 Ga0500652_002635 3300053131 Bacteria 5419
378 Ga0500658_0005655 3300053134 Bacteria 4651
379 Ga0500616_0109736 3300053153 Bacteria 1334
380 Ga0500633_0000792 3300053160 Bacteria 5388
381 Ga0500587_003566 3300053739 Bacteria 2169
382 Ga0501084_0059552 3300054114 Bacteria 3196
383 Ga0501082_0217502 3300060353 Bacteria 1662
384 2547411995 2547132111 Bacteria 8013147
385 2585315169 2582581314 Bacteria 11452267
386 2616699618 2616644814 Bacteria 11555299
387 2786667411 2786546132 Bacteria 10419719
388 2808845914 2808606359 Bacteria 9866990
389 2808917665 2808606375 Bacteria 9466072
390 2917736953 2917736166 Bacteria 9690793
391 2919470732 2919468124 Bacteria 9133025
392 2954673564 2954673503 Bacteria 9685905
393 2954690426 2954682443 Bacteria 9862841
394 2954712637 2954711539 Bacteria 10867210
395 2954722594 2954721474 Bacteria 10456478
396 2954739266 2954731030 Bacteria 10243860
397 2954741473 2954740390 Bacteria 10229294
398 2954758094 2954749733 Bacteria 10366972
399 2954760487 2954759201 Bacteria 9358192
400 8056831294 8056829672 Bacteria 9045328
401 Ga0070706_100029507
402 Ga0070682_100039370
403 Ga0068868_100134001
404 Ga0070709_10001484
405 Ga0070709_10105580
406 Ga0070709_10141338
407 Ga0070714_100023094
408 Ga0070714_100029459
409 Ga0070714_100167188
410 Ga0070714_100302504
411 Ga0070714_100424189
412 Ga0070713_100014044
413 Ga0070710_10001100
414 Ga0070710_10013436
415 Ga0070710_10106573
416 Ga0070710_10212268
417 Ga0070711_100035929
418 Ga0070711_100163083
419 Ga0070711_100185370
420 Ga0070708_100124811
421 Ga0070678_100007181
422 Ga0070706_100002901
423 Ga0070706_100063659
424 Ga0070706_100094175
425 Ga0070707_100000166
426 Ga0070707_100011896
427 Ga0070707_100016513
428 Ga0070698_100000006
429 Ga0070698_100020871
430 Ga0070698_100098889
431 Ga0070679_100224063
432 Ga0070684_100169977
433 Ga0070697_100007934
434 Ga0070697_100036703
435 Ga0070665_100191364
436 Ga0068855_100579506
437 Ga0068856_100033391
438 Ga0068856_100240332
439 Ga0068859_100633277
440 Ga0081455_10116640
441 Ga0070717_10046333
442 Ga0070717_10060223
443 Ga0070717_10391484
444 Ga0070716_100000846
445 Ga0070712_100001434
446 Ga0070712_100038599
447 Ga0070712_100050582
448 Ga0070712_100050894
449 Ga0070712_100052584
450 Ga0068871_100009662
451 Ga0075428_100000450
452 Ga0075433_10024155
453 Ga0075434_100001250
454 Ga0075436_100006875
455 Ga0097620_100633306
456 Ga0105247_10035633
457 Ga0105241_10012709
458 Ga0105242_10547268
459 Ga0105248_10047818
460 Ga0105237_10203820
461 Ga0105238_10120936
462 Ga0105239_10169794
463 Ga0157369_10262921
464 Ga0157374_10309181
465 Ga0157378_10129230
466 Ga0157375_10037893
467 Ga0157379_10066520
468 Ga0157376_10004270
469 Ga0207692_10000294
470 Ga0207692_10046431
471 Ga0207692_10114957
472 Ga0207692_10204710
473 Ga0207710_10019108
474 Ga0207699_10139739
475 Ga0207699_10228222
476 Ga0207684_10002440
477 Ga0207684_10013843
478 Ga0207684_10043924
479 Ga0207684_10054153
480 Ga0207684_10291773
481 Ga0207671_10175698
482 Ga0207693_10051063
483 Ga0207693_10054650
484 Ga0207693_10070988
485 Ga0207663_10018409
486 Ga0207663_10037133
487 Ga0207652_10133895
488 Ga0207646_10000049
489 Ga0207646_10001629
490 Ga0207646_10021297
491 Ga0207700_10002241
492 Ga0207700_10004441
493 Ga0207700_10029942
494 Ga0207700_10084354
495 Ga0207700_10251693
496 Ga0207664_10001824
497 Ga0207664_10016800
498 Ga0207664_10022938
499 Ga0207664_10027979
500 Ga0207665_10000940
501 Ga0207689_10303752
502 Ga0207702_10022901
503 Ga0207702_10041850
504 Ga0207683_10030860
505 Ga0268266_10213668
506 Ga0265337_1000377
507 Ga0265326_10000999
508 Ga0265334_10001075
509 Ga0265336_10001880
510 Ga0265336_10006331
511 Ga0265336_10012321
512 Ga0307517_10048402
513 Ga0307515_10026647
514 Ga0307515_10084317
515 Ga0265338_10003014
516 Ga0265338_10007749
517 Ga0265338_10072167
518 Ga0265324_10006541
519 Ga0307511_10002580
520 Ga0265332_10005192
521 Ga0265320_10020253
522 Ga0265325_10004192
523 Ga0265340_10005027
524 Ga0265339_10009861
525 Ga0265316_10013754
526 Ga0307513_10018194
527 Ga0307509_10004570
528 Ga0307509_10014847
529 Ga0307508_10028550
530 Ga0307514_10033977
531 Ga0265342_10008936
532 Ga0307516_10117000
533 Ga0307518_10061030
534 Ga0307507_10180775
535 Ga0307510_10004499
536 Ga0373926_0019615
537 Ga0373926_0045479
538 Ga0373934_0020967
539 Ga0373934_0030004
540 Ga0373944_0002013
541 Ga0373944_0028181
542 Ga0373923_0002792
543 Ga0373923_0035787
544 Ga0373923_0074474
545 Ga0373936_0013730
546 Ga0373936_0042101
547 Ga0373945_0000861
548 Ga0373953_0038710
549 Ga0373954_0029836
550 Ga0373954_0043933
551 Ga0373954_0116796
552 Ga0373956_0075725
553 Ga0373957_0004512
554 Ga0373946_0000034
555 Ga0373946_0000467
556 Ga0373946_0054373
557 Ga0373955_0022935
558 Ga0373955_0220218
559 Ga0373924_0016708
560 Ga0373924_0017693
561 Ga0373935_0000871
562 Ga0373935_0004623
563 Ga0373935_0018963
564 Ga0373927_0000594
565 Ga0373933_0011023
566 Ga0373933_0049711
567 Ga0373933_0207924
568 Ga0373947_0000001
569 Ga0373947_0008882
570 Ga0373947_0120537
571 Ga0373937_0014234
572 Ga0372808_010510
573 Ga0373925_0008123
574 Ga0395898_0239860
575 Ga0436364_0229196
576 Ga0436364_0613092
577 Ga0395901_0078778
578 Ga0436360_0320843
579 Ga0436361_1211156
580 Ga0436363_1454820
581 Ga0439448_0048365
582 Ga0450903_000341
583 Ga0439458_0000336
584 Ga0466963_0069319
585 Ga0466968_0036100
586 Ga0466959_0151364
587 Ga0466967_0022583
588 Ga0466967_0239424
589 Ga0495627_057432
590 Ga0495592_0030894
591 Ga0495592_0080101
592 Ga0495592_0129532
593 Ga0495592_0150070
594 Ga0495592_0241171
595 Ga0495603_0001880
596 Ga0495603_0010380
597 Ga0495629_0002265
598 Ga0495629_0003925
599 Ga0495629_0025475
600 Ga0495629_0033792
601 Ga0495629_0038384
602 Ga0495641_0002211
603 Ga0495641_0008628
604 Ga0495641_0016721
605 Ga0495651_0001067
606 Ga0495651_0021268
607 Ga0495653_0003019
608 Ga0495653_0005723
609 Ga0495580_0040735
610 Ga0495580_0101044
611 Ga0495582_0004205
612 Ga0495582_0019526
613 Ga0495582_0109492
614 Ga0495662_0002921
615 Ga0495662_0015480
616 Ga0495664_0062572
617 Ga0495664_0134905
618 Ga0495664_0146000
619 Ga0495664_0176167
620 Ga0495585_0004755
621 Ga0495585_0110265
622 Ga0495594_0053674
623 Ga0495594_0075180
624 Ga0495608_0011925
625 Ga0495608_0035745
626 Ga0495608_0072329
627 Ga0495608_0103601
628 Ga0495616_0096470
629 Ga0495618_0019854
630 Ga0495618_0022197
631 Ga0495618_0165059
632 Ga0495620_0014027
633 Ga0495628_0024917
634 Ga0495628_0041668
635 Ga0495628_0168586
636 Ga0495630_0129481
637 Ga0495630_0148606
638 Ga0495643_0005031
639 Ga0495643_0010828
640 Ga0495648_0039110
641 Ga0495652_0061010
642 Ga0495652_0087222
643 Ga0495652_0187490
644 Ga0495665_0013999
645 Ga0495640_0012981
646 Ga0495640_0024879
647 Ga0495586_0010026
648 Ga0495586_0126288
649 Ga0495586_0161235
650 Ga0495586_0185770
651 Ga0495587_0001989
652 Ga0495597_0009289
653 Ga0495645_0032301
654 Ga0495645_0035896
655 Ga0495645_0088532
656 Ga0495645_0100600
657 Ga0495622_0002062
658 Ga0495667_0004723
659 Ga0495634_0000948
660 Ga0495634_0023083
661 Ga0495634_0052123
662 Ga0495625_0039395
663 Ga0495635_0009602
664 Ga0495635_0086084
665 Ga0495635_0168363
666 Ga0495588_0013619
667 Ga0495657_0001737
668 Ga0495657_0004339
669 Ga0495657_0026685
670 Ga0495657_0087582
671 Ga0495599_0052347
672 Ga0495599_0075223
673 Ga0495623_0054695
674 Ga0495646_0002198
675 Ga0495613_0000794
676 Ga0495613_0003419
677 Ga0495613_0039700
678 Ga0495613_0039870
679 Ga0495613_0053026
680 Ga0495613_0097396
681 Ga0495613_0125303
682 Ga0495624_0019552
683 Ga0495624_0026080
684 Ga0495624_0041569
685 Ga0495670_0008044
686 Ga0495671_0087521
687 Ga0495589_0098347
688 Ga0495589_0122019
689 Ga0495600_0003273
690 Ga0495600_0004938
691 Ga0495600_0114553
692 Ga0495581_0002299
693 Ga0495581_0002775
694 Ga0495581_0019034
695 Ga0495581_0054978
696 Ga0495581_0185453
697 Ga0495604_0011850
698 Ga0495604_0014338
699 Ga0495604_0046981
700 Ga0495604_0082023
701 Ga0495674_0038651
702 Ga0495674_0063624
703 Ga0495674_0105839
704 Ga0495674_0115657
705 Ga0495674_0257805
706 Ga0495676_0031958
707 Ga0495680_0050328
708 Ga0495680_0114952
709 Ga0495680_0166939
710 Ga0495683_0001104
711 Ga0495683_0031813
712 Ga0495687_004628
713 Ga0495687_009235
714 Ga0495687_018725
715 Ga0495687_020517
716 Ga0495687_030710
717 Ga0495675_0034418
718 Ga0495675_0087375
719 Ga0495675_0100035
720 Ga0495675_0112115
721 Ga0495675_0138677
722 Ga0495685_000495
723 Ga0495685_006083
724 Ga0495681_0010445
725 Ga0495684_0003882
726 Ga0495684_0011720
727 Ga0495593_0000756
728 Ga0495593_0001906
729 Ga0495602_0101306
730 Ga0495602_0302396
731 Ga0495614_0001683
732 Ga0495614_0013317
733 Ga0495614_0035026
734 Ga0495614_0039702
735 Ga0496106_0021662
736 Ga0496108_0021972
737 Ga0496109_0038411
738 Ga0496110_0045435
739 Ga0496111_0027963
740 Ga0496113_0038813
741 Ga0496115_0058164
742 Ga0496126_0019794
743 Ga0501033_0204392
744 Ga0501036_0271633
745 Ga0501040_0040169
746 Ga0501040_0297498
747 Ga0501043_0169450
748 Ga0501046_0104195
749 Ga0501047_0017546
750 Ga0501048_0112525
751 Ga0501048_0148176
752 Ga0501068_0092309
753 Ga0501070_0072583
754 Ga0501072_0006432
755 Ga0501076_0056224
756 Ga0501077_0051500
757 Ga0501079_0136687
758 Ga0501081_0025674
759 Ga0501083_0100051
760 Ga0501035_0015137
761 Ga0501035_0067496
762 Ga0501044_0009167
763 Ga0501045_0018513
764 Ga0501045_0210418
765 nmdc:mga0n895_51972_c1
766 nmdc:mga08x19_34472_c1
767 nmdc:mga0a205_100643_c1
768 Ga0495601_0033164
769 Ga0495612_0003828
770 Ga0495612_0061246
771 Ga0495595_0000677
772 Ga0495595_0009834
773 Ga0495619_0008240
774 Ga0500569_008507
775 Ga0500580_045801
776 Ga0500628_003943
777 Ga0500652_002635
778 Ga0500658_0005655
779 Ga0500616_0109736
780 Ga0500633_0000792
781 Ga0500587_003566
782 Ga0501084_0059552
783 Ga0501082_0217502
784 2547411995
785 2585315169
786 2616699618
787 2786667411
788 2808845914
789 2808917665
790 2917736953
791 2919470732
792 2954673564
793 2954690426
794 2954712637
795 2954722594
796 2954739266
797 2954741473
798 2954758094
799 2954760487
800 8056831294

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00185

OTCace

Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain

168

343

0.98

PF02729

OTCace_N

Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain

16

156

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vlv-assembly1.cif.gz_A crystal structure of ornithine carbamoyltransferase (tm1097) from thermotoga maritima at 2.25 a resolution 0.9795 2 328
4jhx-assembly1.cif.gz_B crystal structure of anabolic ornithine carbamoyltransferase from vibrio vulnificus in complex with carbamoylphosphate and arginine 0.9768 1 330
1dxh-assembly1.cif.gz_A catabolic ornithine carbamoyltransferase from pseudomonas aeruginosa 0.9768 1 332
4jhx-assembly1.cif.gz_C crystal structure of anabolic ornithine carbamoyltransferase from vibrio vulnificus in complex with carbamoylphosphate and arginine 0.9767 1 330
7tmd-assembly1.cif.gz_A crystal structure of ornithine carbamoyltransferase from klebsiella pneumoniae 0.9762 3 330
ID Description Score Start End Superfamily
af_Q2FUX8_12_142_3.40.50.1370 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Aspartate/ornithine carbamoyltransferase 0.9889 5 134 3.40.50.1370
4anfC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Aspartate/ornithine carbamoyltransferase 0.983 2 146 3.40.50.1370
af_Q2FZB0_134_265_3.40.50.1370 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Aspartate/ornithine carbamoyltransferase 0.98 133 264 3.40.50.1370
af_Q2FUX8_160_269_3.40.50.1370 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Aspartate/ornithine carbamoyltransferase 0.9754 155 264 3.40.50.1370
af_A0A1D6HKQ0_55_115_3.40.50.1370 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Aspartate/ornithine carbamoyltransferase 0.9752 82 140 3.40.50.1370
ID Description Score Start End GO Terms
AF-A0A7X8YAG1-F1-model_v4 Ornithine carbamoyltransferase 0.9929 127 331 GO:0004585
GO:0016597
GO:0019240
GO:0042450
AF-A0A117R7C7-F1-model_v4 Ornithine carbamoyltransferase (OTCase) (EC 2.1.3.3) 0.9925 1 331 GO:0004585
GO:0005737
GO:0016597
GO:0019240
GO:0042450
AF-A0A454W7Z1-F1-model_v4 Ornithine carbamoyltransferase (OTCase) (EC 2.1.3.3) 0.9925 1 331 GO:0004585
GO:0005737
GO:0016597
GO:0019240
GO:0042450
AF-A0A397M5A2-F1-model_v4 deleted 0.9924 1 331
AF-A0A1Q4V696-F1-model_v4 Ornithine carbamoyltransferase (OTCase) (EC 2.1.3.3) 0.9923 1 332 GO:0004585
GO:0005737
GO:0016597
GO:0019240
GO:0042450

Map