F434521
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 400 | 233 | 800 | 333 |
Family's Representative Sequence
| Representative Sequence | 3300005467|Ga0070706_100029507|Ga0070706_1000295074 |
| Length | 348 |
| Sequence | MNLHAQTMNSSRLRGRSLLKEIDLTADEFLYLVDLGDRARRAKEMGFHQHRLAGRNIALIFEKASTRTRSAFEVAAHDEGAHVTYIGPDESQLGYKESMKDTARVLGRMYDGIEYRGSSQEAVEILGAHAGVPVWNGLTDTWHPTQMLADVLTMRDCIAADHPRRRLRDVTLCYLGDGRNNVADSLLVTGAMLGMDVRICTADALQPPAAVWEIAARLAEDSGSRLTITDEVAAGVRGADFLYTDVWLSMGEPAGDWDKRIDQLLPYQVNAEVMAATGNPDVRFMHCLPALHNRETEIGRQVYERRGLEALEVTEEVFESPQSVVFEQAANRMHTIKALMVATIGVRE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 2 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 4 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 5 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 7 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 8 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 18 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 19 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 20 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 21 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 25 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 26 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 27 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 28 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 29 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 60 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 61 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 62 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 63 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 64 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 65 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 66 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 67 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 68 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 69 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 70 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 71 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 72 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 73 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 74 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 75 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 76 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 77 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 78 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 79 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 80 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 81 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 82 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 83 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 84 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 85 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 86 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 87 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 88 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 89 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 90 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 91 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 92 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 93 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 94 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 95 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 96 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 97 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 98 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 99 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 100 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 101 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 102 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 103 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 104 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 105 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 106 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 107 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 108 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 109 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 110 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 111 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 112 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 113 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 114 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 115 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 116 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 175 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 177 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 178 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 179 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 180 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 181 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 182 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 201 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 202 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 203 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 208 | 3300053113 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere | Metagenome | Endosphere |
| 209 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 210 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 211 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 212 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 213 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 214 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 215 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 217 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 218 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 219 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 220 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 221 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 222 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 223 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 224 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 225 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 226 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 227 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 228 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 229 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 230 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 231 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 232 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 233 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.5 |
| Metatranscriptomes | 0.25 |
| Isolates | 4.25 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2 |
| Nodule | 0 |
| Rhizoplane | 1.75 |
| Rhizosphere | 90.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070706_100029507 | 3300005467 | Bacteria | 5054 |
| 2 | Ga0070682_100039370 | 3300005337 | Bacteria | 2905 |
| 3 | Ga0068868_100134001 | 3300005338 | Bacteria | 2029 |
| 4 | Ga0070709_10001484 | 3300005434 | Bacteria | 12666 |
| 5 | Ga0070709_10105580 | 3300005434 | Bacteria | 1884 |
| 6 | Ga0070709_10141338 | 3300005434 | Bacteria | 1654 |
| 7 | Ga0070714_100023094 | 3300005435 | Bacteria | 5106 |
| 8 | Ga0070714_100029459 | 3300005435 | Bacteria | 4563 |
| 9 | Ga0070714_100167188 | 3300005435 | Bacteria | 1994 |
| 10 | Ga0070714_100302504 | 3300005435 | Bacteria | 1491 |
| 11 | Ga0070714_100424189 | 3300005435 | Bacteria | 1260 |
| 12 | Ga0070713_100014044 | 3300005436 | Bacteria | 5930 |
| 13 | Ga0070710_10001100 | 3300005437 | Bacteria | 12801 |
| 14 | Ga0070710_10013436 | 3300005437 | Bacteria | 4102 |
| 15 | Ga0070710_10106573 | 3300005437 | Bacteria | 1677 |
| 16 | Ga0070710_10212268 | 3300005437 | Bacteria | 1227 |
| 17 | Ga0070711_100035929 | 3300005439 | Bacteria | 3317 |
| 18 | Ga0070711_100163083 | 3300005439 | Bacteria | 1691 |
| 19 | Ga0070711_100185370 | 3300005439 | Bacteria | 1595 |
| 20 | Ga0070708_100124811 | 3300005445 | Bacteria | 2378 |
| 21 | Ga0070678_100007181 | 3300005456 | Bacteria | 6590 |
| 22 | Ga0070706_100002901 | 3300005467 | Bacteria | 17066 |
| 23 | Ga0070706_100063659 | 3300005467 | Bacteria | 3408 |
| 24 | Ga0070706_100094175 | 3300005467 | Bacteria | 2779 |
| 25 | Ga0070707_100000166 | 3300005468 | Bacteria | 63590 |
| 26 | Ga0070707_100011896 | 3300005468 | Bacteria | 8122 |
| 27 | Ga0070707_100016513 | 3300005468 | Bacteria | 6927 |
| 28 | Ga0070698_100000006 | 3300005471 | Bacteria | 129236 |
| 29 | Ga0070698_100020871 | 3300005471 | Bacteria | 6864 |
| 30 | Ga0070698_100098889 | 3300005471 | Bacteria | 2891 |
| 31 | Ga0070679_100224063 | 3300005530 | Bacteria | 1841 |
| 32 | Ga0070684_100169977 | 3300005535 | Bacteria | 1980 |
| 33 | Ga0070697_100007934 | 3300005536 | Bacteria | 8274 |
| 34 | Ga0070697_100036703 | 3300005536 | Bacteria | 3959 |
| 35 | Ga0070665_100191364 | 3300005548 | Bacteria | 2047 |
| 36 | Ga0068855_100579506 | 3300005563 | Bacteria | 1212 |
| 37 | Ga0068856_100033391 | 3300005614 | Bacteria | 5038 |
| 38 | Ga0068856_100240332 | 3300005614 | Bacteria | 1826 |
| 39 | Ga0068859_100633277 | 3300005617 | Bacteria | 1162 |
| 40 | Ga0081455_10116640 | 3300005937 | Bacteria | 2111 |
| 41 | Ga0070717_10046333 | 3300006028 | Bacteria | 3558 |
| 42 | Ga0070717_10060223 | 3300006028 | Bacteria | 3143 |
| 43 | Ga0070717_10391484 | 3300006028 | Bacteria | 1247 |
| 44 | Ga0070716_100000846 | 3300006173 | Bacteria | 13188 |
| 45 | Ga0070712_100001434 | 3300006175 | Bacteria | 14533 |
| 46 | Ga0070712_100038599 | 3300006175 | Bacteria | 3264 |
| 47 | Ga0070712_100050582 | 3300006175 | Bacteria | 2891 |
| 48 | Ga0070712_100050894 | 3300006175 | Bacteria | 2884 |
| 49 | Ga0070712_100052584 | 3300006175 | Bacteria | 2841 |
| 50 | Ga0068871_100009662 | 3300006358 | Bacteria | 7002 |
| 51 | Ga0075428_100000450 | 3300006844 | Bacteria | 41111 |
| 52 | Ga0075433_10024155 | 3300006852 | Bacteria | 5126 |
| 53 | Ga0075434_100001250 | 3300006871 | Bacteria | 21174 |
| 54 | Ga0075436_100006875 | 3300006914 | Bacteria | 7781 |
| 55 | Ga0097620_100633306 | 3300006931 | Bacteria | 1162 |
| 56 | Ga0105247_10035633 | 3300009101 | Bacteria | 3034 |
| 57 | Ga0105241_10012709 | 3300009174 | Bacteria | 6178 |
| 58 | Ga0105242_10547268 | 3300009176 | Bacteria | 1109 |
| 59 | Ga0105248_10047818 | 3300009177 | Bacteria | 4798 |
| 60 | Ga0105237_10203820 | 3300009545 | Bacteria | 1978 |
| 61 | Ga0105238_10120936 | 3300009551 | Bacteria | 2598 |
| 62 | Ga0105239_10169794 | 3300010375 | Bacteria | 2439 |
| 63 | Ga0157369_10262921 | 3300013105 | Bacteria | 1799 |
| 64 | Ga0157374_10309181 | 3300013296 | Bacteria | 1564 |
| 65 | Ga0157378_10129230 | 3300013297 | Bacteria | 2337 |
| 66 | Ga0157375_10037893 | 3300013308 | Bacteria | 4625 |
| 67 | Ga0157379_10066520 | 3300014968 | Bacteria | 3222 |
| 68 | Ga0157376_10004270 | 3300014969 | Bacteria | 9920 |
| 69 | Ga0207692_10000294 | 3300025898 | Bacteria | 17332 |
| 70 | Ga0207692_10046431 | 3300025898 | Bacteria | 2177 |
| 71 | Ga0207692_10114957 | 3300025898 | Bacteria | 1498 |
| 72 | Ga0207692_10204710 | 3300025898 | Bacteria | 1162 |
| 73 | Ga0207710_10019108 | 3300025900 | Bacteria | 2921 |
| 74 | Ga0207699_10139739 | 3300025906 | Bacteria | 1591 |
| 75 | Ga0207699_10228222 | 3300025906 | Bacteria | 1274 |
| 76 | Ga0207684_10002440 | 3300025910 | Bacteria | 18754 |
| 77 | Ga0207684_10013843 | 3300025910 | Bacteria | 6968 |
| 78 | Ga0207684_10043924 | 3300025910 | Bacteria | 3790 |
| 79 | Ga0207684_10054153 | 3300025910 | Bacteria | 3404 |
| 80 | Ga0207684_10291773 | 3300025910 | Bacteria | 1406 |
| 81 | Ga0207671_10175698 | 3300025914 | Bacteria | 1665 |
| 82 | Ga0207693_10051063 | 3300025915 | Bacteria | 3246 |
| 83 | Ga0207693_10054650 | 3300025915 | Bacteria | 3132 |
| 84 | Ga0207693_10070988 | 3300025915 | Bacteria | 2725 |
| 85 | Ga0207663_10018409 | 3300025916 | Bacteria | 3914 |
| 86 | Ga0207663_10037133 | 3300025916 | Bacteria | 2935 |
| 87 | Ga0207652_10133895 | 3300025921 | Bacteria | 2212 |
| 88 | Ga0207646_10000049 | 3300025922 | Bacteria | 171680 |
| 89 | Ga0207646_10001629 | 3300025922 | Bacteria | 27402 |
| 90 | Ga0207646_10021297 | 3300025922 | Bacteria | 5992 |
| 91 | Ga0207700_10002241 | 3300025928 | Bacteria | 11094 |
| 92 | Ga0207700_10004441 | 3300025928 | Bacteria | 8271 |
| 93 | Ga0207700_10029942 | 3300025928 | Bacteria | 3848 |
| 94 | Ga0207700_10084354 | 3300025928 | Bacteria | 2490 |
| 95 | Ga0207700_10251693 | 3300025928 | Bacteria | 1509 |
| 96 | Ga0207664_10001824 | 3300025929 | Bacteria | 14044 |
| 97 | Ga0207664_10016800 | 3300025929 | Bacteria | 5347 |
| 98 | Ga0207664_10022938 | 3300025929 | Bacteria | 4669 |
| 99 | Ga0207664_10027979 | 3300025929 | Bacteria | 4280 |
| 100 | Ga0207665_10000940 | 3300025939 | Bacteria | 19700 |
| 101 | Ga0207689_10303752 | 3300025942 | Bacteria | 1323 |
| 102 | Ga0207702_10022901 | 3300026078 | Bacteria | 5183 |
| 103 | Ga0207702_10041850 | 3300026078 | Bacteria | 3842 |
| 104 | Ga0207683_10030860 | 3300026121 | Bacteria | 4647 |
| 105 | Ga0268266_10213668 | 3300028379 | Bacteria | 1770 |
| 106 | Ga0265337_1000377 | 3300028556 | Bacteria | 23918 |
| 107 | Ga0265326_10000999 | 3300028558 | Bacteria | 10160 |
| 108 | Ga0265334_10001075 | 3300028573 | Bacteria | 13356 |
| 109 | Ga0265336_10001880 | 3300028666 | Bacteria | 9079 |
| 110 | Ga0265336_10006331 | 3300028666 | Bacteria | 4276 |
| 111 | Ga0265336_10012321 | 3300028666 | Bacteria | 2880 |
| 112 | Ga0307517_10048402 | 3300028786 | Bacteria | 4374 |
| 113 | Ga0307515_10026647 | 3300028794 | Bacteria | 9933 |
| 114 | Ga0307515_10084317 | 3300028794 | Bacteria | 4083 |
| 115 | Ga0265338_10003014 | 3300028800 | Bacteria | 24307 |
| 116 | Ga0265338_10007749 | 3300028800 | Bacteria | 13213 |
| 117 | Ga0265338_10072167 | 3300028800 | Bacteria | 2949 |
| 118 | Ga0265324_10006541 | 3300029957 | Bacteria | 4838 |
| 119 | Ga0307511_10002580 | 3300030521 | Bacteria | 18930 |
| 120 | Ga0265332_10005192 | 3300031238 | Bacteria | 6025 |
| 121 | Ga0265320_10020253 | 3300031240 | Bacteria | 3610 |
| 122 | Ga0265325_10004192 | 3300031241 | Bacteria | 9161 |
| 123 | Ga0265340_10005027 | 3300031247 | Bacteria | 7355 |
| 124 | Ga0265339_10009861 | 3300031249 | Bacteria | 5966 |
| 125 | Ga0265316_10013754 | 3300031344 | Bacteria | 7171 |
| 126 | Ga0307513_10018194 | 3300031456 | Bacteria | 8407 |
| 127 | Ga0307509_10004570 | 3300031507 | Bacteria | 19849 |
| 128 | Ga0307509_10014847 | 3300031507 | Bacteria | 9130 |
| 129 | Ga0307508_10028550 | 3300031616 | Bacteria | 5043 |
| 130 | Ga0307514_10033977 | 3300031649 | Bacteria | 4065 |
| 131 | Ga0265342_10008936 | 3300031712 | Bacteria | 7116 |
| 132 | Ga0307516_10117000 | 3300031730 | Bacteria | 2460 |
| 133 | Ga0307518_10061030 | 3300031838 | Bacteria | 2738 |
| 134 | Ga0307507_10180775 | 3300033179 | Bacteria | 1508 |
| 135 | Ga0307510_10004499 | 3300033180 | Bacteria | 16395 |
| 136 | Ga0373926_0019615 | 3300035083 | Bacteria | 2331 |
| 137 | Ga0373926_0045479 | 3300035083 | Bacteria | 1574 |
| 138 | Ga0373934_0020967 | 3300035086 | Bacteria | 2515 |
| 139 | Ga0373934_0030004 | 3300035086 | Bacteria | 2125 |
| 140 | Ga0373944_0002013 | 3300035089 | Bacteria | 5154 |
| 141 | Ga0373944_0028181 | 3300035089 | Bacteria | 1670 |
| 142 | Ga0373923_0002792 | 3300035111 | Bacteria | 5467 |
| 143 | Ga0373923_0035787 | 3300035111 | Bacteria | 2023 |
| 144 | Ga0373923_0074474 | 3300035111 | Bacteria | 1463 |
| 145 | Ga0373936_0013730 | 3300035113 | Bacteria | 3091 |
| 146 | Ga0373936_0042101 | 3300035113 | Bacteria | 1832 |
| 147 | Ga0373945_0000861 | 3300035116 | Bacteria | 8944 |
| 148 | Ga0373953_0038710 | 3300035117 | Bacteria | 1887 |
| 149 | Ga0373954_0029836 | 3300035118 | Bacteria | 2514 |
| 150 | Ga0373954_0043933 | 3300035118 | Bacteria | 2084 |
| 151 | Ga0373954_0116796 | 3300035118 | Bacteria | 1293 |
| 152 | Ga0373956_0075725 | 3300035119 | Bacteria | 1539 |
| 153 | Ga0373957_0004512 | 3300035120 | Bacteria | 4238 |
| 154 | Ga0373946_0000034 | 3300035171 | Bacteria | 36345 |
| 155 | Ga0373946_0000467 | 3300035171 | Bacteria | 13372 |
| 156 | Ga0373946_0054373 | 3300035171 | Bacteria | 1685 |
| 157 | Ga0373955_0022935 | 3300035172 | Bacteria | 3173 |
| 158 | Ga0373955_0220218 | 3300035172 | Bacteria | 1133 |
| 159 | Ga0373924_0016708 | 3300035410 | Bacteria | 2805 |
| 160 | Ga0373924_0017693 | 3300035410 | Bacteria | 2737 |
| 161 | Ga0373935_0000871 | 3300035692 | Bacteria | 16284 |
| 162 | Ga0373935_0004623 | 3300035692 | Bacteria | 8088 |
| 163 | Ga0373935_0018963 | 3300035692 | Bacteria | 4193 |
| 164 | Ga0373927_0000594 | 3300035695 | Bacteria | 27587 |
| 165 | Ga0373933_0011023 | 3300035724 | Bacteria | 4966 |
| 166 | Ga0373933_0049711 | 3300035724 | Bacteria | 2501 |
| 167 | Ga0373933_0207924 | 3300035724 | Bacteria | 1253 |
| 168 | Ga0373947_0000001 | 3300035725 | Bacteria | 510932 |
| 169 | Ga0373947_0008882 | 3300035725 | Bacteria | 5782 |
| 170 | Ga0373947_0120537 | 3300035725 | Bacteria | 1666 |
| 171 | Ga0373937_0014234 | 3300036401 | Bacteria | 7021 |
| 172 | Ga0372808_010510 | 3300036459 | Bacteria | 1303 |
| 173 | Ga0373925_0008123 | 3300037068 | Bacteria | 7643 |
| 174 | Ga0395898_0239860 | 3300037466 | Bacteria | 1729 |
| 175 | Ga0436364_0229196 | 3300037853 | Bacteria | 3301 |
| 176 | Ga0436364_0613092 | 3300037853 | Bacteria | 1166 |
| 177 | Ga0395901_0078778 | 3300038443 | Bacteria | 3441 |
| 178 | Ga0436360_0320843 | 3300039438 | Bacteria | 1577 |
| 179 | Ga0436361_1211156 | 3300039447 | Bacteria | 1354 |
| 180 | Ga0436363_1454820 | 3300039450 | Bacteria | 4587 |
| 181 | Ga0439448_0048365 | 3300042005 | Bacteria | 1388 |
| 182 | Ga0450903_000341 | 3300042138 | Bacteria | 10267 |
| 183 | Ga0439458_0000336 | 3300042157 | Bacteria | 11755 |
| 184 | Ga0466963_0069319 | 3300044694 | Bacteria | 2370 |
| 185 | Ga0466968_0036100 | 3300044735 | Bacteria | 2070 |
| 186 | Ga0466959_0151364 | 3300045049 | Bacteria | 1635 |
| 187 | Ga0466967_0022583 | 3300045976 | Bacteria | 5137 |
| 188 | Ga0466967_0239424 | 3300045976 | Bacteria | 1731 |
| 189 | Ga0495627_057432 | 3300046453 | Bacteria | 1158 |
| 190 | Ga0495592_0030894 | 3300046454 | Bacteria | 4052 |
| 191 | Ga0495592_0080101 | 3300046454 | Bacteria | 2363 |
| 192 | Ga0495592_0129532 | 3300046454 | Bacteria | 1766 |
| 193 | Ga0495592_0150070 | 3300046454 | Bacteria | 1613 |
| 194 | Ga0495592_0241171 | 3300046454 | Bacteria | 1199 |
| 195 | Ga0495603_0001880 | 3300046455 | Bacteria | 12386 |
| 196 | Ga0495603_0010380 | 3300046455 | Bacteria | 5639 |
| 197 | Ga0495629_0002265 | 3300046459 | Bacteria | 14832 |
| 198 | Ga0495629_0003925 | 3300046459 | Bacteria | 11185 |
| 199 | Ga0495629_0025475 | 3300046459 | Bacteria | 4203 |
| 200 | Ga0495629_0033792 | 3300046459 | Bacteria | 3616 |
| 201 | Ga0495629_0038384 | 3300046459 | Bacteria | 3373 |
| 202 | Ga0495641_0002211 | 3300046461 | Bacteria | 15517 |
| 203 | Ga0495641_0008628 | 3300046461 | Bacteria | 6174 |
| 204 | Ga0495641_0016721 | 3300046461 | Bacteria | 3854 |
| 205 | Ga0495651_0001067 | 3300046462 | Bacteria | 21168 |
| 206 | Ga0495651_0021268 | 3300046462 | Bacteria | 5041 |
| 207 | Ga0495653_0003019 | 3300046463 | Bacteria | 13492 |
| 208 | Ga0495653_0005723 | 3300046463 | Bacteria | 10162 |
| 209 | Ga0495580_0040735 | 3300046472 | Bacteria | 3316 |
| 210 | Ga0495580_0101044 | 3300046472 | Bacteria | 2006 |
| 211 | Ga0495582_0004205 | 3300046473 | Bacteria | 8096 |
| 212 | Ga0495582_0019526 | 3300046473 | Bacteria | 3706 |
| 213 | Ga0495582_0109492 | 3300046473 | Bacteria | 1551 |
| 214 | Ga0495662_0002921 | 3300046476 | Bacteria | 8635 |
| 215 | Ga0495662_0015480 | 3300046476 | Bacteria | 3701 |
| 216 | Ga0495664_0062572 | 3300046477 | Bacteria | 2217 |
| 217 | Ga0495664_0134905 | 3300046477 | Bacteria | 1495 |
| 218 | Ga0495664_0146000 | 3300046477 | Bacteria | 1434 |
| 219 | Ga0495664_0176167 | 3300046477 | Bacteria | 1297 |
| 220 | Ga0495585_0004755 | 3300046492 | Bacteria | 8740 |
| 221 | Ga0495585_0110265 | 3300046492 | Bacteria | 1464 |
| 222 | Ga0495594_0053674 | 3300046499 | Bacteria | 2220 |
| 223 | Ga0495594_0075180 | 3300046499 | Bacteria | 1883 |
| 224 | Ga0495608_0011925 | 3300046511 | Bacteria | 6045 |
| 225 | Ga0495608_0035745 | 3300046511 | Bacteria | 3348 |
| 226 | Ga0495608_0072329 | 3300046511 | Bacteria | 2250 |
| 227 | Ga0495608_0103601 | 3300046511 | Bacteria | 1833 |
| 228 | Ga0495616_0096470 | 3300046513 | Bacteria | 1392 |
| 229 | Ga0495618_0019854 | 3300046514 | Bacteria | 4137 |
| 230 | Ga0495618_0022197 | 3300046514 | Bacteria | 3918 |
| 231 | Ga0495618_0165059 | 3300046514 | Bacteria | 1410 |
| 232 | Ga0495620_0014027 | 3300046515 | Bacteria | 4085 |
| 233 | Ga0495628_0024917 | 3300046516 | Bacteria | 4893 |
| 234 | Ga0495628_0041668 | 3300046516 | Bacteria | 3665 |
| 235 | Ga0495628_0168586 | 3300046516 | Bacteria | 1661 |
| 236 | Ga0495630_0129481 | 3300046517 | Bacteria | 1916 |
| 237 | Ga0495630_0148606 | 3300046517 | Bacteria | 1782 |
| 238 | Ga0495643_0005031 | 3300046522 | Bacteria | 9050 |
| 239 | Ga0495643_0010828 | 3300046522 | Bacteria | 5591 |
| 240 | Ga0495648_0039110 | 3300046524 | Bacteria | 3023 |
| 241 | Ga0495652_0061010 | 3300046529 | Bacteria | 3184 |
| 242 | Ga0495652_0087222 | 3300046529 | Bacteria | 2560 |
| 243 | Ga0495652_0187490 | 3300046529 | Bacteria | 1581 |
| 244 | Ga0495665_0013999 | 3300046531 | Bacteria | 4332 |
| 245 | Ga0495640_0012981 | 3300046533 | Bacteria | 6347 |
| 246 | Ga0495640_0024879 | 3300046533 | Bacteria | 4350 |
| 247 | Ga0495586_0010026 | 3300046535 | Bacteria | 5047 |
| 248 | Ga0495586_0126288 | 3300046535 | Bacteria | 1431 |
| 249 | Ga0495586_0161235 | 3300046535 | Bacteria | 1265 |
| 250 | Ga0495586_0185770 | 3300046535 | Bacteria | 1177 |
| 251 | Ga0495587_0001989 | 3300046536 | Bacteria | 13643 |
| 252 | Ga0495597_0009289 | 3300046542 | Bacteria | 4867 |
| 253 | Ga0495645_0032301 | 3300046543 | Bacteria | 3817 |
| 254 | Ga0495645_0035896 | 3300046543 | Bacteria | 3615 |
| 255 | Ga0495645_0088532 | 3300046543 | Bacteria | 2214 |
| 256 | Ga0495645_0100600 | 3300046543 | Bacteria | 2056 |
| 257 | Ga0495622_0002062 | 3300046557 | Bacteria | 9820 |
| 258 | Ga0495667_0004723 | 3300046559 | Bacteria | 9209 |
| 259 | Ga0495634_0000948 | 3300046642 | Bacteria | 27438 |
| 260 | Ga0495634_0023083 | 3300046642 | Bacteria | 4378 |
| 261 | Ga0495634_0052123 | 3300046642 | Bacteria | 2743 |
| 262 | Ga0495625_0039395 | 3300046660 | Bacteria | 3451 |
| 263 | Ga0495635_0009602 | 3300046663 | Bacteria | 6764 |
| 264 | Ga0495635_0086084 | 3300046663 | Bacteria | 2150 |
| 265 | Ga0495635_0168363 | 3300046663 | Bacteria | 1490 |
| 266 | Ga0495588_0013619 | 3300046674 | Bacteria | 3877 |
| 267 | Ga0495657_0001737 | 3300046675 | Bacteria | 18655 |
| 268 | Ga0495657_0004339 | 3300046675 | Bacteria | 11332 |
| 269 | Ga0495657_0026685 | 3300046675 | Bacteria | 4087 |
| 270 | Ga0495657_0087582 | 3300046675 | Bacteria | 2003 |
| 271 | Ga0495599_0052347 | 3300046678 | Bacteria | 2557 |
| 272 | Ga0495599_0075223 | 3300046678 | Bacteria | 2109 |
| 273 | Ga0495623_0054695 | 3300046679 | Bacteria | 2517 |
| 274 | Ga0495646_0002198 | 3300046680 | Bacteria | 11879 |
| 275 | Ga0495613_0000794 | 3300046689 | Bacteria | 24570 |
| 276 | Ga0495613_0003419 | 3300046689 | Bacteria | 11862 |
| 277 | Ga0495613_0039700 | 3300046689 | Bacteria | 3489 |
| 278 | Ga0495613_0039870 | 3300046689 | Bacteria | 3480 |
| 279 | Ga0495613_0053026 | 3300046689 | Bacteria | 2985 |
| 280 | Ga0495613_0097396 | 3300046689 | Bacteria | 2126 |
| 281 | Ga0495613_0125303 | 3300046689 | Bacteria | 1843 |
| 282 | Ga0495624_0019552 | 3300046690 | Bacteria | 4518 |
| 283 | Ga0495624_0026080 | 3300046690 | Bacteria | 3832 |
| 284 | Ga0495624_0041569 | 3300046690 | Bacteria | 2939 |
| 285 | Ga0495670_0008044 | 3300046691 | Bacteria | 5184 |
| 286 | Ga0495671_0087521 | 3300046692 | Bacteria | 1526 |
| 287 | Ga0495589_0098347 | 3300046794 | Bacteria | 1417 |
| 288 | Ga0495589_0122019 | 3300046794 | Bacteria | 1254 |
| 289 | Ga0495600_0003273 | 3300046809 | Bacteria | 9488 |
| 290 | Ga0495600_0004938 | 3300046809 | Bacteria | 8009 |
| 291 | Ga0495600_0114553 | 3300046809 | Bacteria | 1755 |
| 292 | Ga0495581_0002299 | 3300047315 | Bacteria | 10757 |
| 293 | Ga0495581_0002775 | 3300047315 | Bacteria | 9983 |
| 294 | Ga0495581_0019034 | 3300047315 | Bacteria | 3985 |
| 295 | Ga0495581_0054978 | 3300047315 | Bacteria | 2298 |
| 296 | Ga0495581_0185453 | 3300047315 | Bacteria | 1217 |
| 297 | Ga0495604_0011850 | 3300047317 | Bacteria | 6935 |
| 298 | Ga0495604_0014338 | 3300047317 | Bacteria | 6321 |
| 299 | Ga0495604_0046981 | 3300047317 | Bacteria | 3364 |
| 300 | Ga0495604_0082023 | 3300047317 | Bacteria | 2412 |
| 301 | Ga0495674_0038651 | 3300047319 | Bacteria | 4282 |
| 302 | Ga0495674_0063624 | 3300047319 | Bacteria | 3209 |
| 303 | Ga0495674_0105839 | 3300047319 | Bacteria | 2389 |
| 304 | Ga0495674_0115657 | 3300047319 | Bacteria | 2270 |
| 305 | Ga0495674_0257805 | 3300047319 | Bacteria | 1433 |
| 306 | Ga0495676_0031958 | 3300047321 | Bacteria | 4447 |
| 307 | Ga0495680_0050328 | 3300047322 | Bacteria | 3258 |
| 308 | Ga0495680_0114952 | 3300047322 | Bacteria | 1991 |
| 309 | Ga0495680_0166939 | 3300047322 | Bacteria | 1595 |
| 310 | Ga0495683_0001104 | 3300047323 | Bacteria | 18634 |
| 311 | Ga0495683_0031813 | 3300047323 | Bacteria | 2688 |
| 312 | Ga0495687_004628 | 3300047443 | Bacteria | 9190 |
| 313 | Ga0495687_009235 | 3300047443 | Bacteria | 5539 |
| 314 | Ga0495687_018725 | 3300047443 | Bacteria | 3414 |
| 315 | Ga0495687_020517 | 3300047443 | Bacteria | 3217 |
| 316 | Ga0495687_030710 | 3300047443 | Bacteria | 2472 |
| 317 | Ga0495675_0034418 | 3300047444 | Bacteria | 3234 |
| 318 | Ga0495675_0087375 | 3300047444 | Bacteria | 1959 |
| 319 | Ga0495675_0100035 | 3300047444 | Bacteria | 1815 |
| 320 | Ga0495675_0112115 | 3300047444 | Bacteria | 1702 |
| 321 | Ga0495675_0138677 | 3300047444 | Bacteria | 1508 |
| 322 | Ga0495685_000495 | 3300047447 | Bacteria | 12193 |
| 323 | Ga0495685_006083 | 3300047447 | Bacteria | 3948 |
| 324 | Ga0495681_0010445 | 3300047470 | Bacteria | 5619 |
| 325 | Ga0495684_0003882 | 3300047471 | Bacteria | 11647 |
| 326 | Ga0495684_0011720 | 3300047471 | Bacteria | 6768 |
| 327 | Ga0495593_0000756 | 3300047673 | Bacteria | 18734 |
| 328 | Ga0495593_0001906 | 3300047673 | Bacteria | 12433 |
| 329 | Ga0495602_0101306 | 3300048088 | Bacteria | 2362 |
| 330 | Ga0495602_0302396 | 3300048088 | Bacteria | 1170 |
| 331 | Ga0495614_0001683 | 3300048089 | Bacteria | 9652 |
| 332 | Ga0495614_0013317 | 3300048089 | Bacteria | 3607 |
| 333 | Ga0495614_0035026 | 3300048089 | Bacteria | 2157 |
| 334 | Ga0495614_0039702 | 3300048089 | Bacteria | 2020 |
| 335 | Ga0496106_0021662 | 3300048909 | Bacteria | 4772 |
| 336 | Ga0496108_0021972 | 3300048911 | Bacteria | 5244 |
| 337 | Ga0496109_0038411 | 3300048912 | Bacteria | 4328 |
| 338 | Ga0496110_0045435 | 3300048913 | Bacteria | 3839 |
| 339 | Ga0496111_0027963 | 3300048914 | Bacteria | 3994 |
| 340 | Ga0496113_0038813 | 3300048916 | Bacteria | 3502 |
| 341 | Ga0496115_0058164 | 3300048918 | Bacteria | 3110 |
| 342 | Ga0496126_0019794 | 3300048929 | Bacteria | 6622 |
| 343 | Ga0501033_0204392 | 3300049570 | Bacteria | 1410 |
| 344 | Ga0501036_0271633 | 3300049572 | Bacteria | 1419 |
| 345 | Ga0501040_0040169 | 3300049576 | Bacteria | 3183 |
| 346 | Ga0501040_0297498 | 3300049576 | Bacteria | 1154 |
| 347 | Ga0501043_0169450 | 3300049579 | Bacteria | 1704 |
| 348 | Ga0501046_0104195 | 3300049580 | Bacteria | 2174 |
| 349 | Ga0501047_0017546 | 3300049581 | Bacteria | 6857 |
| 350 | Ga0501048_0112525 | 3300049582 | Bacteria | 1922 |
| 351 | Ga0501048_0148176 | 3300049582 | Bacteria | 1660 |
| 352 | Ga0501068_0092309 | 3300049584 | Bacteria | 1869 |
| 353 | Ga0501070_0072583 | 3300049586 | Bacteria | 2849 |
| 354 | Ga0501072_0006432 | 3300049588 | Bacteria | 8950 |
| 355 | Ga0501076_0056224 | 3300049592 | Bacteria | 3122 |
| 356 | Ga0501077_0051500 | 3300049593 | Bacteria | 2616 |
| 357 | Ga0501079_0136687 | 3300049741 | Bacteria | 1908 |
| 358 | Ga0501081_0025674 | 3300049743 | Bacteria | 3966 |
| 359 | Ga0501083_0100051 | 3300049744 | Bacteria | 1912 |
| 360 | Ga0501035_0015137 | 3300049822 | Bacteria | 7119 |
| 361 | Ga0501035_0067496 | 3300049822 | Bacteria | 3173 |
| 362 | Ga0501044_0009167 | 3300049823 | Bacteria | 10809 |
| 363 | Ga0501045_0018513 | 3300049824 | Bacteria | 4955 |
| 364 | Ga0501045_0210418 | 3300049824 | Bacteria | 1449 |
| 365 | nmdc:mga0n895_51972_c1 | 3300050512 | Bacteria | 4022 |
| 366 | nmdc:mga08x19_34472_c1 | 3300050514 | Bacteria | 3200 |
| 367 | nmdc:mga0a205_100643_c1 | 3300050515 | Bacteria | 2789 |
| 368 | Ga0495601_0033164 | 3300053077 | Bacteria | 3216 |
| 369 | Ga0495612_0003828 | 3300053078 | Bacteria | 6250 |
| 370 | Ga0495612_0061246 | 3300053078 | Bacteria | 1559 |
| 371 | Ga0495595_0000677 | 3300053084 | Bacteria | 13048 |
| 372 | Ga0495595_0009834 | 3300053084 | Bacteria | 3965 |
| 373 | Ga0495619_0008240 | 3300053085 | Bacteria | 6595 |
| 374 | Ga0500569_008507 | 3300053109 | Bacteria | 2349 |
| 375 | Ga0500580_045801 | 3300053113 | Bacteria | 1847 |
| 376 | Ga0500628_003943 | 3300053129 | Bacteria | 2449 |
| 377 | Ga0500652_002635 | 3300053131 | Bacteria | 5419 |
| 378 | Ga0500658_0005655 | 3300053134 | Bacteria | 4651 |
| 379 | Ga0500616_0109736 | 3300053153 | Bacteria | 1334 |
| 380 | Ga0500633_0000792 | 3300053160 | Bacteria | 5388 |
| 381 | Ga0500587_003566 | 3300053739 | Bacteria | 2169 |
| 382 | Ga0501084_0059552 | 3300054114 | Bacteria | 3196 |
| 383 | Ga0501082_0217502 | 3300060353 | Bacteria | 1662 |
| 384 | 2547411995 | 2547132111 | Bacteria | 8013147 |
| 385 | 2585315169 | 2582581314 | Bacteria | 11452267 |
| 386 | 2616699618 | 2616644814 | Bacteria | 11555299 |
| 387 | 2786667411 | 2786546132 | Bacteria | 10419719 |
| 388 | 2808845914 | 2808606359 | Bacteria | 9866990 |
| 389 | 2808917665 | 2808606375 | Bacteria | 9466072 |
| 390 | 2917736953 | 2917736166 | Bacteria | 9690793 |
| 391 | 2919470732 | 2919468124 | Bacteria | 9133025 |
| 392 | 2954673564 | 2954673503 | Bacteria | 9685905 |
| 393 | 2954690426 | 2954682443 | Bacteria | 9862841 |
| 394 | 2954712637 | 2954711539 | Bacteria | 10867210 |
| 395 | 2954722594 | 2954721474 | Bacteria | 10456478 |
| 396 | 2954739266 | 2954731030 | Bacteria | 10243860 |
| 397 | 2954741473 | 2954740390 | Bacteria | 10229294 |
| 398 | 2954758094 | 2954749733 | Bacteria | 10366972 |
| 399 | 2954760487 | 2954759201 | Bacteria | 9358192 |
| 400 | 8056831294 | 8056829672 | Bacteria | 9045328 |
| 401 | Ga0070706_100029507 | |||
| 402 | Ga0070682_100039370 | |||
| 403 | Ga0068868_100134001 | |||
| 404 | Ga0070709_10001484 | |||
| 405 | Ga0070709_10105580 | |||
| 406 | Ga0070709_10141338 | |||
| 407 | Ga0070714_100023094 | |||
| 408 | Ga0070714_100029459 | |||
| 409 | Ga0070714_100167188 | |||
| 410 | Ga0070714_100302504 | |||
| 411 | Ga0070714_100424189 | |||
| 412 | Ga0070713_100014044 | |||
| 413 | Ga0070710_10001100 | |||
| 414 | Ga0070710_10013436 | |||
| 415 | Ga0070710_10106573 | |||
| 416 | Ga0070710_10212268 | |||
| 417 | Ga0070711_100035929 | |||
| 418 | Ga0070711_100163083 | |||
| 419 | Ga0070711_100185370 | |||
| 420 | Ga0070708_100124811 | |||
| 421 | Ga0070678_100007181 | |||
| 422 | Ga0070706_100002901 | |||
| 423 | Ga0070706_100063659 | |||
| 424 | Ga0070706_100094175 | |||
| 425 | Ga0070707_100000166 | |||
| 426 | Ga0070707_100011896 | |||
| 427 | Ga0070707_100016513 | |||
| 428 | Ga0070698_100000006 | |||
| 429 | Ga0070698_100020871 | |||
| 430 | Ga0070698_100098889 | |||
| 431 | Ga0070679_100224063 | |||
| 432 | Ga0070684_100169977 | |||
| 433 | Ga0070697_100007934 | |||
| 434 | Ga0070697_100036703 | |||
| 435 | Ga0070665_100191364 | |||
| 436 | Ga0068855_100579506 | |||
| 437 | Ga0068856_100033391 | |||
| 438 | Ga0068856_100240332 | |||
| 439 | Ga0068859_100633277 | |||
| 440 | Ga0081455_10116640 | |||
| 441 | Ga0070717_10046333 | |||
| 442 | Ga0070717_10060223 | |||
| 443 | Ga0070717_10391484 | |||
| 444 | Ga0070716_100000846 | |||
| 445 | Ga0070712_100001434 | |||
| 446 | Ga0070712_100038599 | |||
| 447 | Ga0070712_100050582 | |||
| 448 | Ga0070712_100050894 | |||
| 449 | Ga0070712_100052584 | |||
| 450 | Ga0068871_100009662 | |||
| 451 | Ga0075428_100000450 | |||
| 452 | Ga0075433_10024155 | |||
| 453 | Ga0075434_100001250 | |||
| 454 | Ga0075436_100006875 | |||
| 455 | Ga0097620_100633306 | |||
| 456 | Ga0105247_10035633 | |||
| 457 | Ga0105241_10012709 | |||
| 458 | Ga0105242_10547268 | |||
| 459 | Ga0105248_10047818 | |||
| 460 | Ga0105237_10203820 | |||
| 461 | Ga0105238_10120936 | |||
| 462 | Ga0105239_10169794 | |||
| 463 | Ga0157369_10262921 | |||
| 464 | Ga0157374_10309181 | |||
| 465 | Ga0157378_10129230 | |||
| 466 | Ga0157375_10037893 | |||
| 467 | Ga0157379_10066520 | |||
| 468 | Ga0157376_10004270 | |||
| 469 | Ga0207692_10000294 | |||
| 470 | Ga0207692_10046431 | |||
| 471 | Ga0207692_10114957 | |||
| 472 | Ga0207692_10204710 | |||
| 473 | Ga0207710_10019108 | |||
| 474 | Ga0207699_10139739 | |||
| 475 | Ga0207699_10228222 | |||
| 476 | Ga0207684_10002440 | |||
| 477 | Ga0207684_10013843 | |||
| 478 | Ga0207684_10043924 | |||
| 479 | Ga0207684_10054153 | |||
| 480 | Ga0207684_10291773 | |||
| 481 | Ga0207671_10175698 | |||
| 482 | Ga0207693_10051063 | |||
| 483 | Ga0207693_10054650 | |||
| 484 | Ga0207693_10070988 | |||
| 485 | Ga0207663_10018409 | |||
| 486 | Ga0207663_10037133 | |||
| 487 | Ga0207652_10133895 | |||
| 488 | Ga0207646_10000049 | |||
| 489 | Ga0207646_10001629 | |||
| 490 | Ga0207646_10021297 | |||
| 491 | Ga0207700_10002241 | |||
| 492 | Ga0207700_10004441 | |||
| 493 | Ga0207700_10029942 | |||
| 494 | Ga0207700_10084354 | |||
| 495 | Ga0207700_10251693 | |||
| 496 | Ga0207664_10001824 | |||
| 497 | Ga0207664_10016800 | |||
| 498 | Ga0207664_10022938 | |||
| 499 | Ga0207664_10027979 | |||
| 500 | Ga0207665_10000940 | |||
| 501 | Ga0207689_10303752 | |||
| 502 | Ga0207702_10022901 | |||
| 503 | Ga0207702_10041850 | |||
| 504 | Ga0207683_10030860 | |||
| 505 | Ga0268266_10213668 | |||
| 506 | Ga0265337_1000377 | |||
| 507 | Ga0265326_10000999 | |||
| 508 | Ga0265334_10001075 | |||
| 509 | Ga0265336_10001880 | |||
| 510 | Ga0265336_10006331 | |||
| 511 | Ga0265336_10012321 | |||
| 512 | Ga0307517_10048402 | |||
| 513 | Ga0307515_10026647 | |||
| 514 | Ga0307515_10084317 | |||
| 515 | Ga0265338_10003014 | |||
| 516 | Ga0265338_10007749 | |||
| 517 | Ga0265338_10072167 | |||
| 518 | Ga0265324_10006541 | |||
| 519 | Ga0307511_10002580 | |||
| 520 | Ga0265332_10005192 | |||
| 521 | Ga0265320_10020253 | |||
| 522 | Ga0265325_10004192 | |||
| 523 | Ga0265340_10005027 | |||
| 524 | Ga0265339_10009861 | |||
| 525 | Ga0265316_10013754 | |||
| 526 | Ga0307513_10018194 | |||
| 527 | Ga0307509_10004570 | |||
| 528 | Ga0307509_10014847 | |||
| 529 | Ga0307508_10028550 | |||
| 530 | Ga0307514_10033977 | |||
| 531 | Ga0265342_10008936 | |||
| 532 | Ga0307516_10117000 | |||
| 533 | Ga0307518_10061030 | |||
| 534 | Ga0307507_10180775 | |||
| 535 | Ga0307510_10004499 | |||
| 536 | Ga0373926_0019615 | |||
| 537 | Ga0373926_0045479 | |||
| 538 | Ga0373934_0020967 | |||
| 539 | Ga0373934_0030004 | |||
| 540 | Ga0373944_0002013 | |||
| 541 | Ga0373944_0028181 | |||
| 542 | Ga0373923_0002792 | |||
| 543 | Ga0373923_0035787 | |||
| 544 | Ga0373923_0074474 | |||
| 545 | Ga0373936_0013730 | |||
| 546 | Ga0373936_0042101 | |||
| 547 | Ga0373945_0000861 | |||
| 548 | Ga0373953_0038710 | |||
| 549 | Ga0373954_0029836 | |||
| 550 | Ga0373954_0043933 | |||
| 551 | Ga0373954_0116796 | |||
| 552 | Ga0373956_0075725 | |||
| 553 | Ga0373957_0004512 | |||
| 554 | Ga0373946_0000034 | |||
| 555 | Ga0373946_0000467 | |||
| 556 | Ga0373946_0054373 | |||
| 557 | Ga0373955_0022935 | |||
| 558 | Ga0373955_0220218 | |||
| 559 | Ga0373924_0016708 | |||
| 560 | Ga0373924_0017693 | |||
| 561 | Ga0373935_0000871 | |||
| 562 | Ga0373935_0004623 | |||
| 563 | Ga0373935_0018963 | |||
| 564 | Ga0373927_0000594 | |||
| 565 | Ga0373933_0011023 | |||
| 566 | Ga0373933_0049711 | |||
| 567 | Ga0373933_0207924 | |||
| 568 | Ga0373947_0000001 | |||
| 569 | Ga0373947_0008882 | |||
| 570 | Ga0373947_0120537 | |||
| 571 | Ga0373937_0014234 | |||
| 572 | Ga0372808_010510 | |||
| 573 | Ga0373925_0008123 | |||
| 574 | Ga0395898_0239860 | |||
| 575 | Ga0436364_0229196 | |||
| 576 | Ga0436364_0613092 | |||
| 577 | Ga0395901_0078778 | |||
| 578 | Ga0436360_0320843 | |||
| 579 | Ga0436361_1211156 | |||
| 580 | Ga0436363_1454820 | |||
| 581 | Ga0439448_0048365 | |||
| 582 | Ga0450903_000341 | |||
| 583 | Ga0439458_0000336 | |||
| 584 | Ga0466963_0069319 | |||
| 585 | Ga0466968_0036100 | |||
| 586 | Ga0466959_0151364 | |||
| 587 | Ga0466967_0022583 | |||
| 588 | Ga0466967_0239424 | |||
| 589 | Ga0495627_057432 | |||
| 590 | Ga0495592_0030894 | |||
| 591 | Ga0495592_0080101 | |||
| 592 | Ga0495592_0129532 | |||
| 593 | Ga0495592_0150070 | |||
| 594 | Ga0495592_0241171 | |||
| 595 | Ga0495603_0001880 | |||
| 596 | Ga0495603_0010380 | |||
| 597 | Ga0495629_0002265 | |||
| 598 | Ga0495629_0003925 | |||
| 599 | Ga0495629_0025475 | |||
| 600 | Ga0495629_0033792 | |||
| 601 | Ga0495629_0038384 | |||
| 602 | Ga0495641_0002211 | |||
| 603 | Ga0495641_0008628 | |||
| 604 | Ga0495641_0016721 | |||
| 605 | Ga0495651_0001067 | |||
| 606 | Ga0495651_0021268 | |||
| 607 | Ga0495653_0003019 | |||
| 608 | Ga0495653_0005723 | |||
| 609 | Ga0495580_0040735 | |||
| 610 | Ga0495580_0101044 | |||
| 611 | Ga0495582_0004205 | |||
| 612 | Ga0495582_0019526 | |||
| 613 | Ga0495582_0109492 | |||
| 614 | Ga0495662_0002921 | |||
| 615 | Ga0495662_0015480 | |||
| 616 | Ga0495664_0062572 | |||
| 617 | Ga0495664_0134905 | |||
| 618 | Ga0495664_0146000 | |||
| 619 | Ga0495664_0176167 | |||
| 620 | Ga0495585_0004755 | |||
| 621 | Ga0495585_0110265 | |||
| 622 | Ga0495594_0053674 | |||
| 623 | Ga0495594_0075180 | |||
| 624 | Ga0495608_0011925 | |||
| 625 | Ga0495608_0035745 | |||
| 626 | Ga0495608_0072329 | |||
| 627 | Ga0495608_0103601 | |||
| 628 | Ga0495616_0096470 | |||
| 629 | Ga0495618_0019854 | |||
| 630 | Ga0495618_0022197 | |||
| 631 | Ga0495618_0165059 | |||
| 632 | Ga0495620_0014027 | |||
| 633 | Ga0495628_0024917 | |||
| 634 | Ga0495628_0041668 | |||
| 635 | Ga0495628_0168586 | |||
| 636 | Ga0495630_0129481 | |||
| 637 | Ga0495630_0148606 | |||
| 638 | Ga0495643_0005031 | |||
| 639 | Ga0495643_0010828 | |||
| 640 | Ga0495648_0039110 | |||
| 641 | Ga0495652_0061010 | |||
| 642 | Ga0495652_0087222 | |||
| 643 | Ga0495652_0187490 | |||
| 644 | Ga0495665_0013999 | |||
| 645 | Ga0495640_0012981 | |||
| 646 | Ga0495640_0024879 | |||
| 647 | Ga0495586_0010026 | |||
| 648 | Ga0495586_0126288 | |||
| 649 | Ga0495586_0161235 | |||
| 650 | Ga0495586_0185770 | |||
| 651 | Ga0495587_0001989 | |||
| 652 | Ga0495597_0009289 | |||
| 653 | Ga0495645_0032301 | |||
| 654 | Ga0495645_0035896 | |||
| 655 | Ga0495645_0088532 | |||
| 656 | Ga0495645_0100600 | |||
| 657 | Ga0495622_0002062 | |||
| 658 | Ga0495667_0004723 | |||
| 659 | Ga0495634_0000948 | |||
| 660 | Ga0495634_0023083 | |||
| 661 | Ga0495634_0052123 | |||
| 662 | Ga0495625_0039395 | |||
| 663 | Ga0495635_0009602 | |||
| 664 | Ga0495635_0086084 | |||
| 665 | Ga0495635_0168363 | |||
| 666 | Ga0495588_0013619 | |||
| 667 | Ga0495657_0001737 | |||
| 668 | Ga0495657_0004339 | |||
| 669 | Ga0495657_0026685 | |||
| 670 | Ga0495657_0087582 | |||
| 671 | Ga0495599_0052347 | |||
| 672 | Ga0495599_0075223 | |||
| 673 | Ga0495623_0054695 | |||
| 674 | Ga0495646_0002198 | |||
| 675 | Ga0495613_0000794 | |||
| 676 | Ga0495613_0003419 | |||
| 677 | Ga0495613_0039700 | |||
| 678 | Ga0495613_0039870 | |||
| 679 | Ga0495613_0053026 | |||
| 680 | Ga0495613_0097396 | |||
| 681 | Ga0495613_0125303 | |||
| 682 | Ga0495624_0019552 | |||
| 683 | Ga0495624_0026080 | |||
| 684 | Ga0495624_0041569 | |||
| 685 | Ga0495670_0008044 | |||
| 686 | Ga0495671_0087521 | |||
| 687 | Ga0495589_0098347 | |||
| 688 | Ga0495589_0122019 | |||
| 689 | Ga0495600_0003273 | |||
| 690 | Ga0495600_0004938 | |||
| 691 | Ga0495600_0114553 | |||
| 692 | Ga0495581_0002299 | |||
| 693 | Ga0495581_0002775 | |||
| 694 | Ga0495581_0019034 | |||
| 695 | Ga0495581_0054978 | |||
| 696 | Ga0495581_0185453 | |||
| 697 | Ga0495604_0011850 | |||
| 698 | Ga0495604_0014338 | |||
| 699 | Ga0495604_0046981 | |||
| 700 | Ga0495604_0082023 | |||
| 701 | Ga0495674_0038651 | |||
| 702 | Ga0495674_0063624 | |||
| 703 | Ga0495674_0105839 | |||
| 704 | Ga0495674_0115657 | |||
| 705 | Ga0495674_0257805 | |||
| 706 | Ga0495676_0031958 | |||
| 707 | Ga0495680_0050328 | |||
| 708 | Ga0495680_0114952 | |||
| 709 | Ga0495680_0166939 | |||
| 710 | Ga0495683_0001104 | |||
| 711 | Ga0495683_0031813 | |||
| 712 | Ga0495687_004628 | |||
| 713 | Ga0495687_009235 | |||
| 714 | Ga0495687_018725 | |||
| 715 | Ga0495687_020517 | |||
| 716 | Ga0495687_030710 | |||
| 717 | Ga0495675_0034418 | |||
| 718 | Ga0495675_0087375 | |||
| 719 | Ga0495675_0100035 | |||
| 720 | Ga0495675_0112115 | |||
| 721 | Ga0495675_0138677 | |||
| 722 | Ga0495685_000495 | |||
| 723 | Ga0495685_006083 | |||
| 724 | Ga0495681_0010445 | |||
| 725 | Ga0495684_0003882 | |||
| 726 | Ga0495684_0011720 | |||
| 727 | Ga0495593_0000756 | |||
| 728 | Ga0495593_0001906 | |||
| 729 | Ga0495602_0101306 | |||
| 730 | Ga0495602_0302396 | |||
| 731 | Ga0495614_0001683 | |||
| 732 | Ga0495614_0013317 | |||
| 733 | Ga0495614_0035026 | |||
| 734 | Ga0495614_0039702 | |||
| 735 | Ga0496106_0021662 | |||
| 736 | Ga0496108_0021972 | |||
| 737 | Ga0496109_0038411 | |||
| 738 | Ga0496110_0045435 | |||
| 739 | Ga0496111_0027963 | |||
| 740 | Ga0496113_0038813 | |||
| 741 | Ga0496115_0058164 | |||
| 742 | Ga0496126_0019794 | |||
| 743 | Ga0501033_0204392 | |||
| 744 | Ga0501036_0271633 | |||
| 745 | Ga0501040_0040169 | |||
| 746 | Ga0501040_0297498 | |||
| 747 | Ga0501043_0169450 | |||
| 748 | Ga0501046_0104195 | |||
| 749 | Ga0501047_0017546 | |||
| 750 | Ga0501048_0112525 | |||
| 751 | Ga0501048_0148176 | |||
| 752 | Ga0501068_0092309 | |||
| 753 | Ga0501070_0072583 | |||
| 754 | Ga0501072_0006432 | |||
| 755 | Ga0501076_0056224 | |||
| 756 | Ga0501077_0051500 | |||
| 757 | Ga0501079_0136687 | |||
| 758 | Ga0501081_0025674 | |||
| 759 | Ga0501083_0100051 | |||
| 760 | Ga0501035_0015137 | |||
| 761 | Ga0501035_0067496 | |||
| 762 | Ga0501044_0009167 | |||
| 763 | Ga0501045_0018513 | |||
| 764 | Ga0501045_0210418 | |||
| 765 | nmdc:mga0n895_51972_c1 | |||
| 766 | nmdc:mga08x19_34472_c1 | |||
| 767 | nmdc:mga0a205_100643_c1 | |||
| 768 | Ga0495601_0033164 | |||
| 769 | Ga0495612_0003828 | |||
| 770 | Ga0495612_0061246 | |||
| 771 | Ga0495595_0000677 | |||
| 772 | Ga0495595_0009834 | |||
| 773 | Ga0495619_0008240 | |||
| 774 | Ga0500569_008507 | |||
| 775 | Ga0500580_045801 | |||
| 776 | Ga0500628_003943 | |||
| 777 | Ga0500652_002635 | |||
| 778 | Ga0500658_0005655 | |||
| 779 | Ga0500616_0109736 | |||
| 780 | Ga0500633_0000792 | |||
| 781 | Ga0500587_003566 | |||
| 782 | Ga0501084_0059552 | |||
| 783 | Ga0501082_0217502 | |||
| 784 | 2547411995 | |||
| 785 | 2585315169 | |||
| 786 | 2616699618 | |||
| 787 | 2786667411 | |||
| 788 | 2808845914 | |||
| 789 | 2808917665 | |||
| 790 | 2917736953 | |||
| 791 | 2919470732 | |||
| 792 | 2954673564 | |||
| 793 | 2954690426 | |||
| 794 | 2954712637 | |||
| 795 | 2954722594 | |||
| 796 | 2954739266 | |||
| 797 | 2954741473 | |||
| 798 | 2954758094 | |||
| 799 | 2954760487 | |||
| 800 | 8056831294 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1vlv-assembly1.cif.gz_A | crystal structure of ornithine carbamoyltransferase (tm1097) from thermotoga maritima at 2.25 a resolution | 0.9795 | 2 | 328 |
| 4jhx-assembly1.cif.gz_B | crystal structure of anabolic ornithine carbamoyltransferase from vibrio vulnificus in complex with carbamoylphosphate and arginine | 0.9768 | 1 | 330 |
| 1dxh-assembly1.cif.gz_A | catabolic ornithine carbamoyltransferase from pseudomonas aeruginosa | 0.9768 | 1 | 332 |
| 4jhx-assembly1.cif.gz_C | crystal structure of anabolic ornithine carbamoyltransferase from vibrio vulnificus in complex with carbamoylphosphate and arginine | 0.9767 | 1 | 330 |
| 7tmd-assembly1.cif.gz_A | crystal structure of ornithine carbamoyltransferase from klebsiella pneumoniae | 0.9762 | 3 | 330 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FUX8_12_142_3.40.50.1370 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Aspartate/ornithine carbamoyltransferase | 0.9889 | 5 | 134 | 3.40.50.1370 |
| 4anfC01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Aspartate/ornithine carbamoyltransferase | 0.983 | 2 | 146 | 3.40.50.1370 |
| af_Q2FZB0_134_265_3.40.50.1370 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Aspartate/ornithine carbamoyltransferase | 0.98 | 133 | 264 | 3.40.50.1370 |
| af_Q2FUX8_160_269_3.40.50.1370 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Aspartate/ornithine carbamoyltransferase | 0.9754 | 155 | 264 | 3.40.50.1370 |
| af_A0A1D6HKQ0_55_115_3.40.50.1370 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Aspartate/ornithine carbamoyltransferase | 0.9752 | 82 | 140 | 3.40.50.1370 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X8YAG1-F1-model_v4 | Ornithine carbamoyltransferase | 0.9929 | 127 | 331 |
GO:0004585
GO:0016597 GO:0019240 GO:0042450 |
| AF-A0A117R7C7-F1-model_v4 | Ornithine carbamoyltransferase (OTCase) (EC 2.1.3.3) | 0.9925 | 1 | 331 |
GO:0004585
GO:0005737 GO:0016597 GO:0019240 GO:0042450 |
| AF-A0A454W7Z1-F1-model_v4 | Ornithine carbamoyltransferase (OTCase) (EC 2.1.3.3) | 0.9925 | 1 | 331 |
GO:0004585
GO:0005737 GO:0016597 GO:0019240 GO:0042450 |
| AF-A0A397M5A2-F1-model_v4 | deleted | 0.9924 | 1 | 331 |
|
| AF-A0A1Q4V696-F1-model_v4 | Ornithine carbamoyltransferase (OTCase) (EC 2.1.3.3) | 0.9923 | 1 | 332 |
GO:0004585
GO:0005737 GO:0016597 GO:0019240 GO:0042450 |